HHsearch alignment for GI: 254780290 and conserved domain: TIGR02818

>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase; InterPro: IPR014183 The members of this protein family show dual function. First, they remove formaldehyde, a toxic metabolite, by acting as S-(hydroxymethyl)glutathione dehydrogenase (1.1.1.284 from EC). S-(hydroxymethyl)glutathione can form spontaneously from formaldehyde and glutathione, and so this enzyme previously was designated glutathione-dependent formaldehyde dehydrogenase. These same proteins are also designated as class III alcohol dehydrogenases (1.1.1.1 from EC), i.e. alcohol dehydrogenases that do not require glutathione and they tend to show poor activity for ethanol among their various substrate alcohols..
Probab=99.97  E-value=1.5e-31  Score=227.84  Aligned_cols=312  Identities=24%  Similarity=0.313  Sum_probs=246.0

Q ss_pred             CEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCC
Q ss_conf             20899991568853079998237877886289999999827878999868877876687300330002322222212222
Q gi|254780290|r    6 KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHW   85 (332)
Q Consensus         6 ~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~   85 (332)
T Consensus         1 k~~a~va~~~~~P--l~~~e~d~~~P~~Gevl~~~~~tGvChtd~ftlsG~d~eG-~fP~~lGheG~G~v~~vGeGv~~~   77 (368)
T TIGR02818         1 KSRAAVAWAAGEP--LKIEEVDVELPKKGEVLVRIVATGVCHTDAFTLSGADPEG-VFPVILGHEGAGIVEAVGEGVTSL   77 (368)
T ss_pred             CCCEEEEECCCCC--EEEEEEECCCCCCCCEEEEEEECCEEECCCEEECCCCCCC-CCEEEECCCCCCEEEECCCCEEEE
T ss_conf             9631465337998--0588741038877716898730230101101323788665-200577136870453306743453


Q ss_pred             CCCCCCCCC------------------------------CC------------------CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             223333221------------------------------12------------------233333221111111222222
Q gi|254780290|r   86 NIGDEVCAL------------------------------VN------------------GGGYAEYCLSHQGHTLPIPKG  117 (332)
Q Consensus        86 ~~GdrV~~~------------------------------~~------------------~G~~ae~~~~~~~~~~~iP~~  117 (332)
T Consensus        78 ~~GdhviPlyt~eC~~C~fC~sGktnlC~~~r~tqG~GlmPd~t~rf~~~G~~i~hymG~stf~ey~v~~e~~l~k~~~~  157 (368)
T TIGR02818        78 KVGDHVIPLYTAECGECKFCKSGKTNLCVAVRETQGKGLMPDGTSRFSKDGQPIYHYMGCSTFSEYTVVPEISLAKINPE  157 (368)
T ss_pred             ECCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCCC
T ss_conf             05863664105455662101356447889998515871156642112216835787613330000124322322010222


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             232221222222333222111222222222222113444443222221222222-2211122322111111223322222
Q gi|254780290|r  118 YNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAIN  196 (332)
Q Consensus       118 ~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~vi~  196 (332)
T Consensus       158 a~~~~vCllGCGvttG~Gav~ntakv~~G~~vavfG-lG~~Gl~~~~Ga~~a~a~ri~a~d~n~~k~~~a~~~Gatd~~n  236 (368)
T TIGR02818       158 APLEKVCLLGCGVTTGIGAVLNTAKVEEGDTVAVFG-LGGIGLSVIQGAKLAKASRIIAIDINPAKFELAKKLGATDLVN  236 (368)
T ss_pred             CCCCCEEEEECCHHHHHHHHHHHHCCCCCCEEEEEE-CCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCCCCC
T ss_conf             452455675264344244553320025787689982-1046778876432203511799831757999997627611217


Q ss_pred             CCCC--CCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCC-CCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEEC
Q ss_conf             2222--111122222222211122221111-1122222112234-53047983378754322243343053216777512
Q gi|254780290|r  197 YLKE--DFLEILQKETQGRGIDIILDMVGA-EYLNQHLTLLSKE-GKLIIISFLGGNIATEINLNPIISKRITITGSTLR  272 (332)
Q Consensus       197 ~~~~--~~~~~i~~~t~g~g~Divid~~G~-~~~~~~~~~l~~~-G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~  272 (332)
T Consensus       237 P~~~~~Pi~~v~~~~~~-~Gvd~~fe~~Gn~~~mr~ale~~h~GWG~s~~iGva~aG~ei~trPfqlvtGr-vW~GsafG  314 (368)
T TIGR02818       237 PKDYDKPIQEVIVELTD-GGVDYSFECIGNVNVMRAALESAHKGWGESIIIGVAGAGQEISTRPFQLVTGR-VWRGSAFG  314 (368)
T ss_pred             CHHHCCHHHHHHHHHHC-CCCCEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCEEEEEEE-EEECCCCC
T ss_conf             52220316666543412-67112431102078999998764126774489984167862223752565310-65032125


Q ss_pred             CCHHCCHHHHHHHHHHHHHHHHHCCCC--CCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             400011378999999999999986983--10212474189999999999829981328983
Q gi|254780290|r  273 RRTDIAKQSIRDSLQLKIWPLLNSHVI--APVIHTVLPLGKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       273 ~~~~~~~~~~~~~~~~~~~~~i~~g~l--~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~  331 (332)
T Consensus       315 GvkG~~------~l-P~~v~~~~~G~~~~~~~~t~t~~l~~~n~af~~mh~Gk~i-r~v~~  367 (368)
T TIGR02818       315 GVKGRT------EL-PGIVEQYMKGEIALDDFVTHTMPLEDINEAFDLMHEGKSI-RTVIH  367 (368)
T ss_pred             CCCCCC------CC-HHHHHHHHCCCEEEHHHHHHCCCHHHHHHHHHHHHCCCEE-EEEEC
T ss_conf             545621------00-2688877336312034554203678999999887558523-54531