Query         gi|254780290|ref|YP_003064703.1| quinone oxidoreductase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 332
No_of_seqs    143 out of 15578
Neff          9.0 
Searched_HMMs 39220
Date          Tue May 24 17:17:11 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780290.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR02824 quinone_pig3 putativ 100.0       0       0  629.6  11.7  325    7-331     1-333 (334)
  2 PRK10754 quinone oxidoreductas 100.0       0       0  505.4  14.7  323    6-332     1-327 (327)
  3 COG0604 Qor NADPH:quinone redu 100.0       0       0  477.4  13.1  321    7-332     1-326 (326)
  4 COG1064 AdhP Zn-dependent alco 100.0       0       0  456.8  13.7  309    4-332     1-337 (339)
  5 PRK13771 putative alcohol dehy 100.0       0       0  453.2  13.1  305    7-332     1-332 (332)
  6 PRK09422 alcohol dehydrogenase 100.0       0       0  443.8  13.1  306    7-331     1-335 (338)
  7 KOG1197 consensus              100.0       0       0  442.4   9.7  327    2-332     4-330 (336)
  8 smart00829 PKS_ER Enoylreducta 100.0       0       0  444.2   7.8  286   37-330     1-288 (288)
  9 TIGR03451 mycoS_dep_FDH mycoth 100.0       0       0  436.1  13.9  313    6-331     1-357 (358)
 10 PRK05396 tdh L-threonine 3-deh 100.0       0       0  435.3  12.7  307    7-331     1-339 (341)
 11 TIGR01751 crot-CoA-red crotony 100.0       0       0  431.5   4.8  317    2-329     3-395 (409)
 12 PRK10309 galactitol-1-phosphat 100.0       0       0  418.3  14.2  311    7-331     1-345 (347)
 13 PRK10083 putative dehydrogenas 100.0       0       0  411.2  12.7  303    7-331     1-336 (339)
 14 TIGR02817 adh_fam_1 zinc-bindi 100.0       0       0  415.1   4.0  317    8-331     1-336 (338)
 15 TIGR03201 dearomat_had 6-hydro 100.0       0       0  400.7  11.8  305   10-332     2-349 (349)
 16 TIGR02823 oxido_YhdH putative  100.0       0       0  389.5   9.0  314    8-331     1-329 (330)
 17 KOG0023 consensus              100.0       0       0  381.1  14.3  309    1-330     4-352 (360)
 18 TIGR00692 tdh L-threonine 3-de 100.0       0       0  388.9   7.7  298   19-332     9-341 (341)
 19 PRK09880 L-idonate 5-dehydroge 100.0       0       0  380.0  14.2  304    3-331     1-342 (343)
 20 COG1062 AdhC Zn-dependent alco 100.0       0       0  368.4  12.2  311    6-331     2-365 (366)
 21 KOG1198 consensus              100.0       0       0  351.6  13.0  323    4-332     2-345 (347)
 22 KOG0024 consensus              100.0       0       0  352.7  10.6  312    3-332     1-352 (354)
 23 KOG0025 consensus              100.0       0       0  337.6  10.9  328    1-331    14-351 (354)
 24 COG1063 Tdh Threonine dehydrog 100.0       0       0  328.1  11.1  309    7-332     1-350 (350)
 25 KOG0022 consensus              100.0       0       0  323.0  11.7  313    5-331     6-374 (375)
 26 COG2130 Putative NADP-dependen 100.0 1.4E-45       0  319.5  10.8  320    2-331     3-337 (340)
 27 KOG1202 consensus              100.0 5.7E-44       0  309.9   9.5  304   16-331  1424-1740(2376)
 28 TIGR03366 HpnZ_proposed putati 100.0 3.9E-39 9.9E-44  278.0   0.3  233   66-312     1-280 (280)
 29 KOG1196 consensus              100.0 6.8E-36 1.7E-40  256.5  10.6  312    7-331     4-339 (343)
 30 TIGR02818 adh_III_F_hyde S-(hy 100.0 1.5E-31 3.8E-36  227.8   8.2  312    6-331     1-367 (368)
 31 TIGR01202 bchC Chlorophyll syn 100.0 1.6E-28 4.1E-33  207.8   7.3  300    6-330     1-324 (325)
 32 TIGR02825 B4_12hDH leukotriene  99.9 6.7E-28 1.7E-32  203.7   2.1  310    8-331     4-327 (327)
 33 TIGR02822 adh_fam_2 zinc-bindi  99.9 3.3E-27 8.5E-32  199.1   3.6  297    9-330     1-333 (334)
 34 pfam08240 ADH_N Alcohol dehydr  99.7   3E-18 7.6E-23  139.8   4.0   81   33-114     1-108 (108)
 35 pfam00107 ADH_zinc_N Zinc-bind  99.7 3.4E-18 8.6E-23  139.5   1.7  119  157-276     1-121 (131)
 36 TIGR02819 fdhA_non_GSH formald  99.7 1.9E-17 4.8E-22  134.6   4.9  310    7-332     3-399 (403)
 37 pfam11017 DUF2855 Protein of u  98.3 3.2E-07 8.1E-12   66.9   2.6  238   71-324    37-312 (314)
 38 CHL00194 ycf39 Ycf39; Provisio  97.8 6.3E-06 1.6E-10   58.3   0.8   99  147-250     1-115 (319)
 39 PRK06953 short chain dehydroge  97.4 1.1E-05 2.8E-10   56.7  -2.4   77  147-223     2-79  (222)
 40 COG0300 DltE Short-chain dehyd  97.4 1.1E-05 2.9E-10   56.6  -2.3  111  144-254     4-152 (265)
 41 PRK05993 short chain dehydroge  97.4 1.6E-05 4.1E-10   55.6  -1.8  106  146-252     4-142 (277)
 42 PRK05693 short chain dehydroge  97.3 1.5E-05 3.8E-10   55.9  -2.5  104  147-252     2-137 (274)
 43 PRK06182 short chain dehydroge  97.3 1.6E-05 4.2E-10   55.6  -2.3  105  145-251     2-139 (273)
 44 PRK08306 dipicolinate synthase  97.3   8E-05 2.1E-09   51.0   0.7  181   66-265    63-258 (296)
 45 PRK09424 pntA NAD(P) transhydr  97.2 0.00021 5.3E-09   48.3   2.8  148  145-295   164-336 (510)
 46 pfam02353 CMAS Cyclopropane-fa  97.2 3.3E-05 8.3E-10   53.6  -1.4  101  136-244    53-166 (273)
 47 PRK08177 short chain dehydroge  97.2 2.5E-05 6.5E-10   54.3  -2.4   77  147-223     2-80  (225)
 48 PRK09072 short chain dehydroge  97.1 2.4E-05 6.2E-10   54.4  -3.0  106  145-250     4-143 (262)
 49 PRK08263 short chain dehydroge  97.0 5.1E-05 1.3E-09   52.3  -2.2  103  146-250     3-141 (275)
 50 PRK06500 short chain dehydroge  97.0 5.1E-05 1.3E-09   52.3  -2.5  180  145-330     5-241 (249)
 51 PRK06077 fabG 3-ketoacyl-(acyl  96.9 0.00062 1.6E-08   45.1   2.5  181  145-330     2-237 (249)
 52 PRK06914 short chain dehydroge  96.9 4.9E-05 1.2E-09   52.4  -3.2  107  146-252     3-147 (280)
 53 PRK05565 fabG 3-ketoacyl-(acyl  96.8 0.00077   2E-08   44.5   2.5  177  145-330     4-240 (247)
 54 PRK08017 short chain dehydroge  96.8 8.3E-05 2.1E-09   50.9  -2.6   76  147-223     3-83  (256)
 55 KOG1014 consensus               96.8 0.00014 3.6E-09   49.4  -1.5   80  144-224    47-136 (312)
 56 PRK07201 short chain dehydroge  96.8 8.9E-05 2.3E-09   50.7  -2.5   77  145-223   375-462 (663)
 57 PRK06101 short chain dehydroge  96.7 0.00011 2.7E-09   50.2  -2.4   44  147-190     2-45  (241)
 58 PRK07109 short chain dehydroge  96.7   1E-04 2.5E-09   50.4  -2.8  106  144-251     6-150 (338)
 59 PRK05872 short chain dehydroge  96.7 0.00011 2.9E-09   50.0  -2.6  173  145-323     8-234 (296)
 60 PRK06139 short chain dehydroge  96.6 0.00015 3.8E-09   49.2  -2.3   78  145-224     5-93  (324)
 61 PRK11705 cyclopropane fatty ac  96.6 0.00015 3.7E-09   49.3  -2.4   96  136-244   158-267 (383)
 62 PRK07326 short chain dehydroge  96.6 0.00011 2.9E-09   50.1  -3.0  103  145-249     4-143 (235)
 63 pfam01262 AlaDh_PNT_C Alanine   96.6 0.00031 7.9E-09   47.1  -0.8   98  141-246    16-123 (150)
 64 PRK06181 short chain dehydroge  96.6  0.0001 2.7E-09   50.2  -3.2   76  146-223     1-87  (263)
 65 PRK05866 short chain dehydroge  96.6 0.00011 2.8E-09   50.1  -3.2   79  145-223    39-126 (290)
 66 TIGR01983 UbiG ubiquinone bios  96.6 0.00022 5.7E-09   48.1  -1.7   95  144-242    83-194 (275)
 67 TIGR01829 AcAcCoA_reduct aceto  96.6 0.00037 9.5E-09   46.6  -0.6  165  149-323     3-227 (244)
 68 COG4221 Short-chain alcohol de  96.6 0.00016 4.2E-09   48.9  -2.4  107  145-251     5-146 (246)
 69 PRK06200 2,3-dihydroxy-2,3-dih  96.5 0.00016 4.2E-09   49.0  -2.6   77  145-223     5-89  (263)
 70 PRK06180 short chain dehydroge  96.5 0.00013 3.2E-09   49.7  -3.2  103  145-249     3-141 (277)
 71 PRK06128 oxidoreductase; Provi  96.5 0.00023 5.9E-09   48.0  -2.0  182  140-330    50-292 (300)
 72 PRK12742 oxidoreductase; Provi  96.5 0.00033 8.5E-09   46.9  -1.4  175  145-330     5-230 (237)
 73 TIGR01137 cysta_beta cystathio  96.4 0.00067 1.7E-08   44.9   0.1  105  138-244    56-212 (527)
 74 PRK13944 protein-L-isoaspartat  96.4 0.00037 9.5E-09   46.6  -1.2  113  124-243    53-172 (205)
 75 PRK11873 arsM arsenite S-adeno  96.4 0.00042 1.1E-08   46.3  -0.9  122  108-245    46-180 (258)
 76 PRK06482 short chain dehydroge  96.4 0.00017 4.2E-09   48.9  -3.2  104  147-250     3-140 (276)
 77 PRK08267 short chain dehydroge  96.4 0.00017 4.2E-09   48.9  -3.3  104  147-250     2-141 (258)
 78 COG2518 Pcm Protein-L-isoaspar  96.4 0.00055 1.4E-08   45.5  -0.6  110  125-243    54-168 (209)
 79 PRK07832 short chain dehydroge  96.4 0.00027 6.8E-09   47.6  -2.3   76  147-224     1-88  (272)
 80 COG2230 Cfa Cyclopropane fatty  96.4 0.00041   1E-08   46.3  -1.4  108  133-248    60-180 (283)
 81 pfam01135 PCMT Protein-L-isoas  96.4 0.00052 1.3E-08   45.6  -0.9  112  124-243    54-172 (205)
 82 PRK07024 short chain dehydroge  96.4 0.00021 5.4E-09   48.2  -2.9   75  147-223     3-86  (256)
 83 PRK13394 3-hydroxybutyrate deh  96.3 0.00028   7E-09   47.5  -2.3  103  145-249     6-148 (262)
 84 PRK07806 short chain dehydroge  96.3 0.00024 6.2E-09   47.8  -2.6  100  145-246     5-136 (248)
 85 TIGR03325 BphB_TodD cis-2,3-di  96.3 0.00022 5.7E-09   48.1  -3.0   77  145-223     4-88  (262)
 86 PRK06484 short chain dehydroge  96.3 0.00029 7.5E-09   47.3  -2.4  181  144-330   272-508 (530)
 87 PRK06125 short chain dehydroge  96.3 0.00027   7E-09   47.5  -2.5   78  145-224     6-91  (259)
 88 PRK07666 fabG 3-ketoacyl-(acyl  96.3 0.00031   8E-09   47.1  -2.3   78  145-224     5-93  (238)
 89 PRK07825 short chain dehydroge  96.2 0.00024 6.2E-09   47.8  -3.0  104  145-250     4-142 (273)
 90 PRK06194 hypothetical protein;  96.2  0.0003 7.8E-09   47.2  -2.6   78  145-224     5-93  (301)
 91 PRK13943 protein-L-isoaspartat  96.2 0.00064 1.6E-08   45.1  -1.0  114  122-243    54-174 (317)
 92 PRK07578 short chain dehydroge  96.2  0.0015 3.9E-08   42.6   0.8   88  148-248     2-115 (199)
 93 PRK06841 short chain dehydroge  96.2 0.00034 8.6E-09   46.9  -2.7  178  145-330    14-247 (255)
 94 PRK06398 aldose dehydrogenase;  96.2 0.00056 1.4E-08   45.4  -1.6   99  145-249     5-136 (256)
 95 cd01078 NAD_bind_H4MPT_DH NADP  96.1  0.0043 1.1E-07   39.6   2.9   90  145-240    27-124 (194)
 96 PRK06179 short chain dehydroge  96.1 0.00043 1.1E-08   46.2  -2.3  103  145-250     3-137 (270)
 97 PRK06720 hypothetical protein;  96.1 0.00047 1.2E-08   45.9  -2.1   48  145-192    15-66  (169)
 98 PRK07060 short chain dehydroge  96.1 0.00047 1.2E-08   46.0  -2.1  179  145-330     8-237 (245)
 99 PRK06484 short chain dehydroge  96.1 0.00033 8.4E-09   47.0  -2.9   56  187-242   295-351 (530)
100 PRK05855 short chain dehydroge  96.1 0.00041   1E-08   46.3  -2.5   78  145-224   314-402 (582)
101 PRK07067 sorbitol dehydrogenas  96.1 0.00038 9.6E-09   46.6  -2.7  104  145-250     4-144 (256)
102 PRK07985 oxidoreductase; Provi  96.1 0.00056 1.4E-08   45.4  -1.9  186  139-330    43-286 (294)
103 TIGR01963 PHB_DH 3-hydroxybuty  96.1 0.00076 1.9E-08   44.6  -1.3  176  146-328     1-248 (258)
104 PRK12428 3-alpha-hydroxysteroi  96.1 0.00076 1.9E-08   44.6  -1.3   96  145-245     4-117 (261)
105 pfam05368 NmrA NmrA-like famil  96.1 0.00076 1.9E-08   44.6  -1.3   71  149-224     1-74  (232)
106 PRK08251 short chain dehydroge  96.0 0.00028 7.2E-09   47.4  -3.5   75  147-223     3-90  (248)
107 PRK07062 short chain dehydroge  96.0 0.00039 9.9E-09   46.5  -2.9  103  145-249     7-150 (265)
108 PRK08862 short chain dehydroge  96.0 0.00041 1.1E-08   46.3  -2.8   79  145-224     4-93  (227)
109 PRK09291 short chain dehydroge  96.0 0.00062 1.6E-08   45.2  -2.0  102  146-251     2-138 (257)
110 PRK12826 3-ketoacyl-(acyl-carr  96.0 0.00041   1E-08   46.3  -2.9  179  145-330     5-244 (253)
111 PRK06483 short chain dehydroge  96.0 0.00044 1.1E-08   46.1  -2.8   76  146-223     2-83  (236)
112 PRK13942 protein-L-isoaspartat  96.0 0.00084 2.1E-08   44.3  -1.4  111  125-243    58-175 (214)
113 PRK07523 gluconate 5-dehydroge  96.0 0.00047 1.2E-08   46.0  -2.7  179  145-330     8-242 (251)
114 PRK07041 short chain dehydroge  96.0 0.00052 1.3E-08   45.6  -2.5   77  145-223     6-88  (240)
115 KOG1205 consensus               96.0  0.0026 6.6E-08   41.0   1.0  108  145-254    11-159 (282)
116 PRK08217 fabG 3-ketoacyl-(acyl  95.9 0.00043 1.1E-08   46.2  -3.0   77  145-223     4-91  (253)
117 PRK05134 3-demethylubiquinone-  95.9 0.00092 2.4E-08   44.0  -1.3   95  144-243    47-150 (233)
118 PRK05650 short chain dehydroge  95.9 0.00053 1.4E-08   45.6  -2.6  102  148-251     2-142 (270)
119 PRK08277 D-mannonate oxidoredu  95.9 0.00048 1.2E-08   45.9  -2.9   77  145-223     9-96  (278)
120 TIGR03206 benzo_BadH 2-hydroxy  95.9 0.00053 1.4E-08   45.6  -2.6  181  145-330     2-243 (250)
121 PRK08317 hypothetical protein;  95.9 0.00074 1.9E-08   44.6  -1.9  103  137-244    11-124 (241)
122 PRK07775 short chain dehydroge  95.9 0.00039   1E-08   46.5  -3.4  104  145-248     9-149 (275)
123 PRK05653 fabG 3-ketoacyl-(acyl  95.9 0.00047 1.2E-08   45.9  -3.0  177  145-330     4-239 (246)
124 PRK08220 2,3-dihydroxybenzoate  95.9 0.00063 1.6E-08   45.1  -2.4  179  145-330     7-244 (253)
125 PTZ00098 phosphoethanolamine N  95.8  0.0027 6.8E-08   40.9   0.7  105  137-246    44-158 (263)
126 PRK07424 bifunctional sterol d  95.8  0.0016   4E-08   42.5  -0.5   41  145-185   179-219 (410)
127 COG3967 DltE Short-chain dehyd  95.8 0.00083 2.1E-08   44.3  -1.9   77  145-223     4-87  (245)
128 PRK08324 short chain dehydroge  95.8 0.00057 1.5E-08   45.4  -2.7  250   61-330   343-665 (676)
129 PRK06172 short chain dehydroge  95.8 0.00068 1.7E-08   44.9  -2.4  178  145-330     6-245 (253)
130 PRK07576 short chain dehydroge  95.8 0.00058 1.5E-08   45.3  -2.8  179  145-330     7-244 (260)
131 PRK12829 short chain dehydroge  95.8 0.00056 1.4E-08   45.4  -2.9   77  145-223    10-95  (264)
132 PRK06124 gluconate 5-dehydroge  95.8 0.00061 1.5E-08   45.2  -2.8  183  139-330     8-250 (259)
133 PRK07890 short chain dehydroge  95.8 0.00069 1.8E-08   44.8  -2.5  181  145-330     4-250 (258)
134 PRK07102 short chain dehydroge  95.8  0.0005 1.3E-08   45.8  -3.3   76  147-223     2-85  (243)
135 PRK10538 3-hydroxy acid dehydr  95.7 0.00066 1.7E-08   45.0  -2.8  101  148-250     2-139 (248)
136 PRK05854 short chain dehydroge  95.7 0.00093 2.4E-08   44.0  -2.0   78  145-224    13-103 (314)
137 PRK08265 short chain dehydroge  95.7  0.0006 1.5E-08   45.2  -3.0  181  145-330     5-239 (261)
138 PRK08264 short chain dehydroge  95.7  0.0013 3.2E-08   43.1  -1.4   75  145-223     4-79  (235)
139 PRK07231 fabG 3-ketoacyl-(acyl  95.7  0.0006 1.5E-08   45.2  -3.0  180  145-330     5-243 (250)
140 PRK06196 oxidoreductase; Provi  95.7  0.0011 2.7E-08   43.5  -1.8   91  130-224    12-109 (316)
141 PRK08339 short chain dehydroge  95.7 0.00072 1.8E-08   44.7  -2.7   80  145-224     7-95  (263)
142 TIGR01777 yfcH conserved hypot  95.7  0.0034 8.7E-08   40.3   0.8   85  149-235     1-89  (307)
143 PRK06197 short chain dehydroge  95.7   0.001 2.6E-08   43.7  -1.9   84  138-224     9-105 (306)
144 PRK01683 trans-aconitate 2-met  95.7  0.0016   4E-08   42.4  -1.0   97  138-242    24-128 (252)
145 PRK05557 fabG 3-ketoacyl-(acyl  95.6 0.00079   2E-08   44.5  -2.6  177  145-330     4-240 (248)
146 PRK07677 short chain dehydroge  95.6 0.00071 1.8E-08   44.7  -2.9   78  145-224     2-90  (254)
147 PRK06227 consensus              95.6 0.00091 2.3E-08   44.0  -2.3  180  145-330     4-243 (256)
148 PRK07063 short chain dehydroge  95.6   0.001 2.7E-08   43.7  -2.1   78  145-224     6-95  (259)
149 PRK07577 short chain dehydroge  95.6  0.0013 3.2E-08   43.1  -1.6  176  145-330     2-227 (234)
150 PRK09242 tropinone reductase;   95.6 0.00061 1.5E-08   45.2  -3.3  181  145-330     9-248 (258)
151 PRK08085 gluconate 5-dehydroge  95.6 0.00086 2.2E-08   44.2  -2.5  179  145-330     8-245 (254)
152 PRK08226 short chain dehydroge  95.6 0.00065 1.7E-08   45.0  -3.2   78  145-224     5-92  (263)
153 PRK12937 short chain dehydroge  95.6  0.0011 2.8E-08   43.4  -2.0  177  145-330     4-239 (245)
154 PRK12823 benD 1,6-dihydroxycyc  95.6 0.00069 1.8E-08   44.8  -3.1   78  145-224     7-94  (260)
155 PRK08213 gluconate 5-dehydroge  95.6 0.00072 1.8E-08   44.7  -3.0   83  139-224     6-99  (259)
156 PRK12429 3-hydroxybutyrate deh  95.5 0.00094 2.4E-08   44.0  -2.5  103  145-249     3-144 (258)
157 PRK07776 consensus              95.5 0.00075 1.9E-08   44.6  -3.0  177  145-330     7-240 (252)
158 PRK07856 short chain dehydroge  95.5  0.0013 3.4E-08   42.9  -1.8  177  145-330     7-235 (254)
159 PRK07478 short chain dehydroge  95.5 0.00079   2E-08   44.4  -3.0   77  145-223     5-92  (254)
160 TIGR03466 HpnA hopanoid-associ  95.5  0.0017 4.3E-08   42.3  -1.3   11  312-322   315-325 (328)
161 PRK12939 short chain dehydroge  95.5 0.00095 2.4E-08   43.9  -2.6  178  145-330     6-242 (250)
162 PRK00312 pcm protein-L-isoaspa  95.5  0.0013 3.4E-08   43.0  -1.9  110  125-243    60-174 (213)
163 PRK06113 7-alpha-hydroxysteroi  95.5 0.00083 2.1E-08   44.3  -3.0  178  145-330    10-245 (255)
164 PRK05867 short chain dehydroge  95.5 0.00092 2.3E-08   44.0  -2.8   81  140-223     4-95  (253)
