HHsearch alignment for GI: 254780290 and conserved domain: PRK08703

>PRK08703 short chain dehydrogenase; Provisional.
Probab=94.80  E-value=0.0029  Score=40.71  Aligned_cols=78  Identities=28%  Similarity=0.443  Sum_probs=50.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCC-CC-C--CCC---CCCC---CCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111----2233-22-2--222---2221---111222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL----KLGA-KH-A--INY---LKED---FLEILQKET  210 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~----~lGa-~~-v--i~~---~~~~---~~~~i~~~t  210 (332)
T Consensus         5 ~gK~~lITGas~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~l~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~   84 (239)
T PRK08703          5 SDKTILVTGASQGLGEQVAKAYAAAGATVILVARHQKKLEKVYDAIVEAGHPEPFAIRFDLMSAEEKEFEQFAATIAEAT   84 (239)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             96989994886289999999999879989999798889999999999737995499998505630789999999999983


Q ss_pred             CCCCCCCCCCCCC
Q ss_conf             2221112222111
Q gi|254780290|r  211 QGRGIDIILDMVG  223 (332)
Q Consensus       211 ~g~g~Divid~~G  223 (332)
T Consensus        85 ~G-~lD~lvnnAG   96 (239)
T PRK08703         85 QG-KLDGIVHCAG   96 (239)
T ss_pred             CC-CCCEEEECCC
T ss_conf             79-9768996665