HHsearch alignment for GI: 254780290 and conserved domain: PRK13243

>PRK13243 glyoxylate reductase; Reviewed.
Probab=90.76  E-value=0.22  Score=28.25  Aligned_cols=86  Identities=24%  Similarity=0.343  Sum_probs=51.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-
Q ss_conf             2222221134444432222212222222211122322111111223322222222211112222222221112222111-
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG-  223 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G-  223 (332)
T Consensus       149 ~gktlGIiG-~G~IG~~vak~~~~fgm~V~~~d~~~~-~~~~~~~~~~~~------~l~ell~~------sDiIslh~Pl  214 (333)
T PRK13243        149 YGKTIGIVG-FGRIGQAIARRAKGFGMRILYYSRTRK-PEVEKELGAEYR------PLEDLLRE------SDFVVLAVPL  214 (333)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECCCCC-HHHHHHCCCEEE------CHHHHHHH------CCEEEECCCC
T ss_conf             788999979-256689999999976999999899898-667876096881------19997421------6526642558


Q ss_pred             -CC---CC-CCCCCCCCCCCCCEEEE
Q ss_conf             -11---12-22221122345304798
Q gi|254780290|r  224 -AE---YL-NQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       224 -~~---~~-~~~~~~l~~~G~iv~~G  244 (332)
T Consensus       215 t~eT~~li~~~~~~~MK~~a~lIN~a  240 (333)
T PRK13243        215 TKETYHMINEERLKLMKKTAILVNIA  240 (333)
T ss_pred             CCCCCCCCCHHHHHHCCCCEEEEECC
T ss_conf             60134613699997179981999858