165 PRK06057 short chain dehydroge  95.5 0.00081 2.1E-08   44.4  -3.1   77  145-223     6-88  (255)
166 PRK07479 consensus              95.5 0.00086 2.2E-08   44.2  -3.0   77  145-223     4-91  (252)
167 TIGR03649 ergot_EASG ergot alk  95.4  0.0024 6.1E-08   41.3  -0.8   96  148-245     1-105 (285)
168 PRK07074 short chain dehydroge  95.4 0.00098 2.5E-08   43.8  -2.8  181  146-330     2-235 (256)
169 PRK07774 short chain dehydroge  95.4 0.00089 2.3E-08   44.1  -3.0   77  145-223     5-92  (250)
170 PRK06171 sorbitol-6-phosphate   95.4  0.0014 3.5E-08   42.9  -2.1   75  145-223     8-86  (266)
171 PRK07454 short chain dehydroge  95.4  0.0014 3.5E-08   42.9  -2.1  104  144-249     4-146 (241)
172 PRK00216 ubiE ubiquinone/menaq  95.4  0.0021 5.4E-08   41.6  -1.2  105  137-246    43-160 (239)
173 PRK05876 short chain dehydroge  95.3  0.0011 2.9E-08   43.4  -2.6   77  145-223     5-92  (275)
174 PRK05717 oxidoreductase; Valid  95.3 0.00099 2.5E-08   43.8  -3.0  178  145-330     9-242 (255)
175 TIGR02632 RhaD_aldol-ADH rhamn  95.3  0.0026 6.7E-08   41.0  -0.9  215   97-329   386-697 (709)
176 PRK06523 short chain dehydroge  95.2  0.0019 4.8E-08   42.0  -1.8   75  145-223     8-86  (260)
177 PRK08278 short chain dehydroge  95.2  0.0013 3.3E-08   43.1  -2.7   77  145-223     5-99  (273)
178 PRK07814 short chain dehydroge  95.2  0.0012 3.1E-08   43.2  -2.8  184  139-330     4-246 (263)
179 PRK07035 short chain dehydroge  95.2  0.0012 3.1E-08   43.2  -2.9  179  145-330     7-245 (252)
180 PRK12384 sorbitol-6-phosphate   95.2  0.0012   3E-08   43.3  -3.0  180  146-330     2-251 (259)
181 PRK12825 fabG 3-ketoacyl-(acyl  95.2   0.002 5.2E-08   41.7  -1.8  177  145-330     6-242 (250)
182 PRK08628 short chain dehydroge  95.1  0.0017 4.3E-08   42.3  -2.3  182  145-330     6-245 (258)
183 PRK06935 2-deoxy-D-gluconate 3  95.1  0.0019 4.9E-08   41.9  -2.0  183  140-330    10-250 (258)
184 PRK00377 cbiT cobalt-precorrin  95.1  0.0028 7.1E-08   40.8  -1.2  104  139-246    34-147 (198)
185 PRK07097 gluconate 5-dehydroge  95.1  0.0013 3.3E-08   43.0  -2.9  181  145-330     9-252 (265)
186 PRK06463 fabG 3-ketoacyl-(acyl  95.1  0.0014 3.7E-08   42.7  -2.7  102  145-248     6-140 (254)
187 PRK05786 fabG 3-ketoacyl-(acyl  95.1  0.0022 5.5E-08   41.5  -1.8  171  145-330     4-230 (238)
188 PRK06550 fabG 3-ketoacyl-(acyl  95.0  0.0027 6.9E-08   40.9  -1.5  176  145-330     4-229 (237)
189 PRK12746 short chain dehydroge  95.0  0.0017 4.4E-08   42.2  -2.5  180  145-330     5-247 (254)
190 PRK07402 precorrin-6B methylas  95.0  0.0044 1.1E-07   39.5  -0.4  103  139-246    34-144 (196)
191 PRK06949 short chain dehydroge  95.0  0.0019 4.7E-08   42.0  -2.4   78  145-224     8-96  (258)
192 PRK06138 short chain dehydroge  95.0  0.0016   4E-08   42.5  -2.8  178  145-330     4-244 (252)
193 PRK12744 short chain dehydroge  95.0  0.0019 4.8E-08   42.0  -2.5   99  145-245     7-146 (257)
194 PRK06114 short chain dehydroge  95.0  0.0022 5.6E-08   41.5  -2.1   77  145-223    15-103 (262)
195 PRK07533 enoyl-(acyl carrier p  95.0  0.0019 4.7E-08   42.0  -2.5  179  145-330     5-245 (254)
196 PRK05599 hypothetical protein;  95.0  0.0014 3.7E-08   42.7  -3.1   74  147-223     1-86  (246)
197 PRK12367 short chain dehydroge  94.9  0.0052 1.3E-07   39.0  -0.3   39  143-181    14-52  (250)
198 PRK07453 protochlorophyllide o  94.9  0.0024 6.2E-08   41.2  -2.0   77  146-224     6-93  (322)
199 PRK08589 short chain dehydroge  94.9  0.0012 3.1E-08   43.2  -3.5  104  145-250     5-146 (272)
200 PRK08219 short chain dehydroge  94.9  0.0019 4.9E-08   41.9  -2.5  100  147-249     4-132 (226)
201 PRK08993 2-deoxy-D-gluconate 3  94.9  0.0019 4.8E-08   41.9  -2.6   80  141-223     6-94  (253)
202 COG2519 GCD14 tRNA(1-methylade  94.9  0.0037 9.3E-08   40.0  -1.2  103  138-246    87-197 (256)
203 PRK12828 short chain dehydroge  94.9  0.0018 4.5E-08   42.1  -2.8  104  145-250     6-146 (239)
204 PRK06346 consensus              94.8  0.0016 4.1E-08   42.4  -3.1  181  145-330     4-244 (251)
205 PRK12747 short chain dehydroge  94.8  0.0035   9E-08   40.1  -1.4  179  145-329     3-244 (252)
206 PRK08703 short chain dehydroge  94.8  0.0029 7.4E-08   40.7  -1.9   78  145-223     5-96  (239)
207 PRK06505 enoyl-(acyl carrier p  94.8   0.002 5.2E-08   41.7  -2.7   79  143-223     4-94  (271)
208 TIGR02853 spore_dpaA dipicolin  94.8  0.0056 1.4E-07   38.8  -0.4   94  145-248   151-245 (288)
209 pfam08704 GCD14 tRNA methyltra  94.8  0.0048 1.2E-07   39.3  -0.8  107  137-246    94-210 (309)
210 PRK06701 short chain dehydroge  94.7  0.0021 5.4E-08   41.6  -2.7  197  108-329    23-279 (289)
211 PRK08063 enoyl-(acyl carrier p  94.7  0.0021 5.2E-08   41.7  -2.8  178  145-330     3-241 (250)
212 COG2242 CobL Precorrin-6B meth  94.7   0.005 1.3E-07   39.1  -0.8  102  139-246    28-137 (187)
213 PRK12936 3-ketoacyl-(acyl-carr  94.7  0.0021 5.3E-08   41.7  -2.9  177  145-330     5-237 (245)
214 PRK08945 short chain dehydroge  94.7  0.0032 8.2E-08   40.4  -1.9   78  144-223    11-102 (245)
215 PRK12743 acetoin dehydrogenase  94.6  0.0033 8.3E-08   40.4  -1.9  176  146-330     2-238 (253)
216 PRK08936 glucose-1-dehydrogena  94.6  0.0034 8.6E-08   40.3  -1.9  179  145-330     6-245 (261)
217 TIGR01830 3oxo_ACP_reduc 3-oxo  94.6  0.0028 7.2E-08   40.8  -2.3  168  149-329     1-231 (238)
218 PRK06198 short chain dehydroge  94.6  0.0028 7.3E-08   40.8  -2.3  181  145-330     5-249 (268)
219 PRK12481 2-deoxy-D-gluconate 3  94.6  0.0029 7.4E-08   40.7  -2.3   78  145-224     7-93  (251)
220 PRK05884 short chain dehydroge  94.6  0.0022 5.6E-08   41.5  -3.0   54  148-201     2-57  (223)
221 TIGR00507 aroE shikimate 5-deh  94.6  0.0031 7.8E-08   40.5  -2.2  124  106-243    83-225 (286)
222 PRK07831 short chain dehydroge  94.6  0.0029 7.5E-08   40.7  -2.3   79  144-224    14-106 (261)
223 PRK08415 enoyl-(acyl carrier p  94.5  0.0025 6.4E-08   41.1  -2.7  102  145-248     4-147 (274)
224 PRK07792 fabG 3-ketoacyl-(acyl  94.5  0.0029 7.5E-08   40.7  -2.4   79  145-224     8-96  (303)
225 PRK08642 fabG 3-ketoacyl-(acyl  94.4  0.0029 7.3E-08   40.7  -2.7   78  145-223     5-91  (254)
226 PRK07889 enoyl-(acyl carrier p  94.4  0.0029 7.4E-08   40.7  -2.7   78  144-223     5-93  (256)
227 PRK06603 enoyl-(acyl carrier p  94.3  0.0032 8.2E-08   40.4  -2.6  180  144-330     6-247 (260)
228 pfam01596 Methyltransf_3 O-met  94.3  0.0021 5.5E-08   41.6  -3.5  102  139-242    38-152 (204)
229 PRK08643 acetoin reductase; Va  94.2  0.0029 7.5E-08   40.7  -2.9   77  146-224     2-89  (256)
230 PRK12827 short chain dehydroge  94.2  0.0046 1.2E-07   39.4  -2.0  177  145-330     5-245 (251)
231 PRK05875 short chain dehydroge  94.2  0.0048 1.2E-07   39.3  -1.9   79  145-223     6-96  (277)
232 PRK07904 short chain dehydroge  94.1  0.0046 1.2E-07   39.4  -2.1   79  145-223     7-96  (253)
233 pfam01488 Shikimate_DH Shikima  94.1  0.0062 1.6E-07   38.5  -1.6   72  145-225    11-86  (134)
234 PRK08303 short chain dehydroge  94.0  0.0035 8.9E-08   40.2  -2.9   77  145-223     7-104 (305)
235 KOG1502 consensus               94.0  0.0073 1.9E-07   38.1  -1.3   46  145-190     5-53  (327)
236 COG1748 LYS9 Saccharopine dehy  94.0  0.0045 1.2E-07   39.4  -2.3   11  290-300   339-349 (389)
237 PRK12824 acetoacetyl-CoA reduc  93.9  0.0051 1.3E-07   39.1  -2.2  176  146-330     2-237 (245)
238 COG4122 Predicted O-methyltran  93.9  0.0048 1.2E-07   39.3  -2.3  102  138-242    52-164 (219)
239 PRK08159 enoyl-(acyl carrier p  93.8  0.0041   1E-07   39.7  -2.8  182  142-330     6-249 (272)
240 PRK06079 enoyl-(acyl carrier p  93.8   0.004   1E-07   39.8  -2.9  180  144-330     5-244 (252)
241 KOG0725 consensus               93.8  0.0048 1.2E-07   39.3  -2.5   79  145-224     7-99  (270)
242 COG2226 UbiE Methylase involve  93.8  0.0072 1.8E-07   38.1  -1.6  105  137-247    43-159 (238)
243 PRK09186 flagellin modificatio  93.7  0.0066 1.7E-07   38.3  -1.9   77  145-223     3-91  (255)
244 PRK07791 short chain dehydroge  93.7  0.0046 1.2E-07   39.4  -2.7   77  145-223     5-101 (285)
245 PRK11036 putative metallothion  93.7  0.0053 1.4E-07   39.0  -2.4   93  149-244    46-149 (256)
246 PRK09135 pteridine reductase;   93.7  0.0047 1.2E-07   39.3  -2.7  103  145-249     5-147 (249)
247 PRK08261 fabG 3-ketoacyl-(acyl  93.6  0.0049 1.3E-07   39.2  -2.7  107  142-248   203-343 (447)
248 PRK09009 C factor cell-cell si  93.6  0.0095 2.4E-07   37.3  -1.3   72  148-223     2-76  (235)
249 PRK06947 glucose-1-dehydrogena  93.6  0.0061 1.6E-07   38.5  -2.3   77  145-223     5-93  (252)
250 PRK07707 consensus              93.5  0.0065 1.7E-07   38.4  -2.2  177  146-330     2-232 (239)
251 pfam01370 Epimerase NAD depend  93.4    0.01 2.6E-07   37.1  -1.3   72  149-223     1-74  (235)
252 PRK08287 cobalt-precorrin-6Y C  93.4   0.018 4.5E-07   35.5  -0.2  100  139-246    24-132 (186)
253 PRK12935 acetoacetyl-CoA reduc  93.3   0.006 1.5E-07   38.6  -2.6  102  145-248     5-146 (247)
254 COG2910 Putative NADH-flavin r  93.3   0.015 3.8E-07   36.0  -0.6   92  148-247     2-107 (211)
255 TIGR01289 LPOR light-dependent  93.3   0.012 3.1E-07   36.5  -1.1   46  146-191     3-50  (321)
256 PRK12938 acetyacetyl-CoA reduc  93.3  0.0067 1.7E-07   38.3  -2.5  177  145-330     2-238 (246)
257 PRK06997 enoyl-(acyl carrier p  93.2  0.0065 1.7E-07   38.4  -2.6   78  144-223     4-93  (260)
258 PRK06123 short chain dehydroge  93.2  0.0078   2E-07   37.9  -2.3   76  146-223     3-90  (249)
259 PRK08340 glucose-1-dehydrogena  93.1   0.009 2.3E-07   37.5  -2.0   74  148-223     2-85  (259)
260 PRK03369 murD UDP-N-acetylmura  93.1   0.014 3.7E-07   36.1  -1.0   19  312-330   439-457 (487)
261 pfam01209 Ubie_methyltran ubiE  93.1    0.01 2.6E-07   37.1  -1.8  104  137-246    39-155 (233)
262 PRK12745 3-ketoacyl-(acyl-carr  93.0   0.007 1.8E-07   38.2  -2.7   76  146-223     5-92  (259)
263 PRK08655 prephenate dehydrogen  92.9   0.015 3.8E-07   36.0  -1.1   24   29-52     80-103 (441)
264 pfam01113 DapB_N Dihydrodipico  92.8   0.023 5.8E-07   34.8  -0.3   97  148-248     2-99  (122)
265 PRK07984 enoyl-(acyl carrier p  92.6   0.008   2E-07   37.8  -2.8   78  144-223     4-93  (262)
266 KOG1201 consensus               92.6   0.014 3.5E-07   36.3  -1.7  104  145-250    37-178 (300)
267 PRK06924 short chain dehydroge  92.5   0.019 4.8E-07   35.3  -1.0   37  147-183     2-38  (251)
268 pfam08659 KR KR domain. This e  92.5  0.0085 2.2E-07   37.6  -2.9   74  148-223     2-90  (181)
269 smart00828 PKS_MT Methyltransf  92.5   0.015 3.8E-07   36.0  -1.6   94  148-247     2-107 (224)
270 pfam00106 adh_short short chai  92.4   0.013 3.3E-07   36.4  -2.0   76  147-224     1-90  (167)
271 PRK09134 short chain dehydroge  92.4  0.0087 2.2E-07   37.5  -2.9   79  144-224     7-97  (256)
272 PRK00048 dihydrodipicolinate r  92.3   0.028 7.2E-07   34.2  -0.4   29  148-176     4-33  (265)
273 pfam06325 PrmA Ribosomal prote  92.3   0.015 3.8E-07   36.0  -1.9  144   85-247   108-261 (294)
274 COG0144 Sun tRNA and rRNA cyto  92.1   0.036 9.1E-07   33.5  -0.0   97  139-241   150-285 (355)
275 COG0702 Predicted nucleoside-d  92.1   0.028 7.3E-07   34.1  -0.6   70  148-223     2-72  (275)
276 PRK00258 aroE shikimate 5-dehy  92.1   0.023 5.8E-07   34.8  -1.1   99  136-243   112-217 (275)
277 PRK10901 16S rRNA methyltransf  92.0   0.027   7E-07   34.3  -0.7   98  139-241   239-370 (428)
278 PRK07023 short chain dehydroge  92.0   0.025 6.3E-07   34.5  -1.0   37  146-182     1-37  (243)
279 COG1090 Predicted nucleoside-d  92.0   0.051 1.3E-06   32.5   0.6   32  150-181     2-33  (297)
280 pfam08241 Methyltransf_11 Meth  91.8   0.026 6.5E-07   34.5  -1.0   82  157-241     6-94  (95)
281 TIGR01139 cysK cysteine syntha  91.8   0.024 6.1E-07   34.6  -1.2  187  138-330    51-296 (312)
282 PRK08690 enoyl-(acyl carrier p  91.8   0.013 3.3E-07   36.4  -2.6   80  144-223     4-93  (261)
283 TIGR01136 cysKM cysteine synth  91.7   0.024 6.2E-07   34.6  -1.3  105  138-244    54-203 (315)
284 KOG1210 consensus               91.7   0.021 5.3E-07   35.0  -1.6   80  143-224    30-122 (331)
285 PRK07370 enoyl-(acyl carrier p  91.6   0.013 3.3E-07   36.4  -2.7  179  145-330     6-249 (259)
286 PRK07069 short chain dehydroge  91.5   0.017 4.4E-07   35.6  -2.2  100  148-249     1-142 (251)
287 COG0686 Ald Alanine dehydrogen  91.4   0.053 1.3E-06   32.4   0.2   96  143-246   166-270 (371)
288 KOG1208 consensus               91.4   0.027   7E-07   34.2  -1.3   43  145-187    34-76  (314)
289 TIGR01318 gltD_gamma_fam gluta  91.4   0.073 1.9E-06   31.4   0.9   51  145-196   291-350 (480)
290 PRK06940 short chain dehydroge  91.3   0.015 3.7E-07   36.1  -2.8   77  147-224     5-89  (277)
291 TIGR02356 adenyl_thiF thiazole  91.2   0.028 7.2E-07   34.2  -1.4   32  146-178    21-53  (210)
292 PRK08594 enoyl-(acyl carrier p  91.1   0.027 6.8E-07   34.3  -1.6   39  145-183     5-45  (256)
293 COG2521 Predicted archaeal met  90.9   0.047 1.2E-06   32.7  -0.4  115  140-258   129-259 (287)
294 TIGR01934 MenG_MenH_UbiE ubiqu  90.9   0.038 9.7E-07   33.3  -0.9  117  143-264    41-182 (242)
295 pfam00670 AdoHcyase_NAD S-aden  90.9   0.042 1.1E-06   33.0  -0.7  109  134-259    10-121 (162)
296 cd01065 NAD_bind_Shikimate_DH   90.8   0.023 5.9E-07   34.7  -2.1   81  136-224     9-91  (155)
297 pfam02475 Met_10 Met-10+ like-  90.8   0.034 8.7E-07   33.6  -1.2   93  142-240    97-197 (199)
298 PRK00536 speE spermidine synth  90.8   0.027 6.9E-07   34.3  -1.8   93  147-243    74-170 (262)
299 smart00822 PKS_KR This enzymat  90.8   0.021 5.3E-07   35.0  -2.4   77  148-224     2-91  (180)
300 PRK13243 glyoxylate reductase;  90.8    0.22 5.6E-06   28.3   2.9   86  145-244   149-240 (333)
301 TIGR01138 cysM cysteine syntha  90.6    0.12   3E-06   30.1   1.3  130  138-270    54-202 (300)
302 TIGR01035 hemA glutamyl-tRNA r  90.4   0.032   8E-07   33.8  -1.7   74  143-225   183-262 (436)
303 PRK00045 hemA glutamyl-tRNA re  90.3   0.024 6.2E-07   34.6  -2.3   71  145-225   181-253 (429)
304 COG2227 UbiG 2-polyprenyl-3-me  90.3   0.037 9.4E-07   33.4  -1.4   92  145-242    59-159 (243)
305 PRK12859 3-ketoacyl-(acyl-carr  90.2   0.025 6.3E-07   34.6  -2.4   35  145-179     5-41  (257)
306 PRK02472 murD UDP-N-acetylmura  90.2   0.035 8.9E-07   33.6  -1.6   22  309-330   398-419 (450)
307 TIGR02469 CbiT precorrin-6Y C5  90.0   0.077   2E-06   31.3  -0.0  102  139-243    13-132 (135)
308 cd05213 NAD_bind_Glutamyl_tRNA  89.9   0.026 6.7E-07   34.4  -2.4   72  145-226   177-250 (311)
309 PRK09730 hypothetical protein;  89.8   0.028 7.2E-07   34.2  -2.3  174  148-330     3-242 (247)
310 pfam05175 MTS Methyltransferas  89.7   0.053 1.4E-06   32.4  -1.0  104  139-249    25-145 (170)
311 KOG1122 consensus               89.3    0.15 3.7E-06   29.5   1.0  137   98-241   196-368 (460)
312 PRK01438 murD UDP-N-acetylmura  89.2   0.057 1.5E-06   32.1  -1.2   22  309-330   427-448 (481)
313 KOG1252 consensus               89.2   0.057 1.5E-06   32.2  -1.2   57  139-195    96-155 (362)
314 COG0451 WcaG Nucleoside-diphos  89.1   0.082 2.1E-06   31.1  -0.4   36  149-184     3-38  (314)
315 PRK12748 3-ketoacyl-(acyl-carr  89.0   0.045 1.2E-06   32.8  -1.8  173  145-330     4-249 (257)
316 TIGR02355 moeB molybdopterin s  88.9     0.2   5E-06   28.6   1.4   32  145-177    23-55  (240)
317 PRK10217 dTDP-glucose 4,6-dehy  88.8   0.061 1.5E-06   32.0  -1.3   10    7-16      1-10  (355)
318 pfam03435 Saccharop_dh Sacchar  88.8   0.036 9.1E-07   33.5  -2.5   32  290-321   343-378 (384)
319 TIGR03589 PseB UDP-N-acetylglu  88.7   0.073 1.9E-06   31.5  -0.9   74  145-223     3-83  (324)
320 KOG1207 consensus               88.7    0.07 1.8E-06   31.6  -1.0   42  145-186     6-47  (245)
321 pfam09445 Methyltransf_15 RNA   88.4   0.055 1.4E-06   32.3  -1.7   70  151-221     4-78  (165)
322 TIGR01296 asd_B aspartate-semi  88.3    0.14 3.5E-06   29.6   0.3   90  148-247     1-96  (350)
323 COG3288 PntA NAD/NADP transhyd  88.1     0.4   1E-05   26.6   2.5  129  141-270   159-308 (356)
324 pfam02558 ApbA Ketopantoate re  88.1   0.088 2.3E-06   30.9  -0.8   95  149-245     1-101 (150)
325 KOG1209 consensus               88.0    0.12 3.2E-06   29.9  -0.1   77  146-223     7-90  (289)
326 KOG1270 consensus               87.9   0.091 2.3E-06   30.8  -0.8   89  146-243    90-194 (282)
327 COG0111 SerA Phosphoglycerate   87.9    0.59 1.5E-05   25.4   3.3   33  145-178   141-173 (324)
328 PRK08416 7-alpha-hydroxysteroi  87.8   0.056 1.4E-06   32.2  -2.0   76  145-222     7-95  (260)
329 PRK06130 3-hydroxybutyryl-CoA   87.8    0.22 5.6E-06   28.3   1.0   39  147-186     6-44  (310)
330 KOG1611 consensus               87.7     0.1 2.6E-06   30.4  -0.6   78  147-224     4-94  (249)
331 PRK10675 UDP-galactose-4-epime  87.7    0.06 1.5E-06   32.0  -1.9   17  307-323   316-333 (338)
332 pfam01564 Spermine_synth Sperm  87.6   0.071 1.8E-06   31.5  -1.6   95  146-244    76-189 (240)
