HHsearch alignment for GI: 254780290 and conserved domain: PRK11036

>PRK11036 putative metallothionein SmtA; Provisional.
Probab=93.73  E-value=0.0053  Score=38.96  Aligned_cols=93  Identities=20%  Similarity=0.274  Sum_probs=59.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---
Q ss_conf             2211344444322222122222222111223221111112----233222222222111122222222211122221---
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQGRGIDIILDM---  221 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~---  221 (332)
T Consensus        46 lrVLDvG~G~G~~a~~lA~~-Gh~Vt~~D~S~~mL~~A~~~a~~~gv~~~~~~v~~~~-q~l~~~~-~~~fDlVlcHaVL  122 (256)
T PRK11036         46 LRVLDAGGGEGQTAIKMAEL-GHQVTLCDLSAEMIQRAKQAAEAKGVSDNMQFIHCAA-QDIAQHL-ETPVDLILFHAVL  122 (256)
T ss_pred             CEEEEECCCCCHHHHHHHHC-CCEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCH-HHHHHHC-CCCCCEEEEEHHH
T ss_conf             83998379877989999977-9979986699999999999988649661279885689-9885423-6886678651367


Q ss_pred             --CC--CCCCCCCCCCCCCCCCCEEEE
Q ss_conf             --11--111222221122345304798
Q gi|254780290|r  222 --VG--AEYLNQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       222 --~G--~~~~~~~~~~l~~~G~iv~~G  244 (332)
T Consensus       123 E~v~dP~~~l~~l~~~lkPGG~lSLmf  149 (256)
T PRK11036        123 EWVADPKSVLQTLWSVLRPGGALSLMF  149 (256)
T ss_pred             HHCCCHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             723789999999999758993799984