HHsearch alignment for GI: 254780290 and conserved domain: PRK12481

>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional.
Probab=94.57  E-value=0.0029  Score=40.72  Aligned_cols=78  Identities=19%  Similarity=0.301  Sum_probs=48.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCC---CCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221--111112233222---2222221----11122222222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK--CLACLKLGAKHA---INYLKED----FLEILQKETQGRGI  215 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~--~~~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g~g~  215 (332)
T Consensus         7 ~gKvalVTGas~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~g--~i   84 (251)
T PRK12481          7 NGKVAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEAPETQAQVEALGRKFHFITADLIQQKDIDSIVSQAVEVMG--HI   84 (251)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCC--CC
T ss_conf             9998999486768999999999986999999789871999999997599479999127999999999999999819--99


Q ss_pred             CCCCCCCCC
Q ss_conf             122221111
Q gi|254780290|r  216 DIILDMVGA  224 (332)
Q Consensus       216 Divid~~G~  224 (332)
T Consensus        85 DilVNNAG~   93 (251)
T PRK12481         85 DILINNAGI   93 (251)
T ss_pred             CEEEECCCC
T ss_conf             899989989