333 COG0031 CysK Cysteine synthase  87.4   0.086 2.2E-06   31.0  -1.2   60  138-198    54-116 (300)
334 PRK08040 putative semialdehyde  87.3    0.13 3.3E-06   29.8  -0.3   16  104-119    92-107 (337)
335 KOG1203 consensus               87.2    0.14 3.7E-06   29.5  -0.1   43  145-187    78-121 (411)
336 PRK05476 S-adenosyl-L-homocyst  87.1    0.11 2.7E-06   30.4  -0.9  102  132-246   193-297 (427)
337 PRK11933 yebU rRNA (cytosine-C  87.1    0.12   3E-06   30.0  -0.6   16  146-161   184-199 (471)
338 cd02440 AdoMet_MTases S-adenos  86.8   0.085 2.2E-06   31.0  -1.5   90  149-243     2-103 (107)
339 PRK08410 2-hydroxyacid dehydro  86.7    0.78   2E-05   24.6   3.4   35  145-180   144-178 (311)
340 PRK08309 short chain dehydroge  86.4    0.34 8.6E-06   27.0   1.4   95  148-243     2-108 (182)
341 COG2264 PrmA Ribosomal protein  86.2    0.15 3.8E-06   29.4  -0.5  148   85-247   109-266 (300)
342 PRK11761 cysM cysteine synthas  85.8    0.12 3.1E-06   30.0  -1.2   57  138-195    55-114 (296)
343 pfam08242 Methyltransf_12 Meth  85.7   0.084 2.2E-06   31.0  -2.0   82  156-240     5-98  (98)
344 PRK06901 aspartate-semialdehyd  85.6    0.14 3.5E-06   29.6  -0.9   15  104-118    91-105 (323)
345 cd00401 AdoHcyase S-adenosyl-L  85.6    0.11 2.7E-06   30.3  -1.5  105  130-247   185-292 (413)
346 COG2520 Predicted methyltransf  85.3    0.26 6.7E-06   27.8   0.4   99  143-246   186-291 (341)
347 PRK07531 bifunctional 3-hydrox  85.3     1.1 2.7E-05   23.8   3.5   23   31-53    103-125 (489)
348 COG0421 SpeE Spermidine syntha  85.3    0.12   3E-06   30.0  -1.4   95  144-243    76-189 (282)
349 PRK08229 2-dehydropantoate 2-r  85.3    0.12 3.1E-06   30.0  -1.3   10  292-301   314-323 (341)
350 pfam02882 THF_DHG_CYH_C Tetrah  85.3    0.18 4.5E-06   28.9  -0.5   96  124-246    14-110 (159)
351 PRK05447 1-deoxy-D-xylulose 5-  85.2   0.061 1.5E-06   32.0  -2.9   14   33-46     25-38  (379)
352 PRK13581 D-3-phosphoglycerate   85.2     0.9 2.3E-05   24.2   3.1   46  145-192   137-182 (524)
353 PRK07580 Mg-protoporphyrin IX   85.1    0.17 4.4E-06   29.0  -0.6   68  145-221    63-134 (230)
354 TIGR00446 nop2p NOL1/NOP2/sun   84.8    0.26 6.7E-06   27.8   0.2   88   97-195    32-131 (284)
355 KOG1663 consensus               84.5   0.063 1.6E-06   31.9  -3.1  101  142-242    70-181 (237)
356 pfam05221 AdoHcyase S-adenosyl  84.5    0.14 3.6E-06   29.6  -1.3  102  132-246   195-299 (430)
357 PRK04308 murD UDP-N-acetylmura  84.3    0.16   4E-06   29.2  -1.1   21  310-330   397-417 (445)
358 PRK09853 putative selenate red  84.1    0.12   3E-06   30.0  -1.8   35  143-178   676-712 (1032)
359 PRK11207 tellurite resistance   84.1    0.24   6E-06   28.1  -0.3   95  143-246    29-136 (198)
360 PRK01390 murD UDP-N-acetylmura  84.0    0.15 3.8E-06   29.4  -1.4   25  306-330   403-428 (457)
361 PRK06719 precorrin-2 dehydroge  84.0    0.65 1.7E-05   25.2   1.9   88  145-243    12-99  (157)
362 PRK12767 carbamoyl phosphate s  83.8    0.14 3.5E-06   29.6  -1.6   10    8-17      2-11  (325)
363 TIGR00417 speE spermidine synt  83.7    0.27   7E-06   27.6  -0.1  105  134-243    67-194 (284)
364 TIGR01317 GOGAT_sm_gam glutama  83.6    0.24   6E-06   28.1  -0.5   36  144-180   149-184 (517)
365 COG1091 RfbD dTDP-4-dehydrorha  83.2    0.21 5.3E-06   28.4  -0.9   32  148-180     2-33  (281)
366 PRK11188 rrmJ 23S rRNA methylt  83.2    0.23 5.9E-06   28.1  -0.6   17  227-243   148-164 (209)
367 KOG4022 consensus               83.1    0.17 4.3E-06   29.0  -1.4   73  147-224     4-82  (236)
368 COG1028 FabG Dehydrogenases wi  83.1    0.24 6.2E-06   28.0  -0.6   37  145-181     4-40  (251)
369 TIGR01181 dTDP_gluc_dehyt dTDP  83.0    0.25 6.3E-06   27.9  -0.6   41  148-188     1-48  (340)
370 pfam01189 Nol1_Nop2_Fmu NOL1/N  82.7    0.26 6.7E-06   27.8  -0.6   52  142-195    81-138 (277)
371 TIGR01832 kduD 2-deoxy-D-gluco  82.6    0.14 3.6E-06   29.5  -1.9   76  145-223     4-90  (249)
372 PRK11908 NAD-dependent epimera  82.1    0.23 5.7E-06   28.2  -1.1   22  308-329   323-345 (347)
373 TIGR01809 Shik-DH-AROM shikima  82.1    0.31   8E-06   27.2  -0.3   76  146-223   130-206 (291)
374 PRK03806 murD UDP-N-acetylmura  82.0    0.25 6.3E-06   27.9  -0.9   34  213-246   311-347 (438)
375 cd01080 NAD_bind_m-THF_DH_Cycl  82.0    0.24 6.2E-06   28.0  -0.9   95  125-246    23-118 (168)
376 PRK06728 aspartate-semialdehyd  81.9    0.26 6.6E-06   27.8  -0.8   12  105-116    95-106 (347)
377 TIGR01369 CPSaseII_lrg carbamo  81.9     3.6 9.1E-05   20.3   5.0   33  234-271   647-681 (1089)
378 COG0136 Asd Aspartate-semialde  81.6    0.31 7.9E-06   27.3  -0.5   15  104-118    92-106 (334)
379 KOG1199 consensus               81.6    0.27 6.8E-06   27.7  -0.8   50  146-195     9-59  (260)
380 PRK00811 spermidine synthase;   81.4    0.15 3.9E-06   29.3  -2.1   94  146-243    79-192 (283)
381 PRK06932 glycerate dehydrogena  81.1     2.1 5.4E-05   21.8   3.6   33  145-178   146-178 (314)
382 PRK10258 biotin biosynthesis p  80.9    0.29 7.4E-06   27.5  -0.8   95  142-244    39-140 (251)
383 PTZ00075 S-adenosyl-L-homocyst  80.9    0.33 8.5E-06   27.1  -0.5  103  131-246   238-343 (476)
384 PRK12815 carB carbamoyl phosph  80.8     3.8 9.8E-05   20.1   4.9   86  218-315   612-699 (1068)
385 TIGR03315 Se_ygfK putative sel  80.8    0.18 4.5E-06   28.9  -2.0   34  144-178   664-699 (1012)
386 PRK13940 glutamyl-tRNA reducta  80.8    0.21 5.4E-06   28.4  -1.6   73  145-226   180-254 (414)
387 PRK03612 spermidine synthase;   80.7    0.23   6E-06   28.1  -1.4   95  146-244   294-411 (516)
388 PRK13984 putative oxidoreducta  80.7    0.23 5.7E-06   28.2  -1.5   74  144-223   281-377 (604)
389 PRK05600 thiamine biosynthesis  80.6    0.22 5.6E-06   28.3  -1.5   23  148-171    43-65  (370)
390 KOG4169 consensus               80.6    0.22 5.6E-06   28.3  -1.5  105  146-252     5-144 (261)
391 cd05212 NAD_bind_m-THF_DH_Cycl  80.4    0.46 1.2E-05   26.1   0.1   83  138-246    19-102 (140)
392 PRK07066 3-hydroxybutyryl-CoA   80.3     0.3 7.8E-06   27.3  -0.9   33  148-181     9-41  (321)
393 PRK10717 cysteine synthase A;   79.7    0.23   6E-06   28.1  -1.6   57  138-195    56-115 (334)
394 pfam02254 TrkA_N TrkA-N domain  79.7    0.23 5.9E-06   28.1  -1.7   71  149-225     1-72  (115)
395 PRK00517 prmA ribosomal protei  79.6    0.23 5.8E-06   28.2  -1.7  145   85-247   110-264 (298)
396 PTZ00079 NADP-specific glutama  79.5    0.21 5.3E-06   28.4  -1.9   40  139-179   245-284 (469)
397 cd01487 E1_ThiF_like E1_ThiF_l  79.2    0.18 4.7E-06   28.8  -2.3   28  148-176     1-29  (174)
398 PRK00141 murD UDP-N-acetylmura  78.8    0.35 8.9E-06   26.9  -1.0   22  309-330   419-440 (476)
399 PRK01710 murD UDP-N-acetylmura  78.7    0.28 7.2E-06   27.5  -1.5   25  306-330   406-430 (458)
400 cd01075 NAD_bind_Leu_Phe_Val_D  78.5    0.25 6.5E-06   27.9  -1.8   69  145-225    27-96  (200)
401 PRK12550 shikimate 5-dehydroge  78.5    0.25 6.3E-06   27.9  -1.8   70  140-223   116-187 (272)
402 PRK08644 thiamine biosynthesis  78.4    0.25 6.3E-06   28.0  -1.9   30  146-176    27-57  (209)
403 PRK13685 hypothetical protein;  77.7    0.28 7.1E-06   27.6  -1.8   93   84-177   124-235 (326)
404 PRK05671 aspartate-semialdehyd  77.6    0.49 1.3E-05   26.0  -0.5   14    3-16      1-14  (336)
405 pfam03848 TehB Tellurite resis  77.3    0.55 1.4E-05   25.7  -0.4   97  143-247    29-136 (192)
406 PRK08294 phenol 2-monooxygenas  77.2    0.57 1.4E-05   25.5  -0.3   18  315-332   588-606 (634)
407 pfam00389 2-Hacid_dh D-isomer   77.2     2.9 7.5E-05   20.8   3.4   35  145-180   136-170 (313)
408 COG0373 HemA Glutamyl-tRNA red  77.1    0.27 6.8E-06   27.7  -2.0   71  145-225   177-249 (414)
409 PRK12809 putative oxidoreducta  77.1    0.26 6.7E-06   27.7  -2.0   31  146-177   310-340 (639)
410 COG0169 AroE Shikimate 5-dehyd  76.9    0.35   9E-06   26.9  -1.4   71  144-224   124-200 (283)
411 PRK04690 murD UDP-N-acetylmura  76.9    0.47 1.2E-05   26.1  -0.8   22  309-330   405-427 (468)
412 pfam07021 MetW Methionine bios  76.7    0.56 1.4E-05   25.6  -0.4   91  143-240    11-105 (193)
413 PRK09414 glutamate dehydrogena  76.7    0.26 6.7E-06   27.8  -2.1   34  145-179   228-261 (446)
414 pfam05724 TPMT Thiopurine S-me  76.6    0.59 1.5E-05   25.4  -0.3  100  140-244    17-140 (203)
415 cd00755 YgdL_like Family of ac  76.5    0.33 8.5E-06   27.1  -1.6   29  146-175    11-40  (231)
416 KOG0069 consensus               76.4    0.51 1.3E-05   25.9  -0.7   89  143-244   159-253 (336)
417 COG1086 Predicted nucleoside-d  76.3    0.56 1.4E-05   25.6  -0.5   39  145-184   249-289 (588)
418 pfam01118 Semialdhyde_dh Semia  76.2    0.52 1.3E-05   25.8  -0.7   89  148-239     1-91  (121)
419 PRK04148 hypothetical protein;  76.2    0.63 1.6E-05   25.3  -0.3   32  164-195    33-64  (135)
420 pfam02826 2-Hacid_dh_C D-isome  75.4    0.52 1.3E-05   25.8  -0.9   86  145-245    35-126 (176)
421 pfam01210 NAD_Gly3P_dh_N NAD-d  75.4    0.42 1.1E-05   26.4  -1.4   93  147-243     1-103 (159)
422 KOG3010 consensus               75.0    0.69 1.8E-05   25.0  -0.3  103  139-245    26-138 (261)
423 PRK02006 murD UDP-N-acetylmura  75.0    0.47 1.2E-05   26.1  -1.2   21  310-330   445-465 (501)
424 PRK07411 hypothetical protein;  75.0    0.49 1.3E-05   25.9  -1.1   11   35-45     81-91  (390)
425 PRK02947 hypothetical protein;  74.9    0.94 2.4E-05   24.1   0.3   71  136-223    98-171 (247)
426 PRK06545 prephenate dehydrogen  74.5    0.18 4.6E-06   28.9  -3.4   11   89-99     62-72  (357)
427 pfam01073 3Beta_HSD 3-beta hyd  74.4    0.39   1E-05   26.6  -1.7   29  150-178     1-31  (280)
428 KOG3201 consensus               74.3    0.46 1.2E-05   26.2  -1.4  114  131-248    16-144 (201)
429 cd01076 NAD_bind_1_Glu_DH NAD(  74.3    0.29 7.5E-06   27.4  -2.4   35  144-179    29-63  (227)
430 PRK06849 hypothetical protein;  74.2    0.35   9E-06   26.9  -2.0   11  211-221   253-263 (387)
431 COG0334 GdhA Glutamate dehydro  74.1    0.45 1.2E-05   26.2  -1.5   36  145-181   206-241 (411)
432 PRK12778 putative bifunctional  74.0    0.67 1.7E-05   25.1  -0.6   33  145-178   438-470 (760)
433 PRK06718 precorrin-2 dehydroge  73.7     1.5 3.7E-05   22.8   1.1   91  145-243     9-99  (202)
434 PRK05597 molybdopterin biosynt  73.7     0.5 1.3E-05   25.9  -1.3   13   35-47     71-83  (355)
435 PRK08639 threonine dehydratase  73.4       1 2.6E-05   23.9   0.2   32  147-178   179-212 (418)
436 PRK12749 quinate/shikimate deh  73.3    0.67 1.7E-05   25.1  -0.7   41  145-186   123-164 (288)
437 cd05313 NAD_bind_2_Glu_DH NAD(  73.2    0.37 9.3E-06   26.8  -2.1   33  145-178    37-69  (254)
438 TIGR03385 CoA_CoA_reduc CoA-di  73.2    0.46 1.2E-05   26.2  -1.6   80  144-224   135-231 (427)
439 COG1052 LdhA Lactate dehydroge  72.9    0.78   2E-05   24.6  -0.5   87  145-245   145-237 (324)
440 PRK08526 threonine dehydratase  72.7     1.5 3.8E-05   22.8   0.9   17  307-323   380-396 (403)
441 cd05211 NAD_bind_Glu_Leu_Phe_V  72.5    0.66 1.7E-05   25.1  -0.9   35  145-180    22-56  (217)
442 COG1087 GalE UDP-glucose 4-epi  72.4    0.55 1.4E-05   25.6  -1.3   13  308-320   309-322 (329)
443 TIGR02360 pbenz_hydroxyl 4-hyd  71.7    0.59 1.5E-05   25.4  -1.3  211   18-246    26-290 (393)
444 KOG2733 consensus               71.6    0.45 1.2E-05   26.2  -1.9   10  190-199   243-252 (423)
445 PRK13512 coenzyme A disulfide   71.5     1.1 2.8E-05   23.7  -0.0   80  144-224   146-239 (438)
446 PRK12778 putative bifunctional  71.3    0.49 1.2E-05   26.0  -1.8   36  143-179   575-611 (760)
447 pfam02670 DXP_reductoisom 1-de  71.2    0.31 7.8E-06   27.3  -2.9   89  149-237     1-114 (129)
448 cd00757 ThiF_MoeB_HesA_family   71.0    0.64 1.6E-05   25.2  -1.3   31  146-177    21-52  (228)
449 PRK00421 murC UDP-N-acetylmura  71.0    0.63 1.6E-05   25.2  -1.3   16    2-17      3-18  (459)
450 COG1619 LdcA Uncharacterized p  70.7     1.6 4.1E-05   22.5   0.7   14   30-44      6-19  (313)
451 PRK13255 thiopurine S-methyltr  70.6       2 5.1E-05   22.0   1.2  101  141-244    33-155 (218)
452 TIGR01214 rmlD dTDP-4-dehydror  70.5    0.75 1.9E-05   24.8  -1.0   32  148-179     1-32  (317)
453 PRK11150 rfaD ADP-L-glycero-D-  70.4    0.72 1.8E-05   24.9  -1.1   12  308-319   294-306 (308)
454 PRK06222 ferredoxin-NADP(+) re  70.4    0.84 2.1E-05   24.4  -0.8   29  212-241   178-207 (281)
455 PRK13228 consensus              70.4    0.71 1.8E-05   24.9  -1.1   13    4-16      5-17  (232)
456 pfam02719 Polysacc_synt_2 Poly  70.3    0.54 1.4E-05   25.7  -1.8   31  149-179     1-32  (280)
457 PRK07190 hypothetical protein;  70.2    0.92 2.3E-05   24.2  -0.6   13   41-53     45-57  (480)
458 PRK06436 glycerate dehydrogena  69.4    0.98 2.5E-05   24.0  -0.6   36  145-181   121-156 (303)
459 pfam03446 NAD_binding_2 NAD bi  69.2     0.6 1.5E-05   25.4  -1.8   87  148-246     3-97  (163)
460 pfam00208 ELFV_dehydrog Glutam  69.0    0.88 2.3E-05   24.3  -0.9   33  145-178    31-63  (237)
461 COG0743 Dxr 1-deoxy-D-xylulose  69.0     0.5 1.3E-05   25.9  -2.2   11    7-17      1-12  (385)
462 PRK12483 threonine dehydratase  69.0     1.9   5E-05   22.0   0.8  101   79-180   204-324 (521)
463 PRK09288 purT phosphoribosylgl  68.7    0.56 1.4E-05   25.6  -2.0   11  310-320   374-384 (395)
464 PRK00683 murD UDP-N-acetylmura  68.7    0.69 1.8E-05   25.0  -1.5   21  310-330   366-386 (418)
465 PRK12831 putative oxidoreducta  68.4       1 2.6E-05   23.9  -0.7   37  143-180   278-314 (464)
466 PRK08762 molybdopterin biosynt  68.0    0.71 1.8E-05   24.9  -1.6   31  146-177   138-169 (379)
467 PRK03562 glutathione-regulated  67.9    0.74 1.9E-05   24.8  -1.5   71  148-223   401-472 (615)
468 COG0499 SAM1 S-adenosylhomocys  67.7     1.1 2.9E-05   23.5  -0.6   91  143-246   206-298 (420)
469 TIGR00036 dapB dihydrodipicoli  67.5    0.69 1.8E-05   25.0  -1.7  112  148-262     3-123 (281)
470 PRK06847 hypothetical protein;  67.4       1 2.7E-05   23.8  -0.8   11    6-16      3-13  (375)
471 COG0569 TrkA K+ transport syst  67.2    0.46 1.2E-05   26.1  -2.7   60  139-198    60-121 (225)
472 TIGR02371 ala_DH_arch alanine   67.1     2.1 5.3E-05   21.8   0.7   90  214-326   194-285 (327)
473 PRK13886 conjugal transfer pro  66.9    0.82 2.1E-05   24.5  -1.4   91  150-240     6-115 (241)
474 COG1648 CysG Siroheme synthase  66.8     2.7 6.8E-05   21.1   1.2   91  145-243    11-102 (210)
475 PRK12770 putative glutamate sy  66.3     1.1 2.9E-05   23.5  -0.8   33  144-177   169-201 (350)
476 cd01079 NAD_bind_m-THF_DH NAD   66.0     3.3 8.4E-05   20.5   1.5   95  144-245    60-157 (197)
477 PRK05690 molybdopterin biosynt  65.9    0.99 2.5E-05   23.9  -1.2   30  146-176    32-62  (245)
478 PRK12775 putative trifunctiona  65.9    0.76 1.9E-05   24.7  -1.8   78  144-223   430-528 (993)
479 PRK09310 aroDE bifunctional 3-  65.7    0.67 1.7E-05   25.1  -2.1   54  134-188   320-373 (477)
480 PRK09224 threonine dehydratase  65.4     2.8   7E-05   21.0   1.0  168  150-332    71-277 (504)
481 PRK06382 threonine dehydratase  65.4     2.3 5.8E-05   21.5   0.6  167  150-332    70-275 (400)
482 PRK08243 4-hydroxybenzoate 3-m  65.3     1.1 2.9E-05   23.5  -0.9   32  149-181     5-36  (392)
483 PRK12549 shikimate 5-dehydroge  65.2    0.58 1.5E-05   25.5  -2.5   84  135-222   116-200 (284)
484 TIGR01179 galE UDP-glucose 4-e  65.1     1.3 3.4E-05   23.1  -0.6   85  148-232     1-94  (341)
485 PRK02118 V-type ATP synthase s  65.0       4  0.0001   19.9   1.8  117   66-189    42-184 (432)
486 COG0771 MurD UDP-N-acetylmuram  64.9     1.9 4.9E-05   22.0   0.2   91  146-242     7-97  (448)
487 PRK05294 carB carbamoyl phosph  64.6     9.7 0.00025   17.4   5.2  165  128-332   535-710 (1063)
488 PRK07574 formate dehydrogenase  64.6     6.3 0.00016   18.7   2.7  157  145-302   191-365 (385)
489 PRK10262 thioredoxin reductase  64.5       1 2.6E-05   23.9  -1.3   92  148-240     8-104 (321)
490 KOG1200 consensus               64.4     1.1 2.8E-05   23.6  -1.1   42  149-190    17-59  (256)
491 pfam10672 Methyltrans_SAM S-ad  64.1    0.92 2.3E-05   24.2  -1.6   97  151-247   127-241 (286)
492 PRK08198 threonine dehydratase  64.0     2.6 6.7E-05   21.2   0.7  167  150-332    75-280 (406)
493 PRK12771 putative glutamate sy  63.9     1.4 3.5E-05   23.0  -0.8   35  146-181   137-171 (560)
494 pfam03686 UPF0146 Uncharacteri  63.9     1.9 4.9E-05   22.0  -0.0   82  162-243    28-124 (127)
495 COG0027 PurT Formate-dependent  63.7     1.4 3.6E-05   22.9  -0.7  173  147-330    13-194 (394)
496 PRK01581 speE spermidine synth  63.7    0.77   2E-05   24.7  -2.1   92  147-242   141-255 (363)
497 PRK08244 hypothetical protein;  63.7     1.5 3.9E-05   22.7  -0.6   43  149-192     5-47  (494)
498 PRK11579 putative oxidoreducta  63.2     5.9 0.00015   18.8   2.4  139  148-329     6-146 (346)
499 PRK12814 putative NADPH-depend  63.2     1.4 3.6E-05   22.9  -0.8   35  146-181   193-227 (652)
500 PRK03659 glutathione-regulated  63.2    0.93 2.4E-05   24.1  -1.7   59  146-205   400-459 (602)

