HHsearch alignment for GI: 254780290 and conserved domain: TIGR03649

>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family. This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.
Probab=95.44  E-value=0.0024  Score=41.26  Aligned_cols=96  Identities=15%  Similarity=0.262  Sum_probs=54.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCC-
Q ss_conf             22211344444322222122222222111223221111112233222222222111122222222--211122221111-
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQG--RGIDIILDMVGA-  224 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g--~g~Divid~~G~-  224 (332)
T Consensus         1 TIlVtGATG~iG~~v~~~L~~~g~~v~~~~R~~~~~~~~~~~~v~--~d~~d~~~~~~a~~~~d~~~~~v~~v~l~~p~~   78 (285)
T TIGR03649         1 TILLTGGTGKTASRIARLLQAASVPFLVASRSSSSSAGPNEKHVK--FDWLDEDTWDNPFSSDDGMEPEISAVYLVAPPI   78 (285)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCEEE--EECCCCCCHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             989998998189999999986899789995885664666675368--644481148889763532312741899838998


Q ss_pred             -C---CCCCCCCCCCCCC--CCEEEEE
Q ss_conf             -1---1222221122345--3047983
Q gi|254780290|r  225 -E---YLNQHLTLLSKEG--KLIIISF  245 (332)
Q Consensus       225 -~---~~~~~~~~l~~~G--~iv~~G~  245 (332)
T Consensus        79 ~~~~~~~~~~i~aA~~aGV~~iV~lS~  105 (285)
T TIGR03649        79 PDLAPPMIKFIDFARSKGVRRFVLLSA  105 (285)
T ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             776789999999999849988999830