HHsearch alignment for GI: 254780290 and conserved domain: PRK09880

>PRK09880 L-idonate 5-dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=379.99  Aligned_cols=304  Identities=20%  Similarity=0.267  Sum_probs=252.8

Q ss_pred             CCCCEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCC-CCCC-CCCCCCEECCCCCCCCCCCCC
Q ss_conf             77620899991568853079998237877886289999999827878999868-8778-766873003300023222222
Q gi|254780290|r    3 ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKG-LYPP-PKNANPILGLEVAGKIVDLGE   80 (332)
Q Consensus         3 ~~~~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G-~~~~-~~~~p~v~G~e~~G~V~~vG~   80 (332)
T Consensus         1 m~~~~~a~v~~gp~---~~~~~e~~~~~~~-~~vlVkv~~~GICgSDl~~~~~g~~g~~~~~~P~i~GHE~~G~VV~--~   74 (343)
T PRK09880          1 MKVKTQSCVVAGKK---DVAVTEQEIEWNN-NGTLVQITRGGICGSDLHYYQEGKVGNFMIKAPMVLGHEVIGKIVH--S   74 (343)
T ss_pred             CCCEEEEEEEECCC---CEEEEECCCCCCC-CCEEEEEEEEEECHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEEE--C
T ss_conf             98568999998898---6379957989999-9889998089668878998708877886788982603268999993--3


Q ss_pred             CCCCCCCCCCCCCC---------------------------C-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             12222223333221---------------------------1-----223333322111111122222223222122222
Q gi|254780290|r   81 NTTHWNIGDEVCAL---------------------------V-----NGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE  128 (332)
Q Consensus        81 ~v~~~~~GdrV~~~---------------------------~-----~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~  128 (332)
T Consensus        75 ~~~~~kvGDrV~v~~~~~Cg~C~~C~~G~~~~C~~~~~~G~~~~~~~~dGgfaEy~~v~~~~~~~~p~~~~~~~aa-l~e  153 (343)
T PRK09880         75 DSSDLHEGQTVAINPSKPCGHCKYCLSHEENQCTEMRFFGSAMYFPHVDGGFTRYKVVDTAQCIPYPAKADEKVMA-FAE  153 (343)
T ss_pred             CCCCCCCCCEEEECCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHEECCCCCCCHHHHE-ECC
T ss_conf             8998889996998970588997576288855466741411123158878404117863578843366689878833-234


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2333222111222222222222113444443222221222222-221112232211111122332222222221111222
Q gi|254780290|r  129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQ  207 (332)
Q Consensus       129 ~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~  207 (332)
T Consensus       154 pla~a~~a~~-~~~~~~g~~VlV~G-~G~iGl~~~~~ak~~Ga~~Vi~~d~~~~rl~~a~~~Ga~~~i~~~~~~~~~~~~  231 (343)
T PRK09880        154 PLAVAIHAAH-QAGDLQGKRVFISG-VGPIGCLIVSAVKTLGAAEIVCADLSPRSLSLARQMGADVLVNPQNDDMDHWKA  231 (343)
T ss_pred             HHHHHHHHHH-HCCCCCCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEEECCCCCCHHHHHH
T ss_conf             0332302665-24775698899984-776799999999986998799997978999999972997998798743999996


Q ss_pred             CCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHH
Q ss_conf             22222211122221111-11222221122345304798337875432224334305321677751240001137899999
Q gi|254780290|r  208 KETQGRGIDIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSL  286 (332)
Q Consensus       208 ~~t~g~g~Divid~~G~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~  286 (332)
T Consensus       232 ~---~g~~Dvvie~~G~~~~~~~al~~~r~gG~iv~vG~~~--~~~~~~~~~l~~kei~i~Gs~~~~------~----~-  295 (343)
T PRK09880        232 E---KGYFDVSFEVSGHPSSVNTCLEVTRAKGVMVQVGMGG--AMPEFPMMTLISKEISLKGSFRFT------S----E-  295 (343)
T ss_pred             H---CCCCCEEEEECCCHHHHHHHHHHCCCCEEEEEEECCC--CCCCCCHHHHHHCCCEEEEECCCH------H----H-
T ss_conf             3---6997789992199999999997377983999997279--888708999985884999904867------9----9-


Q ss_pred             HHHHHHHHHCCCCC--CCCEEEEEHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             99999999869831--0212474189999999999829981328983
Q gi|254780290|r  287 QLKIWPLLNSHVIA--PVIHTVLPLGKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       287 ~~~~~~~i~~g~l~--p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~  331 (332)
T Consensus       296 ~~~~l~li~~g~i~~~~lIt~~~~le~~~~Af~~a~~~~~~~KV~l~  342 (343)
T PRK09880        296 FNTAVSWLANGVINPLPLLSAEYPFTDLEEALIFAGDKTQAAKVQLV  342 (343)
T ss_pred             HHHHHHHHHCCCCCHHHEEEEEEEHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             99999999859998045588798799999999984287981799997