No 1  
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family; InterPro: IPR014189   Members of this family are putative quinone oxidoreductases that belong to the broader superfamily of zinc-dependent alcohol (of medium chain length) dehydrogenases and quinone oxidoreductases. An alignment shows no motif of conserved Cys residues as are found in zinc-binding members of the superfamily, consequently members of this entry are likely to be quinone oxidoreductases. A member of this family in Homo sapiens (Human), PIG3, is induced by p53 but is otherwise uncharacterised..
Probab=100.00  E-value=0  Score=629.55  Aligned_cols=325  Identities=54%  Similarity=0.958  Sum_probs=321.0

Q ss_pred             EEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCC--
Q ss_conf             089999156885307999823787788628999999982787899986887787668730033000232222221222--
Q gi|254780290|r    7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTH--   84 (332)
Q Consensus         7 Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~--   84 (332)
                      ||+|.++++|+||+|++.+.|+|+|++|||||||+|+|||+-|++.|+|.||.++..+.|||-|++|+|+++|++|++  
T Consensus         1 M~aI~i~~~GgpevL~~~~~p~P~p~~GEVLi~V~AAGVNRPD~lQR~G~YPpPPGAS~IlGLE~AG~v~a~G~~V~~~~   80 (334)
T TIGR02824         1 MKAIEITEPGGPEVLELVEVPLPVPKAGEVLIRVAAAGVNRPDVLQRQGKYPPPPGASDILGLEVAGEVVAVGEGVSREH   80 (334)
T ss_pred             CCEEEEECCCCCCEEEEEECCCCCCCCCEEEEEEEEECCCHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEECCCCCCHHH
T ss_conf             91789727989715678606888558862589999842682799864677210111288887125368998388877688


