HHsearch alignment for GI: 254780290 and conserved domain: PRK12859

>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.
Probab=90.22  E-value=0.025  Score=34.57  Aligned_cols=35  Identities=20%  Similarity=0.302  Sum_probs=28.5

Q ss_pred             CCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211344--444322222122222222111223
Q gi|254780290|r  145 SGQTVLIHGGS--SGIGTTAIQLASYFGATVYTTAKS  179 (332)
Q Consensus       145 ~g~~vlV~ga~--g~vG~~a~qla~~~G~~vi~~~~~  179 (332)
T Consensus         5 ~gKvalVTGas~~~GIG~aiA~~la~~Ga~Vvi~~~~   41 (257)
T PRK12859          5 KNKVAVVTGVSRLDGIGAAICKELAEAGYDIFFTYWT   41 (257)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEECC
T ss_conf             9888999288999862999999999879989998365