Q ss_pred             ---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             ---22233332211223333322111111122222223222122222233322211122222222222211344444322
Q gi|254780290|r   85 ---WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTT  161 (332)
Q Consensus        85 ---~~~GdrV~~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~  161 (332)
                         |++|||||++..+|+||||++||+.++.|+|+++|+.|||+||++|+|+|.+|++.++|++||++|||||+||||..
T Consensus        81 L~~f~vGDrVcAL~~GGGYAEy~~V~A~q~LP~P~Gls~veAAAlPEt~fTVW~NLF~~g~L~~GEtvLiHGGaSGIGtt  160 (334)
T TIGR02824        81 LAKFKVGDRVCALVAGGGYAEYVAVPAGQVLPVPEGLSLVEAAALPETFFTVWSNLFQRGGLKAGETVLIHGGASGIGTT  160 (334)
T ss_pred             HHHCCCCCEEEEECCCCCEEEEEEECCCEEEECCCCCCHHHHHCCHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHH
T ss_conf             96358875799875898337678751441550689887797612514788888868722113789728997136736799


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22212222222211122322111-1112233222222222111122222222-211122221111112222211223453
Q gi|254780290|r  162 AIQLASYFGATVYTTAKSEEKCL-ACLKLGAKHAINYLKEDFLEILQKETQG-RGIDIILDMVGAEYLNQHLTLLSKEGK  239 (332)
Q Consensus       162 a~qla~~~G~~vi~~~~~~~~~~-~~~~lGa~~vi~~~~~~~~~~i~~~t~g-~g~Divid~~G~~~~~~~~~~l~~~G~  239 (332)
                      |+||||++|++|++|++|++|++ .+++||||.+|||+++||.+.+++.|.+ +|+|+|+|.+|++++++-+++|+.+||
T Consensus       161 AIqLAKA~Ga~V~~TaGS~eK~~~a~~~LGAd~aINY~e~DFve~~k~~t~g~kGvDVILD~vGg~Yl~~N~~alA~dGR  240 (334)
T TIGR02824       161 AIQLAKAFGARVFTTAGSDEKCATACEALGADIAINYREEDFVEVVKEETGGGKGVDVILDIVGGSYLARNIKALALDGR  240 (334)
T ss_pred             HHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCCCCCCEEEECCCHHHHHHHHHHHHCCCC
T ss_conf             99999856975999828989999999860980786077734799999826899853179857766889989999840793


Q ss_pred             CEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHH-CCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHH
Q ss_conf             0479833787543222433430532167775124000-113789999999999999869831021247418999999999
Q gi|254780290|r  240 LIIISFLGGNIATEINLNPIISKRITITGSTLRRRTD-IAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDI  318 (332)
Q Consensus       240 iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~-~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~  318 (332)
                      ++.+|...|....++|+.+++.|+++++||+++++.. ..+..+.+++..++..++++|+++|+|+++|||+|+.+||++
T Consensus       241 lV~Ig~~gG~~A~e~dL~~Ll~KR~~~tGSTLR~R~~G~~KA~Ia~~l~~~VWPll~~G~~~P~I~~~fpL~~A~~AH~~  320 (334)
T TIGR02824       241 LVQIGFQGGAKAEELDLGPLLAKRLTITGSTLRARPVGAEKAAIAAELREQVWPLLASGRVRPVIDKVFPLEDAAKAHAL  320 (334)
T ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCHHHHHHHHHH
T ss_conf             99985067832011684899988754301025898835899999999888730466658525784210798999999999


Q ss_pred             HHCCCCCCEEEEE
Q ss_conf             9829981328983
Q gi|254780290|r  319 MEKSEHIGKIILL  331 (332)
Q Consensus       319 l~~g~~~GKvVi~  331 (332)
                      |++++|+|||||+
T Consensus       321 me~g~h~GKiVL~  333 (334)
T TIGR02824       321 MESGDHIGKIVLT  333 (334)
T ss_pred             HHCCCCCCEEEEC
T ss_conf             7458960147741


No 2  
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional
Probab=100.00  E-value=0  Score=505.45  Aligned_cols=323  Identities=27%  Similarity=0.393  Sum_probs=284.7

Q ss_pred             CEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCC
Q ss_conf             20899991568853079998237877886289999999827878999868877876687300330002322222212222
Q gi|254780290|r    6 KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHW   85 (332)
Q Consensus         6 ~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~   85 (332)
                      .|||+++++||+|++|++.|+|.|+|++|||||||+++|||++|++++.|.++. ..+|.++|||++|+|+++|++|++|
T Consensus         1 m~kav~~~~~G~p~~L~~~~~~~p~p~~~eVlVkV~a~gin~~D~~~r~G~~~~-~~~P~~~G~E~~G~V~~vG~~V~~~   79 (327)
T PRK10754          1 MATRIEFHKHGGPEVLQAVEFTPADPAENEIQVENKAIGINFIDTYIRSGLYPP-PSLPSGLGTEAAGIVSKVGSGVKHI   79 (327)
T ss_pred             CCEEEEEECCCCCCCEEEEECCCCCCCCCEEEEEEEEECCCHHHHHHHCCCCCC-CCCCCCCCCEEEEEEEEECCCCCCC
T ss_conf             984999805689600399976899999998999999992798999997899998-7678747632699999977998647


Q ss_pred             CCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22333322-11223333322111111122222223222122222233322211122222222222211344444322222
Q gi|254780290|r   86 NIGDEVCA-LVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQ  164 (332)
Q Consensus        86 ~~GdrV~~-~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~q  164 (332)
                      ++||||+. ....|+||||+.++++.++++|+++|+++||+++++++|||++|++.+++++++++||+||+|++|++++|
T Consensus        80 ~vGdrV~~~~~~~G~~aey~~v~~~~~~~~P~~ls~~~AA~~~~~~~Ta~~~l~~~~~~~~g~~vLi~gaaGgVG~~avQ  159 (327)
T PRK10754         80 KVGDRVVYAQSALGAYSSVHNVPADKAAILPDAISFEQAAASFLKGLTVYYLLRKTYEIKPDEQFLFHAAAGGVGLIACQ  159 (327)
T ss_pred             CCCCEEEECCCCCCCCEEEEEECHHHEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCHHHHH
T ss_conf             89998866667873654699961799387888767778775213588798876531378999999998177611268999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             12222222211122322111111223322222222211112222222221112222111111222221122345304798
Q gi|254780290|r  165 LASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       165 la~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~~~~~~~~~l~~~G~iv~~G  244 (332)
                      +||++|++|++++++++|.++++++||++++||+++++.++++++|+|+++|++||++|+++++.++++++++|+++.+|
T Consensus       160 lAk~~Ga~Vi~t~~s~~k~e~~~~lGA~~vi~~~~~~~~~~i~~~t~g~gvdvv~D~vG~~~~~~~~~~l~~~G~iv~~G  239 (327)
T PRK10754        160 WAKALGAKLIGTVGSAQKAQRALKAGAWQVINYREENIVERVKEITGGKKVRVVYDSVGKDTWEASLDCLQRRGLMVSFG  239 (327)
T ss_pred             HHHHCCCEEEEEECCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             99986999999989899999999669999998999999999999868998369998988899999999863498999980


Q ss_pred             ECCCCCCCCCCCCHHHCCC-CEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCC--EEEEEHHHHHHHHHHHHC
Q ss_conf             3378754322243343053-2167775124000113789999999999999869831021--247418999999999982
Q gi|254780290|r  245 FLGGNIATEINLNPIISKR-ITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI--HTVLPLGKVAMAHDIMEK  321 (332)
Q Consensus       245 ~~~~~~~~~~~~~~~~~~~-~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i--~~~~~l~~i~~A~~~l~~  321 (332)
                      ..++.. ..+++..+..+. +.+...++..+.  ...........++++++++|+|++.+  +++|+|+|+.+||+.|++
T Consensus       240 ~~~~~~-~~~~l~~~~~~~~~~~~~~~~~g~~--~~~~~~~~~~~~l~~lv~~G~i~~~i~~~~~f~l~~~~~A~~~le~  316 (327)
T PRK10754        240 NASGPV-TGVNLGILNQKGSLYVTRPSLQGYI--TTREELTEASNELFSLIASGVIKVDVAENQKYPLKDAQRAHEILES  316 (327)
T ss_pred             CCCCCC-CCCCHHHHHHCCCEEEEECEEEEEE--CCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEHHHHHHHHHHHHC
T ss_conf             688986-6768789862575588501123650--7899999999999999987997321477718809999999999976


Q ss_pred             CCCCCEEEEEC
Q ss_conf             99813289839
Q gi|254780290|r  322 SEHIGKIILLP  332 (332)
Q Consensus       322 g~~~GKvVi~P  332 (332)
                      ++++||+||+|
T Consensus       317 ~~~~GKvVL~P  327 (327)
T PRK10754        317 RATQGSSLLIP  327 (327)
T ss_pred             CCCCEEEEEEC
T ss_conf             99951389959


No 3  
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]
Probab=100.00  E-value=0  Score=477.41  Aligned_cols=321  Identities=39%  Similarity=0.655  Sum_probs=293.2

Q ss_pred             EEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             08999915688530799982378778862899999998278789998688778766873003300023222222122222
Q gi|254780290|r    7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWN   86 (332)
Q Consensus         7 Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~~   86 (332)
                      |||++++++|+|++|+++|.|.|+|++|||||||++++|||.|++.++|..+...+.|++||+|++|+|+++|++|++|+
T Consensus         1 mka~~~~~~g~~~~l~~~e~~~P~p~~geVlV~V~aagvN~~D~~~r~G~~~~~~~~P~i~G~d~aG~V~avG~~V~~~~   80 (326)
T COG0604           1 MKAVVVEEFGGPEVLKVVEVPEPEPGPGEVLVRVKAAGVNPIDVLVRQGLAPPVRPLPFIPGSEAAGVVVAVGSGVTGFK   80 (326)
T ss_pred             CCEEEEECCCCCCCEEEEECCCCCCCCCEEEEEEEEEECCHHHHHHHCCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCC
T ss_conf             90399832689862169867899999996999998986174888873388787688997540157899996378988778


Q ss_pred             CCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             233332211---22333332211111112222222322212222223332221112222222222221134444432222
Q gi|254780290|r   87 IGDEVCALV---NGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAI  163 (332)
Q Consensus        87 ~GdrV~~~~---~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~  163 (332)
                      +||||+.+.   +.|+||||+.+++++++++|+++|+++||+++++++|||++|++.+++++|++|||+||+|+||++++
T Consensus        81 ~GdrV~~~~~~~~~G~~AEy~~v~a~~~~~~P~~ls~~eAA~l~~~~~TA~~~l~~~~~l~~g~~VLv~gaaGgVG~~ai  160 (326)
T COG0604          81 VGDRVAALGGVGRDGGYAEYVVVPADWLVPLPDGLSFEEAAALPLAGLTAWLALFDRAGLKPGETVLVHGAAGGVGSAAI  160 (326)
T ss_pred             CCCEEEECCCCCCCCCCEEEEECCHHHEEECCCCCCHHHHHHCCCHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHH
T ss_conf             99889985888889865126770556728789999989985522306769999997617699997999778546999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             21222222221112232211111122332222222221111222222222111222211111122222112234530479
Q gi|254780290|r  164 QLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       164 qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~~~~~~~~~l~~~G~iv~~  243 (332)
                      ||||++|++++++++++++.++++++|||+++||+++|+.+.++++++|+|+|+|||++|++++..++++++++|+++.|
T Consensus       161 QlAk~~G~~~v~~~~s~~k~~~~~~lGAd~vi~y~~~d~~~~v~~~t~g~gvDvv~D~vG~~~~~~~l~~l~~~G~lv~i  240 (326)
T COG0604         161 QLAKALGATVVAVVSSSEKLELLKELGADHVINYREEDFVEQVRELTGGKGVDVVLDTVGGDTFAASLAALAPGGRLVSI  240 (326)
T ss_pred             HHHHHCCCCEEEEECCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHCCCCEEEEE
T ss_conf             99998499589998175788999873998897056424899999983799878899798679999999974259589998


Q ss_pred             EECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHH--HHHHHHHHHC
Q ss_conf             83378754322243343053216777512400011378999999999999986983102124741899--9999999982
Q gi|254780290|r  244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGK--VAMAHDIMEK  321 (332)
Q Consensus       244 G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~--i~~A~~~l~~  321 (332)
                      |..++.....++...++.+.++..|++....   .+ ........++++++++|.++|.++++|+|+|  ...|+..++ 
T Consensus       241 g~~~g~~~~~~~~~~~~~~~~~~~g~~~~~~---~~-~~~~~~~~~l~~~l~~g~l~~~i~~~~~l~e~~~a~a~~~~~-  315 (326)
T COG0604         241 GALSGGPPVPLNLLPLLGKRLTLRGVTLGSR---DP-EALAEALAELFDLLASGKLKPVIDRVYPLAEAPAAAAHLLLE-  315 (326)
T ss_pred             ECCCCCCCCCCCCHHHCCCEEEEEEECCCCC---CH-HHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHC-
T ss_conf             0688776445330311015169996414236---76-778999999999997698502235453766768999999855-


Q ss_pred             CCCCCEEEEEC
Q ss_conf             99813289839
Q gi|254780290|r  322 SEHIGKIILLP  332 (332)
Q Consensus       322 g~~~GKvVi~P  332 (332)
                      ++++||+||+|
T Consensus       316 ~~~~GKvvl~~  326 (326)
T COG0604         316 RRTTGKVVLKV  326 (326)
T ss_pred             CCCCCEEEEEC
T ss_conf             88861699859


No 4  
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=100.00  E-value=0  Score=456.77  Aligned_cols=309  Identities=33%  Similarity=0.516  Sum_probs=283.0

Q ss_pred             CCCEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCC
Q ss_conf             76208999915688530799982378778862899999998278789998688778766873003300023222222122
Q gi|254780290|r    4 CKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTT   83 (332)
Q Consensus         4 ~~~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~   83 (332)
                      +.||||++++++++|  ++++|+|.|+|+++||||||+|||+|++|+|.++|.++... +|.|||||++|+|+++|++|+
T Consensus         1 ~~~mkA~~~~~~~~p--l~i~e~~~p~p~~~eVlI~v~~~GVChsDlH~~~G~~~~~~-~P~ipGHEivG~V~~vG~~V~   77 (339)
T COG1064           1 MMTMKAAVLKKFGQP--LEIEEVPVPEPGPGEVLIKVEACGVCHTDLHVAKGDWPVPK-LPLIPGHEIVGTVVEVGEGVT   77 (339)
T ss_pred             CCCEEEEEECCCCCC--CEEEECCCCCCCCCEEEEEEEEEEECCHHHHHHCCCCCCCC-CCCCCCCCEEEEEEEECCCCC
T ss_conf             963289986168999--55786668999988089999998626055465527788888-982688535799998658986


Q ss_pred             CCCCCCCCC----------------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222233332----------------------------2112233333221111111222222232221222222333222
Q gi|254780290|r   84 HWNIGDEVC----------------------------ALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA  135 (332)
Q Consensus        84 ~~~~GdrV~----------------------------~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~  135 (332)
                      +||+||||.                            ++..+|+||||+++++.+++++|+++|+++||.+.|++.|+|.
T Consensus        78 ~~k~GDrVgV~~~~~~Cg~C~~C~~G~E~~C~~~~~~gy~~~GGyaeyv~v~~~~~~~iP~~~d~~~aApllCaGiT~y~  157 (339)
T COG1064          78 GLKVGDRVGVGWLVISCGECEYCRSGNENLCPNQKITGYTTDGGYAEYVVVPARYVVKIPEGLDLAEAAPLLCAGITTYR  157 (339)
T ss_pred             CCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCEEEEEECHHHEEECCCCCCHHHHHHHHCCEEEEEE
T ss_conf             47789998857743689998020485501288766265560584211799765785888899986661154367005760


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11122222222222211344444322222122222222111223221111112233222222222111122222222211
Q gi|254780290|r  136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGI  215 (332)
Q Consensus       136 ~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~  215 (332)
                      +|.+ .+++||++|+|+|+ ||+|++|+|+|+++|++|++++++++|.++++++|||+++|.+++++.+.+.+.     +
T Consensus       158 alk~-~~~~pG~~V~I~G~-GGlGh~avQ~Aka~ga~Via~~~~~~K~e~a~~lGAd~~i~~~~~~~~~~~~~~-----~  230 (339)
T COG1064         158 ALKK-ANVKPGKWVAVVGA-GGLGHMAVQYAKAMGAEVIAITRSEEKLELAKKLGADHVINSSDSDALEAVKEI-----A  230 (339)
T ss_pred             EHHH-CCCCCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEECCCCHHHHHHHHH-----C
T ss_conf             0465-38999989999877-489999999999869969999578779999998488289976781166776734-----7


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             12222111111222221122345304798337875432224334305321677751240001137899999999999998
Q gi|254780290|r  216 DIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLN  295 (332)
Q Consensus       216 Divid~~G~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~  295 (332)
                      |+++|+++..+++.++++|+++|+++.+|.........++.+.++.+++++.||..+++.+.          ++++++.+
T Consensus       231 d~ii~tv~~~~~~~~l~~l~~~G~~v~vG~~~~~~~~~~~~~~li~~~~~i~GS~~g~~~d~----------~e~l~f~~  300 (339)
T COG1064         231 DAIIDTVGPATLEPSLKALRRGGTLVLVGLPGGGPIPLLPAFLLILKEISIVGSLVGTRADL----------EEALDFAA  300 (339)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHCCCEEEEEECCCHHHH----------HHHHHHHH
T ss_conf             39999877455999999864297899978888766666787786326708999724899999----------99999998


Q ss_pred             CCCCCCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             6983102124741899999999998299813289839
Q gi|254780290|r  296 SHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP  332 (332)
Q Consensus       296 ~g~l~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~P  332 (332)
                      +|+++|.+.++|+|+|+++||+.|++|+..|++||.+
T Consensus       301 ~g~Ikp~i~e~~~l~~in~A~~~m~~g~v~gR~Vi~~  337 (339)
T COG1064         301 EGKIKPEILETIPLDEINEAYERMEKGKVRGRAVIDM  337 (339)
T ss_pred             HCCCEEEEEEEECHHHHHHHHHHHHCCCEEEEEEECC
T ss_conf             1894324876677899999999987288116999567


No 5  
>PRK13771 putative alcohol dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=453.23  Aligned_cols=305  Identities=30%  Similarity=0.460  Sum_probs=269.8

Q ss_pred             EEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             08999915688530799982378778862899999998278789998688778766873003300023222222122222
Q gi|254780290|r    7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWN   86 (332)
Q Consensus         7 Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~~   86 (332)
                      |||++++++|++  |+++|+|+|+|+++||||||+++|||++|++.++|.++.. .+|.++|||++|+|+++|++|++|+
T Consensus         1 MkA~v~~~~g~~--l~l~evp~P~p~~~eVlVkv~a~gic~sD~~~~~G~~~~~-~~P~i~GhE~~G~V~~vG~~v~~~~   77 (332)
T PRK13771          1 MKAAILPGFKQG--YSIDEVEDPKPGKGEVVIKVVYAGLCYRDLLQLQGFYPRV-KYPVILGHEVVGVVEEVGEGVEGFK   77 (332)
T ss_pred             CEEEEEECCCCC--CEEEEEECCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCC-CCCCCCCEEEEEEEEEECCCEEEEE
T ss_conf             938999369999--7899807998998989999999937889999866899988-8983585579999998167224663


Q ss_pred             CCCCCCCCC---------------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             233332211---------------------------22333332211111112222222322212222223332221112
Q gi|254780290|r   87 IGDEVCALV---------------------------NGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQ  139 (332)
Q Consensus        87 ~GdrV~~~~---------------------------~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~  139 (332)
                      +||||+++.                           .+|+||||+++++++++++|+++|+++|+.+++++.|+|+++ +
T Consensus        78 vGdrV~~~~~~~cg~c~~C~~g~~~~c~~~~~~g~~~~G~~aey~~v~~~~l~~iP~~~~~~~aa~~~~~~~t~~~al-~  156 (332)
T PRK13771         78 PGDRVASLLYEPCGKCEYCRSGEEALCRNRKIYGEELDGFFAEYIKVKVKSLVKVPPGVSDEAAVIAACVTGMIYRGL-R  156 (332)
T ss_pred             CCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCEECCCCCCHHHHHHHHHHHHHHHHHH-H
T ss_conf             088899965348888613458873415554202556787561201146887044798753688988767889999999-9


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222222113444443222221222222221112232211111122332222222221111222222222111222
Q gi|254780290|r  140 TANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIIL  219 (332)
Q Consensus       140 ~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divi  219 (332)
                      .+++++|++|||+||+|++|++++|+||++|++|++++++++|.+++++++ ++++++.+  +.+.+.+.   .|+|++|
T Consensus       157 ~~~~~~g~~VlI~Ga~G~vG~~aiqlak~~Ga~vi~v~~~~~k~~~~~~~~-~~~i~~~~--~~~~~~~~---~g~Dvvi  230 (332)
T PRK13771        157 RAGVSEGETVLVTGAGGGVGIHAVQVAKAYGAKVIAVTTSESKAKAVGKYA-DYVIVGSK--FSEEVKKL---GGADIVI  230 (332)
T ss_pred             HHCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC-CEEEECCC--HHHHHHHC---CCCCEEE
T ss_conf             719999999999778775899999999986998999949999999998569-98983630--57888734---6863898


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             21111112222211223453047983378754322243343053216777512400011378999999999999986983
Q gi|254780290|r  220 DMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVI  299 (332)
Q Consensus       220 d~~G~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l  299 (332)
                      |++|++.+++++++++++|+++.+|..++. ...+++..++.+++++.|+...+..+          ..++++++++|+|
T Consensus       231 d~~G~~~~~~~~~~l~~~G~iv~~G~~~~~-~~~~~~~~~~~k~~~i~g~~~~~~~~----------~~~~~~l~~~g~i  299 (332)
T PRK13771        231 ETVGGPTLEESLRSLNWGGKIVLIGNVDPS-PASLRLGLLILKDIEILGHISATKKD----------VEEALKLVAEGKI  299 (332)
T ss_pred             ECCCHHHHHHHHHHHCCCCEEEEEECCCCC-CCCCCHHHHHHCCCEEEEEECCCHHH----------HHHHHHHHHCCCC
T ss_conf             457668899888862589699999345787-57645899986687899985578999----------9999999986998


Q ss_pred             CCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             102124741899999999998299813289839
Q gi|254780290|r  300 APVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP  332 (332)
Q Consensus       300 ~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~P  332 (332)
                      +|.++++|+|+|+++||+.++++++.|||||+|
T Consensus       300 ~~~i~~~~~l~~~~~A~~~l~~~~~~GKvVl~P  332 (332)
T PRK13771        300 KPVIAGHVSLSDIDKALEMLKDKSHIGRILVKP  332 (332)
T ss_pred             EEEEEEEEEHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             645727982899999999997799865799979


No 6  
>PRK09422 alcohol dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=443.83  Aligned_cols=306  Identities=21%  Similarity=0.371  Sum_probs=266.8

Q ss_pred             EEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             08999915688530799982378778862899999998278789998688778766873003300023222222122222
Q gi|254780290|r    7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWN   86 (332)
Q Consensus         7 Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~~   86 (332)
                      |||+++++.++  .++++|+|+|+|+++||||||+++|||++|+++++|.++.  ..|.++|||++|+|+++|++|++|+
T Consensus         1 MkA~v~~~~~~--~~~i~ev~~P~~~~~eVlVkv~~~gic~sD~~~~~G~~~~--~~p~i~GhE~~G~V~~vG~~v~~~~   76 (338)
T PRK09422          1 MKAAVVTKDHD--GVDVVEKELRPLKHGEALVKMEYCGVCHTDLHVANGDFGD--KTGRILGHEGIGIVKEVGPGVTSLK   76 (338)
T ss_pred             CEEEEEECCCC--CCEEEEEECCCCCCCEEEEEEEEEEECHHHHHHHCCCCCC--CCCCCCCEEEEEEEEECCCCCCCCC
T ss_conf             94899978999--8489981689889898999999994899999986599999--9996077768999998688666664


Q ss_pred             CCCCCCC----------------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2333322----------------------------112233333221111111222222232221222222333222111
Q gi|254780290|r   87 IGDEVCA----------------------------LVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLF  138 (332)
Q Consensus        87 ~GdrV~~----------------------------~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~  138 (332)
                      +||||..                            +..+|+||||+++++++++++|+++|+++||++++++.|+|+++ 
T Consensus        77 vGdrV~v~~~~~~Cg~C~~C~~g~~~~C~~~~~~G~~~~G~~AEy~~v~~~~~~~iP~~l~~~~AA~l~~~~~t~~~al-  155 (338)
T PRK09422         77 VGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYTVDGGMAEQCIVTADYAVKVPEGLDPAAASSITCAGVTTYKAI-  155 (338)
T ss_pred             CCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHEEECCCCCCHHHHHHCCHHHHHHHHHH-
T ss_conf             2887887475578878622247861202234456545787554441125352998789998889752330467688999-


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222113444443222221222-2222211122322111111223322222222211112222222221112
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASY-FGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDI  217 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~-~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Di  217 (332)
                      +.+++++|++|||+|| |++|++++|+|+. .|++|++++++++|+++++++|||+++|+.+.+....+.+.+.+...++
T Consensus       156 ~~~~~~~G~~VlV~Ga-GgvG~~aiq~ak~~~g~~Vi~~~~~~~k~~~a~~lGad~vi~~~~~~~~~~~~~~~~gg~~~~  234 (338)
T PRK09422        156 KVSGIKPGQWIAIYGA-GGLGNLALQYAKNVFNAKVIAVDINDDKLALAKEVGADLTINSKRVEDVAKIIQEKTGGAHAA  234 (338)
T ss_pred             HHHCCCCCCEEEEECC-CHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHCCCCCEE
T ss_conf             9848999988999688-689999999999808986999989999999999729989981887434999999950997769


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             22211111122222112234530479833787543222433430532167775124000113789999999999999869
Q gi|254780290|r  218 ILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH  297 (332)
Q Consensus       218 vid~~G~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g  297 (332)
                      ++++++...+++++++++++|+++.+|...+.  ..+++..++.+++++.|+..+++.+.          .++++++++|
T Consensus       235 v~~~~~~~~~~~~~~~l~~gG~~v~vG~~~~~--~~~~~~~~~~~~~~i~Gs~~~~~~d~----------~~~~~l~~~g  302 (338)
T PRK09422        235 VVTAVAKAAFNQAVDAVRAGGRVVAVGLPPES--MDLSIPRLVLDGIEVVGSLVGTRQDL----------EEAFQFGAEG  302 (338)
T ss_pred             EEECCCHHHHHHHHHHHHCCCEEEEECCCCCC--CCCCHHHHHHCCCEEEEEECCCHHHH----------HHHHHHHHCC
T ss_conf             99678789999999981169999998778987--67678999868839999842899999----------9999999869


Q ss_pred             CCCCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             8310212474189999999999829981328983
Q gi|254780290|r  298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       298 ~l~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~  331 (332)
                      +++|.+ ++|+|+|+++||+.|++|+++||+||.
T Consensus       303 ~i~p~i-~~~pl~~~~eA~~~l~~g~~~GKiVl~  335 (338)
T PRK09422        303 KVVPKV-QLRPLEDINDIFDEMEEGKIQGRMVID  335 (338)
T ss_pred             CCEEEE-EEEEHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             985779-998389999999999769981689999


No 7  
>KOG1197 consensus
Probab=100.00  E-value=0  Score=442.38  Aligned_cols=327  Identities=32%  Similarity=0.482  Sum_probs=303.9

Q ss_pred             CCCCCEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCC
Q ss_conf             87762089999156885307999823787788628999999982787899986887787668730033000232222221
Q gi|254780290|r    2 PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGEN   81 (332)
Q Consensus         2 ~~~~~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~   81 (332)
                      ++|..-|-++++++|+.|++++++.|+|+|.++|++||..|+|+|+.|.+.++|.|. +.+.|++||.|++|+|+++|++
T Consensus         4 ~~p~~~k~i~v~e~Ggydvlk~ed~pv~~papgel~iknka~GlNfid~y~RkGlY~-~~plPytpGmEaaGvVvAvG~g   82 (336)
T KOG1197           4 ASPPLLKCIVVTEFGGYDVLKLEDRPVPPPAPGELTIKNKACGLNFIDLYFRKGLYD-PAPLPYTPGMEAAGVVVAVGEG   82 (336)
T ss_pred             CCCCHHEEEEEECCCCCCEEEEEEECCCCCCCCCEEEEEHHCCCCHHHHHHHCCCCC-CCCCCCCCCCCCCEEEEEECCC
T ss_conf             787212389994238851578753107999987368862211713799998624667-8888857775442279995377


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222233332211223333322111111122222223222122222233322211122222222222211344444322
Q gi|254780290|r   82 TTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTT  161 (332)
Q Consensus        82 v~~~~~GdrV~~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~  161 (332)
                      |++|++||||+.+.+.|.|||++.+|...+.++|+.+++++||++.+.++|||.-+++..++++|++|||+.|+||||++
T Consensus        83 vtdrkvGDrVayl~~~g~yaee~~vP~~kv~~vpe~i~~k~aaa~llq~lTAy~ll~e~y~vkpGhtVlvhaAAGGVGll  162 (336)
T KOG1197          83 VTDRKVGDRVAYLNPFGAYAEEVTVPSVKVFKVPEAITLKEAAALLLQGLTAYMLLFEAYNVKPGHTVLVHAAAGGVGLL  162 (336)
T ss_pred             CCCCCCCCEEEEECCCHHHHEECCCCCEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHH
T ss_conf             55540255789952403321000266045303775558999999999889999999986588999789998315628799


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             22212222222211122322111111223322222222211112222222221112222111111222221122345304
Q gi|254780290|r  162 AIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI  241 (332)
Q Consensus       162 a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~~~~~~~~~l~~~G~iv  241 (332)
                      ++|++|+.|+++|+++++.+|++.+++.|++|.|+|+.+|+.+++...|.|+|+|+++|++|.++++.++.+|++.|.++
T Consensus       163 l~Ql~ra~~a~tI~~asTaeK~~~akenG~~h~I~y~~eD~v~~V~kiTngKGVd~vyDsvG~dt~~~sl~~Lk~~G~mV  242 (336)
T KOG1197         163 LCQLLRAVGAHTIATASTAEKHEIAKENGAEHPIDYSTEDYVDEVKKITNGKGVDAVYDSVGKDTFAKSLAALKPMGKMV  242 (336)
T ss_pred             HHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCEEECCCHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHCCCCEEE
T ss_conf             99999752867999725378899998648743000450569999984148877105632656414677899753486699


Q ss_pred             EEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC
Q ss_conf             79833787543222433430532167775124000113789999999999999869831021247418999999999982
Q gi|254780290|r  242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK  321 (332)
Q Consensus       242 ~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~  321 (332)
                      ++|+.++... ++++..+-.+.+++..-++..+.+  .+..+.....+++.++.+|+|++.|+++|||+++.+|+..+++
T Consensus       243 SfG~asgl~~-p~~l~~ls~k~l~lvrpsl~gYi~--g~~el~~~v~rl~alvnsg~lk~~I~~~ypls~vadA~~dies  319 (336)
T KOG1197         243 SFGNASGLID-PIPLNQLSPKALQLVRPSLLGYID--GEVELVSYVARLFALVNSGHLKIHIDHVYPLSKVADAHADIES  319 (336)
T ss_pred             EECCCCCCCC-CEEHHHCCHHHHHHCCHHHHCCCC--CHHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHH
T ss_conf             8235568989-711555083564321576615347--7799999999999986337622155300246888889998873


Q ss_pred             CCCCCEEEEEC
Q ss_conf             99813289839
Q gi|254780290|r  322 SEHIGKIILLP  332 (332)
Q Consensus       322 g~~~GKvVi~P  332 (332)
                      +++.||+++.|
T Consensus       320 rktvGkvlLlp  330 (336)
T KOG1197         320 RKTVGKVLLLP  330 (336)
T ss_pred             HHCCCEEEEEC
T ss_conf             30455089857


No 8  
>smart00829 PKS_ER Enoylreductase. Enoylreductase in Polyketide synthases.
Probab=100.00  E-value=0  Score=444.23  Aligned_cols=286  Identities=31%  Similarity=0.505  Sum_probs=255.5

Q ss_pred             EEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99999998278789998688778766873003300023222222122222233332211223333322111111122222
Q gi|254780290|r   37 LIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPK  116 (332)
Q Consensus        37 lV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~~~GdrV~~~~~~G~~ae~~~~~~~~~~~iP~  116 (332)
                      +|||+|+||||+|+++++|.|+    .|.+||||++|+|+++|++|++|++||||+++. +|+||||+++++++++++|+
T Consensus         1 ~VkV~a~gin~~D~~~~~G~~~----~p~~~G~e~~G~V~~vG~~V~~~~vGdrV~~~~-~G~~aey~~v~~~~~~~iP~   75 (288)
T smart00829        1 EVEVRAAGLNFRDVLIALGLLP----GEAVLGGECAGVVTRVGPGVTGLAVGDRVMGLA-PGSFATYVRTDARLVVPIPD   75 (288)
T ss_pred             CCCEEEECCCHHHHHHHCCCCC----CCCCCEEEEEEEEEEECCCCCCCCCCCEEEEEC-CCCCCCEEEECHHHEEECCC
T ss_conf             9788998619999998689999----899670899999999999999999999999987-98561769976368899799


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCC
Q ss_conf             22322212222223332221112222222222221134444432222212222222211122322111111223--3222
Q gi|254780290|r  117 GYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLG--AKHA  194 (332)
Q Consensus       117 ~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lG--a~~v  194 (332)
                      ++|+++||++|++++|||++|.+.+++++|++|||+||+|++|++++|+||++|++|++|+++++|+++++++|  ++++
T Consensus        76 ~ls~~~aA~l~~~~~TA~~al~~~~~i~~g~~VlI~gg~G~vG~~aiqlak~~Ga~Vi~t~~s~~k~~~~~~lG~~~~~v  155 (288)
T smart00829       76 GLSFEEAATVPVVFLTAYYALVDLARLRPGESVLIHAAAGGVGQAAIQLAQHLGAEVFATAGSPEKRDFLRELGIPDDHI  155 (288)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCCCCEE
T ss_conf             99989997648889999999997508899999999789867779999999973983003408889999999769996076


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCC
Q ss_conf             22222211112222222221112222111111222221122345304798337875432224334305321677751240
Q gi|254780290|r  195 INYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR  274 (332)
Q Consensus       195 i~~~~~~~~~~i~~~t~g~g~Divid~~G~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~  274 (332)
                      +||+++++.+++++.|+|+|+|+||||+|++.++.++++|+++|+++.+|..+......+++. .+.+++++.++.+..+
T Consensus       156 ~~~~~~~~~~~v~~~t~g~gvDvv~d~vgg~~~~~~~~~l~~~G~~v~ig~~~~~~~~~~~~~-~~~~~~~~~~~~l~~~  234 (288)
T smart00829      156 FSSRDLSFADEILRATGGRGVDVVLNSLAGEFLDASLRCLAPGGRFVEIGKRDIRDNSQLGMA-PFRRNVSYHAVDLDAL  234 (288)
T ss_pred             EECCCCCHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHH-HHCCCCEEEEEEEEEH
T ss_conf             217995099999987089882799989868999999997536988999756666675543423-4317617999997513


Q ss_pred             HHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             00113789999999999999869831021247418999999999982998132898
Q gi|254780290|r  275 TDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL  330 (332)
Q Consensus       275 ~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi  330 (332)
                      ...  +........++.+++++|+|+|.++++|+|+|+++||++|++|++.||+||
T Consensus       235 ~~~--~~~~~~~~~~~~~l~~~g~l~p~i~~~f~l~~~~eA~~~l~~g~~~GKivi  288 (288)
T smart00829      235 EEG--PDRIRELLAEVLELFAEGVLRPLPVTVFPISDVEDAFRYMQQGKHIGKVVL  288 (288)
T ss_pred             HCC--HHHHHHHHHHHHHHHHCCCCCCCCCEEECHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             159--899999999999999879997450079939999999999973999704879


No 9  
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=100.00  E-value=0  Score=436.11  Aligned_cols=313  Identities=22%  Similarity=0.301  Sum_probs=276.8

Q ss_pred             CEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCC
Q ss_conf             20899991568853079998237877886289999999827878999868877876687300330002322222212222
Q gi|254780290|r    6 KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHW   85 (332)
Q Consensus         6 ~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~   85 (332)
                      ||||+|++++|.|  |+++|+|+|+|+++||||||.++|||++|++++.|.++  ..+|.++|||++|+|+++|++|++|
T Consensus         1 tMkA~v~~~~g~p--l~i~ev~~P~p~~~eVlvkV~a~gICgsDlh~~~G~~~--~~~P~ilGHE~~G~V~evG~~V~~~   76 (358)
T TIGR03451         1 TVRGVIARSKGAP--VELETIVVPDPGPGEVIVDIQACGVCHTDLHYREGGIN--DEFPFLLGHEAAGVVEAVGEGVTDV   76 (358)
T ss_pred             CEEEEEEECCCCC--CEEEEEECCCCCCCEEEEEEEEEEECHHHHHHHCCCCC--CCCCEECCEEEEEEEEEECCCCCCC
T ss_conf             9569999028999--78999678999989899999999688999999739999--9998047875799999989999877


Q ss_pred             CCCCCCCCC------------------C----------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             223333221------------------1----------------------223333322111111122222223222122
Q gi|254780290|r   86 NIGDEVCAL------------------V----------------------NGGGYAEYCLSHQGHTLPIPKGYNAIQAAS  125 (332)
Q Consensus        86 ~~GdrV~~~------------------~----------------------~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~  125 (332)
                      ++||||+..                  +                      ..|+|+||+.+++.+++++|++++++.++.
T Consensus        77 kvGDrV~v~~~~~Cg~C~~C~~G~~~~C~~~~~~~~~~~~~~g~~~~~~~~~G~~ae~~~v~~~~~~~~~~~~~~~~aa~  156 (358)
T TIGR03451        77 APGDYVVLNWRAVCGQCRACKRGRPWYCFDTHNATQKMTLTDGTELSPALGIGAFAEKTLVHAGQCTKVDPAADPAAAGL  156 (358)
T ss_pred             CCCCEEEECCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEECHHHEEECCCCCCHHHHHH
T ss_conf             77998997654576786566189733253433556653225882114664632115689964699076899998899887


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222333222111222222222222113444443222221222222-221112232211111122332222222221111
Q gi|254780290|r  126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLE  204 (332)
Q Consensus       126 l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~  204 (332)
                      +.++..|+|++..+.+++++|++|||+| +|++|++++|+|+++|+ +|++++.+++|+++++++||+++||+++.++.+
T Consensus       157 l~~~~~~~~~~~~~~~~~~~g~~VlV~G-aG~iGl~a~~~ak~~Ga~~Vi~~d~~~~rl~~A~~lGa~~~i~~~~~~~~~  235 (358)
T TIGR03451       157 LGCGVMAGLGAAVNTGGVKRGDSVAVIG-CGGVGDAAIAGAALAGASKIIAVDIDDRKLEWAREFGATHTVNSSGTDPVE  235 (358)
T ss_pred             HHCCHHHHHHHHHHHCCCCCCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCEEEECCCCCCHHH
T ss_conf             4021445468898640799998899967-376999999999983991899991988999999965990997399878899


Q ss_pred             CCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHH
Q ss_conf             22222222211122221111-11222221122345304798337875432224334305321677751240001137899
Q gi|254780290|r  205 ILQKETQGRGIDIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIR  283 (332)
Q Consensus       205 ~i~~~t~g~g~Divid~~G~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~  283 (332)
                      +++++|+|.|+|++||++|. .++++++++++++|+++.+|........++++..++.++.++.+++......   .   
T Consensus       236 ~v~~~t~g~G~Dvvie~~G~~~~~~~al~~~~~gG~iv~~G~~~~~~~~~~~~~~~~~~~~~i~~s~~~~~~~---~---  309 (358)
T TIGR03451       236 AIRALTGGFGADVVIDAVGRPETYKQAFYARDLAGTVVLVGVPTPDMTLELPLLDVFGRGGALKSSWYGDCLP---E---  309 (358)
T ss_pred             HHHHHHCCCCCCEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHCCCEEEEEEECCCCH---H---
T ss_conf             9999858988749999999989999999976279699999225899732226999973775899988648760---8---


Q ss_pred             HHHHHHHHHHHHCCCC--CCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             9999999999986983--10212474189999999999829981328983
Q gi|254780290|r  284 DSLQLKIWPLLNSHVI--APVIHTVLPLGKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       284 ~~~~~~~~~~i~~g~l--~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~  331 (332)
                       .....+.+++.+|++  +++++++|+|+|+++||+.|++|+.. |+||+
T Consensus       310 -~~~~~~~~li~~g~i~~~~lIt~~~~Le~~~eAfe~~~~g~~~-k~vv~  357 (358)
T TIGR03451       310 -RDFPMLVDLYLQGRLPLDAFVTERIGLDDVEEAFDKMHAGDVL-RSVVE  357 (358)
T ss_pred             -HHHHHHHHHHHCCCCCCCCCEEEEEEHHHHHHHHHHHHCCCCE-EEEEE
T ss_conf             -8999999999849799841389998799999999998779972-89997


No 10 
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated
Probab=100.00  E-value=0  Score=435.33  Aligned_cols=307  Identities=26%  Similarity=0.401  Sum_probs=263.1

Q ss_pred             EEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCC--CCCCCCCCEECCCCCCCCCCCCCCCCC
Q ss_conf             089999156885307999823787788628999999982787899986887--787668730033000232222221222
Q gi|254780290|r    7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLY--PPPKNANPILGLEVAGKIVDLGENTTH   84 (332)
Q Consensus         7 Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~--~~~~~~p~v~G~e~~G~V~~vG~~v~~   84 (332)
                      |||+++++++++  |+++|+|+|+|+++||||||+++|||++|++++.+..  ....++|.++|||++|+|+++|++|++
T Consensus         1 MkA~v~~~~~~~--l~l~evp~P~p~~~evlVkv~a~gic~sDl~~~~~~~~~~~~~~~P~i~GhE~~G~V~~vG~~V~~   78 (341)
T PRK05396          1 MKALVKLKAEPG--IWLTDVPVPEPGPNDVLIKVKKTAICGTDVHIYNWDEWAQKTIPVPMVVGHEFVGEVVEVGSEVTG   78 (341)
T ss_pred             CEEEEECCCCCC--CEEEECCCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCCEECCEEEEEEEEEECCCCCC
T ss_conf             904898789999--789967089899898999999998878898886578644567999834766689999882896886


Q ss_pred             CCCCCCCCC---------------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222333322---------------------------11223333322111111122222223222122222233322211
Q gi|254780290|r   85 WNIGDEVCA---------------------------LVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANL  137 (332)
Q Consensus        85 ~~~GdrV~~---------------------------~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l  137 (332)
                      |++||||++                           +..+|+||||+++++++++++|+++|+++||.+ .++.+|+++.
T Consensus        79 ~~vGdrV~~~~~~~cg~C~~c~~g~~~~c~~~~~~G~~~~G~~aey~~vp~~~~~~iP~~l~~e~aa~~-~pl~~a~~~~  157 (341)
T PRK05396         79 FKVGDRVSGEGHIVCGHCRNCRAGRRHLCRNTKGVGVNRPGAFAEYLVIPAFNVWKIPDDIPDDLAAIF-DPFGNAVHTA  157 (341)
T ss_pred             CCCCCEEEEECCCCCCCCHHHHCCCCCCCCCCCEECCCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHH-HHHHHHHHHH
T ss_conf             899889987232168888455288845375552533578982314150001339971432227899998-8899999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1222222222222113444443222221222222-221112232211111122332222222221111222222222111
Q gi|254780290|r  138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGID  216 (332)
Q Consensus       138 ~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~D  216 (332)
                      .+ .. ..|++|||+|+ |++|++++|+||++|+ +|++++.+++|+++++++||++++|++++++.+.+++++.++|+|
T Consensus       158 ~~-~~-~~g~~VlV~Ga-G~vGl~~~~~ak~~Ga~~Vi~~d~~~~kl~~a~~lGa~~~i~~~~~~~~~~~~~~t~~~G~D  234 (341)
T PRK05396        158 LS-FD-LVGEDVLITGA-GPIGIMAAAVAKHVGARHVVITDVNEYRLELARKMGATRAVNVAKEDLRDVMAELGMTEGFD  234 (341)
T ss_pred             HH-CC-CCCCEEEEECC-CCCCHHHHHHHHHCCCEEEEEEECCHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHCCCCCE
T ss_conf             84-57-78886999899-75432999999984992899994899999989864994999688506899999974899976


Q ss_pred             CCCCCCCC-CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             22221111-11222221122345304798337875432224334305321677751240001137899999999999998
Q gi|254780290|r  217 IILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLN  295 (332)
Q Consensus       217 ivid~~G~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~  295 (332)
                      ++||++|. ..+++++++++++|+++.+|..++.  ..+++..++.+++++.|++.....+         .+.++.++++
T Consensus       235 vvid~~G~~~~~~~~~~~l~~gG~vv~~G~~~~~--~~i~~~~~~~k~l~i~G~~g~~~~~---------~~~~~~~l~~  303 (341)
T PRK05396        235 VGLEMSGAPSAFRQMLDAMNHGGRIAMLGIPPGD--MSIDWNKVIFKGLTIKGIYGREMFE---------TWYKMAALLQ  303 (341)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCC--CCCCHHHHHHCCCEEEEEECCCHHH---------HHHHHHHHHH
T ss_conf             9998789899999999986359899999557998--7507999986683899985510577---------8999999997


Q ss_pred             CC-CCCCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             69-8310212474189999999999829981328983
Q gi|254780290|r  296 SH-VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       296 ~g-~l~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~  331 (332)
                      +| .++|.++++|+|+|+++||+.+++|++ |||||.
T Consensus       304 ~g~~~~~lIt~~f~Lee~~eA~~~~~~g~~-gKvVld  339 (341)
T PRK05396        304 SGLDLSPIITHRFPIDDFQKGFEAMRSGQS-GKVILD  339 (341)
T ss_pred             CCCCCCCEEEEEEEHHHHHHHHHHHHCCCC-CEEEEE
T ss_conf             799987436359889999999999977997-179994


No 11 
>TIGR01751 crot-CoA-red crotonyl-CoA reductase; InterPro: IPR010085    Crotonyl-CoA reductase is responsible for the conversion of crotonyl-CoA to butyryl-CoA. In serine cycle methylotrophic bacteria this enzyme is involved in the process of acetyl-CoA to glyoxylate , . In other bacteria the enzyme is used to produce butyrate for incorporation into polyketides such as tylosin from Streptomyces fradiae  and coronatine from Pseudomonas syringae ..
Probab=100.00  E-value=0  Score=431.45  Aligned_cols=317  Identities=25%  Similarity=0.360  Sum_probs=280.3

Q ss_pred             CCCCCEEEEEEC--CCCCCC-EEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCC----------C------C-CC
Q ss_conf             877620899991--568853-07999823787788628999999982787899986887----------7------8-76
Q gi|254780290|r    2 PICKKMRHVAMS--GYGKSN-VMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLY----------P------P-PK   61 (332)
Q Consensus         2 ~~~~~Mka~v~~--~~g~~~-~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~----------~------~-~~   61 (332)
                      ..+|+|+|+.+.  ++|+|. .|+++++|+|+++||||||.|.|+|||+..++...|.-          .      . ..
T Consensus         3 ~~~e~m~af~ir~eR~g~P~qa~~~e~Vp~P~lGP~evLV~VMAagvNYN~VWaa~gePVs~~~~~~~~~~~~~~~~RH~   82 (409)
T TIGR01751         3 VVPETMYAFAIRKERYGDPRQAIRVEQVPVPELGPDEVLVLVMAAGVNYNNVWAALGEPVSTIAARRKYGKDSGLAKRHD   82 (409)
T ss_pred             CCCCHHHEEECHHCCCCCCCCEEECCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHCCCCCCHHHHHHHHCCCCCCCCCCC
T ss_conf             76011320113001478710103507337871076425456666540233488642888676789887213577610157


Q ss_pred             CCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCC-----------------------------CCCCCCCCCCCCCCCCCC
Q ss_conf             687300330002322222212222223333221-----------------------------122333332211111112
Q gi|254780290|r   62 NANPILGLEVAGKIVDLGENTTHWNIGDEVCAL-----------------------------VNGGGYAEYCLSHQGHTL  112 (332)
Q Consensus        62 ~~p~v~G~e~~G~V~~vG~~v~~~~~GdrV~~~-----------------------------~~~G~~ae~~~~~~~~~~  112 (332)
                      .+.+|.|+|++|+|.+||++|++|++||.|+.-                             +++|+||||++|+..+|+
T Consensus        83 ~PfHI~GSd~sGvV~~VG~gV~~w~~GDeVV~sC~q~d~~~~~~~~g~DpM~~~~QrIWGyETn~GsfA~~alV~~~Ql~  162 (409)
T TIGR01751        83 LPFHIIGSDASGVVWRVGEGVTRWKVGDEVVVSCLQVDETAPESRAGADPMLSSEQRIWGYETNYGSFAEFALVKDYQLL  162 (409)
T ss_pred             CCCCEEEECCCCEEEEECCCCCEECCCCEEEEEECCCCCCCHHHCCCCCCCCCCCCEEEEEECCCCCCEEEEEECCCCCC
T ss_conf             88744404456127884587415248886899605666434656268888889873387756788541234344023687


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222223222122222233322211122--22222222221134444432222212222222211122322111111223
Q gi|254780290|r  113 PIPKGYNAIQAASLPESFFTVWANLFQT--ANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLG  190 (332)
Q Consensus       113 ~iP~~~s~~~aa~l~~~~~tA~~~l~~~--~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lG  190 (332)
                      |+|++||+|||||+++...|||.-|+..  +++||||.|||+||+||+|.+|+||+++.|+..|++++||+|.+++++||
T Consensus       163 PKPkhLtWEEaAc~~L~~~TAYRqL~g~~p~~~KpGD~VLIWGAaGGLGs~A~Ql~~a~Gg~Pv~VVSSp~kae~~r~lG  242 (409)
T TIGR01751       163 PKPKHLTWEEAACLLLTGATAYRQLVGWKPAEVKPGDNVLIWGAAGGLGSYAIQLARAGGGIPVAVVSSPDKAEYARELG  242 (409)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCC
T ss_conf             87678886999852101344554420687776688883798426662568999999954895289846778999998759


Q ss_pred             CCCCCCCCCCC-----------------------CCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             32222222221-----------------------11122222222-2111222211111122222112234530479833
Q gi|254780290|r  191 AKHAINYLKED-----------------------FLEILQKETQG-RGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       191 a~~vi~~~~~~-----------------------~~~~i~~~t~g-~g~Divid~~G~~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      |+.+||..+.+                       |-+.+.+.+++ +-+|+|||.+|..++..++-+++++|++++||.+
T Consensus       243 A~~~i~R~d~~~~grlpd~Gn~~a~~~w~k~~~~FG~~i~~~~G~~ed~~iVfEH~G~~TFp~Sv~~~~rgGmVViCggT  322 (409)
T TIGR01751       243 AKAVIDRQDFGHWGRLPDVGNSEAVKEWTKEVKRFGKAIWEVLGEKEDPDIVFEHSGRATFPVSVFVVRRGGMVVICGGT  322 (409)
T ss_pred             CEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCEEEEEEECCCEEEEECCC
T ss_conf             80898054258777887778815688898889998789999807842763678558830117258998258879995787


Q ss_pred             CCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC-CCCC
Q ss_conf             787543222433430532167775124000113789999999999999869831021247418999999999982-9981
Q gi|254780290|r  247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK-SEHI  325 (332)
Q Consensus       247 ~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~-g~~~  325 (332)
                      +|.. .++|.+.|+++-++|.||.+.+..+-          .++.+|++.|+|.|-.+++|+|||+.+|++.|.+ +++.
T Consensus       323 tGY~-~~~D~R~LWM~qKRiqGSHfANlre~----------~e~~~LV~~gr~~PtLS~~y~~eeig~Ah~~~~~N~~~~  391 (409)
T TIGR01751       323 TGYN-HDYDNRFLWMRQKRIQGSHFANLREA----------SEANRLVAKGRVDPTLSEVYPLEEIGKAHQKVLANQHHQ  391 (409)
T ss_pred             CCCC-CCCCHHHHHHHCCHHHHHHHHHHHHH----------HHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCC
T ss_conf             7401-14332555553011244378889999----------999999870831212256678201279999998478965


Q ss_pred             CEEE
Q ss_conf             3289
Q gi|254780290|r  326 GKII  329 (332)
Q Consensus       326 GKvV  329 (332)
                      ||+=
T Consensus       392 Gn~a  395 (409)
T TIGR01751       392 GNVA  395 (409)
T ss_pred             CCEE
T ss_conf             7646


No 12 
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=418.26  Aligned_cols=311  Identities=23%  Similarity=0.298  Sum_probs=258.2

Q ss_pred             EEEEEECCCCCCCEEEEEEECCCCC-CCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCC
Q ss_conf             0899991568853079998237877-886289999999827878999868877876687300330002322222212222
Q gi|254780290|r    7 MRHVAMSGYGKSNVMFLAESPIPQP-QKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHW   85 (332)
Q Consensus         7 Mka~v~~~~g~~~~l~~~~~~~P~~-~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~   85 (332)
                      |||+|++++|.   |+++|+|+|++ ++||||||++++|||++|++.+.+..  ...+|.++|||++|+|+++|++|++|
T Consensus         1 MkA~v~~~~g~---l~~~e~p~P~~~~~~eVlVkv~~~gic~sDl~~~~~~~--~~~~P~i~GhE~~G~V~~vG~~V~~~   75 (347)
T PRK10309          1 MKSVVNDTDGI---VRVAESPIPEIKHQDDVLVKVASSGLCGSDIPRIFKNG--AHYYPITLGHEFSGYVEAVGSGVTDL   75 (347)
T ss_pred             CCEEEEECCCC---EEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHHCCC--CCCCCCCCCCEEEEEEEEECCCCCCC
T ss_conf             94899970897---89998318989981999999999968888889885178--88899845825899999989999869


Q ss_pred             CCCCCCCC---------------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22333322---------------------------112233333221111111222222232221222222333222111
Q gi|254780290|r   86 NIGDEVCA---------------------------LVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLF  138 (332)
Q Consensus        86 ~~GdrV~~---------------------------~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~  138 (332)
                      ++||||+.                           ...+|+||||+++++++++++|+++|+++||.+ .+..++++++ 
T Consensus        76 ~vGdrV~~~~~~~Cg~C~~C~~G~~~~C~~~~~~G~~~~Gg~Aey~~v~~~~~~~iP~~~~~e~aa~~-ep~~~~~~a~-  153 (347)
T PRK10309         76 HPGDAVACVPLLPCFTCPECLRGFYSLCAKYDFIGSRRDGGNAEYIVVKRKNLFALPTDMPIEDGAFI-EPITVGLHAF-  153 (347)
T ss_pred             CCCCEEEECCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEECHHHCCCCCCCHHHHHHHHH-HHHHHHHHHH-
T ss_conf             99998998840688888233389866354555233688876510478548986678720024566767-6677776777-


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-
Q ss_conf             2222222222221134444432222212222222-21112232211111122332222222221111222222222111-
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGID-  216 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~D-  216 (332)
                      +.++.++|++++|+|+ |++|++++|+||++|++ |++++.+++|+++++++|||+++|+++.+. +++.+.+.+.++| 
T Consensus       154 ~~~~~~~g~~vlV~Ga-G~vGl~aiq~ak~~Ga~~V~~~d~~~~kl~~a~~lGAd~~i~~~~~~~-~~~~~~~~~~~~d~  231 (347)
T PRK10309        154 HLAQGCEGKNVIIIGA-GTIGLLAIQCAVALGAKSVTAIDINSEKLALAKSLGAMQTFNSREMSA-PQIQSVLRELRFDQ  231 (347)
T ss_pred             HHCCCCCCCEEEEECC-CCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEEECCCCCCH-HHHHHHHCCCCCCE
T ss_conf             6505888986999899-838999999999859976999928999999999729989986887799-99999862998886


Q ss_pred             CCCCCCCC-CCCCCCCCCCCCCCCCEEEEECCCCCCCC-CCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHH
Q ss_conf             22221111-11222221122345304798337875432-22433430532167775124000113789999999999999
Q gi|254780290|r  217 IILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATE-INLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLL  294 (332)
Q Consensus       217 ivid~~G~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~-~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i  294 (332)
                      +++|++|. .++++++++++++|+++.+|....+...+ .++..++.+++++.|+++.....+...     .+.+..+++
T Consensus       232 vvid~~G~~~~~~~a~~~~~~~G~iv~~G~~~~~~~~~~~~~~~~~~k~~~i~Gs~~~~~~~~~~~-----~~~~a~~li  306 (347)
T PRK10309        232 LILETAGVPQTVELAIEIAGPRAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQ-----EWETASRLL  306 (347)
T ss_pred             EEEECCCCHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHCEEEEEEEEECCCCCCCHH-----HHHHHHHHH
T ss_conf             999799998999999996189749999805788876572428988756179999971467888479-----999999999


Q ss_pred             HCCCC--CCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             86983--10212474189999999999829981328983
Q gi|254780290|r  295 NSHVI--APVIHTVLPLGKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       295 ~~g~l--~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~  331 (332)
                      +++++  +|.|+++|+|+|+++||+.|++++..|||||+
T Consensus       307 ~~gk~~~~plIt~~~~le~~~eA~~~l~~~~~~GKvvlk  345 (347)
T PRK10309        307 TERKLSLEPLIAHRGSFESFAQAVRDLAGNPMPGKVLLQ  345 (347)
T ss_pred             HCCCCCCCCEEEEEEEHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             839899874454498499999999999819991899996


No 13 
>PRK10083 putative dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=411.23  Aligned_cols=303  Identities=24%  Similarity=0.376  Sum_probs=260.6

Q ss_pred             EEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             08999915688530799982378778862899999998278789998688778766873003300023222222122222
Q gi|254780290|r    7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWN   86 (332)
Q Consensus         7 Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~~   86 (332)
                      |||+|++++|   +++++|+|+|+|+++|||||++++|||++|++++.|..+.. .+|.++|||++|+|+++|++|++|+
T Consensus         1 MkA~v~~~p~---~l~~~evp~P~p~~~eVlVkv~a~gICgsDl~~~~G~~~~~-~~P~v~GHE~~G~V~~vG~~V~~~k   76 (339)
T PRK10083          1 MKSIVIEKPN---SLAIRERPIPTPAAGEVRVKVKLAGICGSDSHIYRGHNPFA-KYPRVIGHEFFGVIDAVGDGVDAAR   76 (339)
T ss_pred             CCEEEEECCC---EEEEEEEECCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCC-CCCCCCCCEEEEEEEEECCCCCCCC
T ss_conf             9489996299---18999838998994989999999989899999973999988-9996576414899999678756665


Q ss_pred             CCCCCCC---------------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2333322---------------------------1122333332211111112222222322212222223332221112
Q gi|254780290|r   87 IGDEVCA---------------------------LVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQ  139 (332)
Q Consensus        87 ~GdrV~~---------------------------~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~  139 (332)
                      +||||+.                           +..+|+||||+++++++++++|+++|+++|+ +..++.++++++ +
T Consensus        77 ~GdrV~~~~~~~Cg~C~~C~~G~~~~C~~~~~~G~~~~Gg~aey~~vp~~~~~~iP~~~~~~~aa-l~~p~~~~~~~~-~  154 (339)
T PRK10083         77 IGERVAVDPVISCGHCYPCSIGKPNVCTSLVVLGVHRDGGFSEYAVVPAKNAHRIPDAIADQHAV-MVEPFTIAANVT-G  154 (339)
T ss_pred             CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECHHHCCCCCCCHHHHHHH-HCCCHHHHHHHH-H
T ss_conf             68899993301579964334898550345420165789753326887579903588403457776-403045789999-8


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222222113444443222221222-2222-211122322111111223322222222211112222222221112
Q gi|254780290|r  140 TANLRSGQTVLIHGGSSGIGTTAIQLASY-FGAT-VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDI  217 (332)
Q Consensus       140 ~~~~~~g~~vlV~ga~g~vG~~a~qla~~-~G~~-vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Di  217 (332)
                      .+++++|++++|+| +|++|++++|++++ .|++ |++++++++|+++++++|||+++|++++++.+.+.+  .|.++|+
T Consensus       155 ~~~~~~g~~VlV~G-~G~iGl~~~~~~~~~~ga~~Vi~~d~~~~rl~~A~~~GAd~vi~~~~~~~~~~~~~--~G~~~dv  231 (339)
T PRK10083        155 RTGPTEQDVALIYG-AGPVGLTIVQVLKGVYGVKNVIVADRIDERLALAKESGADWVINNAQESLAEALAE--KGVKPTL  231 (339)
T ss_pred             HHCCCCCCEEEEEC-CCHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHCCCCEEECCCCCCHHHHHHH--CCCCCCE
T ss_conf             61899998899958-76599999999998569978999379899999999719989984887669999985--3999619


Q ss_pred             CCCCCCC-CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHC
Q ss_conf             2221111-112222211223453047983378754322243343053216777512400011378999999999999986
Q gi|254780290|r  218 ILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS  296 (332)
Q Consensus       218 vid~~G~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~  296 (332)
                      +||++|. ..+++++++++++|+++.+|..+.  +..++...++.|++++.|+....           ....++.+++++
T Consensus       232 vid~~g~~~~~~~a~~~~~~gG~iv~~G~~~~--~~~i~~~~~~~k~l~i~gs~~~~-----------~~~~~~~~li~~  298 (339)
T PRK10083        232 IFDAACHPSILEEAVTLASPAARIVLMGFSSE--PSEIVQQGITGKELTIYSSRLNA-----------NKFPVVIDWLAK  298 (339)
T ss_pred             EEECCCCHHHHHHHHHHHHCCEEEEEEECCCC--CCCCCHHHHHHCEEEEEECCCCH-----------HHHHHHHHHHHC
T ss_conf             99666688999999998518809999925899--87536888742678999922688-----------899999999985


Q ss_pred             CCCCC--CCEEEEEHHHHHHHHHHHHCC-CCCCEEEEE
Q ss_conf             98310--212474189999999999829-981328983
Q gi|254780290|r  297 HVIAP--VIHTVLPLGKVAMAHDIMEKS-EHIGKIILL  331 (332)
Q Consensus       297 g~l~p--~i~~~~~l~~i~~A~~~l~~g-~~~GKvVi~  331 (332)
                      |+++|  +++++|+|+|+++||+.++++ +..|||||+
T Consensus       299 g~i~~~~lIt~~f~L~~~~~A~~~~~~~~~~~~Kvvlt  336 (339)
T PRK10083        299 GLIDPEKLITHTFDFQHVADAIELFEKDQRHCCKVLLT  336 (339)
T ss_pred             CCCCHHHEEEEEEEHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             99991570899989899999999986599895899999


No 14 
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein; InterPro: IPR014182   Members of this entry form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases. Some current members of this entry carry designations as putative alginate lyase, however none have been characterised as such..
Probab=100.00  E-value=0  Score=415.14  Aligned_cols=317  Identities=26%  Similarity=0.422  Sum_probs=280.6

Q ss_pred             EEEEECCCCC----CCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCC
Q ss_conf             8999915688----530799982378778862899999998278789998688778766873003300023222222122
Q gi|254780290|r    8 RHVAMSGYGK----SNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTT   83 (332)
Q Consensus         8 ka~v~~~~g~----~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~   83 (332)
                      |||-|.++|.    ++-|.--++|.|+|+..|+||+|+|.|+||.|.++|.+..|..-.-|-|+|.|++|+|.+||++||
T Consensus         1 kAvgY~~~GlPI~~~~AL~Di~~~~P~p~grDlLVEVKAvSVNPVDtKVR~~~~p~~Ggq~KILGWDAAGVV~avG~~Vt   80 (338)
T TIGR02817         1 KAVGYKKPGLPITDPDALVDIDLPKPKPGGRDLLVEVKAVSVNPVDTKVRARVAPEAGGQPKILGWDAAGVVKAVGDEVT   80 (338)
T ss_pred             CCEEECCCCCCCCCHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCCC
T ss_conf             94010388888573002523305888889853068888887268860012778768888742310342212602188100


Q ss_pred             CCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCCCC
Q ss_conf             222233332---21122333332211111112222222322212222223332221112222222-----2222211344
Q gi|254780290|r   84 HWNIGDEVC---ALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRS-----GQTVLIHGGS  155 (332)
Q Consensus        84 ~~~~GdrV~---~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~-----g~~vlV~ga~  155 (332)
                      -|||||+||   .+.|+|++|||.+||+.-+-++|+.+||++||+||++-+|||..||++.++..     +..+||+||+
T Consensus        81 LFKpGDeVwYAG~i~RpGsNaEfhLVDERIVG~KP~sLsfa~AAALPLT~ITAWElLFDRL~~~~~~~~~~~~lLIiGgA  160 (338)
T TIGR02817        81 LFKPGDEVWYAGDITRPGSNAEFHLVDERIVGHKPKSLSFAEAAALPLTSITAWELLFDRLGINDPVAGAKRALLIIGGA  160 (338)
T ss_pred             EECCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCC
T ss_conf             10278755754336888314688877899836898960089997310248999999886615897688888747897388


Q ss_pred             CCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCC
Q ss_conf             44432222212222-2222111223221111112233222222222111122222222211122221111-112222211
Q gi|254780290|r  156 SGIGTTAIQLASYF-GATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA-EYLNQHLTL  233 (332)
Q Consensus       156 g~vG~~a~qla~~~-G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~-~~~~~~~~~  233 (332)
                      ||||++++||||.+ +++||+|++.+|..+.+++||||+|||++. ++.+++.++--. -+++||-++-. ..+++..++
T Consensus       161 GGVGSI~iQLAR~LT~ltVIaTASRpEs~~Wv~~LGAH~VIDHsk-PL~~ql~~L~l~-~v~~V~SlT~TDqH~~~ive~  238 (338)
T TIGR02817       161 GGVGSILIQLARQLTGLTVIATASRPESQEWVLELGAHHVIDHSK-PLKAQLEKLGLE-AVSYVFSLTHTDQHFKEIVEL  238 (338)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEECCCC-CHHHHHHHHCCC-CCCEEECCCHHHHHHHHHHHH
T ss_conf             517899999999854964999728578999999739918865884-368999982889-985575166078999999998


Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHH--HHHHHHHHHHHHCCCCCCCCEEEEEH--
Q ss_conf             22345304798337875432224334305321677751240001137899--99999999999869831021247418--
Q gi|254780290|r  234 LSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIR--DSLQLKIWPLLNSHVIAPVIHTVLPL--  309 (332)
Q Consensus       234 l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~--~~~~~~~~~~i~~g~l~p~i~~~~~l--  309 (332)
                      |+|+||+..+     +++..++..++-.|.+++++..|++++-+..+...  +.+..++.+|+++|+||..+++.|+.  
T Consensus       239 laPQGrlaLI-----DDP~~LD~~~lK~KSiSlHWE~MfTRS~f~T~Dmi~QH~LLn~VA~LvD~G~irTTl~e~~G~IN  313 (338)
T TIGR02817       239 LAPQGRLALI-----DDPAELDVSPLKRKSISLHWEFMFTRSMFQTEDMIEQHELLNRVARLVDAGKIRTTLAETFGAIN  313 (338)
T ss_pred             HCCCCCEECC-----CCCCCCCHHHHCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCC
T ss_conf             5678740000-----28700163132101302112455417766746699999999999888649846531103478546


Q ss_pred             -HHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             -9999999999829981328983
Q gi|254780290|r  310 -GKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       310 -~~i~~A~~~l~~g~~~GKvVi~  331 (332)
                       +++.+||..+|+|+++||||+-
T Consensus       314 AanLkrAHaliEsG~aRGKIVLe  336 (338)
T TIGR02817       314 AANLKRAHALIESGKARGKIVLE  336 (338)
T ss_pred             HHHHHHHHHHHCCCCCCCCEEEC
T ss_conf             68899998642078555303207


No 15 
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase. Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Probab=100.00  E-value=0  Score=400.71  Aligned_cols=305  Identities=21%  Similarity=0.311  Sum_probs=261.0

Q ss_pred             EEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99915688530799982378778862899999998278789998688778766873003300023222222122222233
Q gi|254780290|r   10 VAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGD   89 (332)
Q Consensus        10 ~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~~~Gd   89 (332)
                      |+++++|.|  |+++|+|+|+|+++|||||++++|||++|++.+.+..+....+|.++|||++|+|+++|++|++| +||
T Consensus         2 ~v~~e~g~p--l~~~evp~P~p~~~eVlVkv~a~GICgsDl~~~~~g~~~~~~~P~vlGHE~~G~Vv~vG~~v~~~-vGd   78 (349)
T TIGR03201         2 WMMTEPGKP--MVKTRVEIPELGAGDVVVKVAGCGVCHTDLSYYYMGVRTNHALPLALGHEISGRVIQAGAGAASW-IGK   78 (349)
T ss_pred             EEEEECCCC--CEEEECCCCCCCCCEEEEEEEEEEECHHHHHHHHCCCCCCCCCCCCCCCEEEEEEEEECCCCCCC-CCC
T ss_conf             079708898--78998058998989799999999797899999818888678898365417999999848998776-799


Q ss_pred             CCCCC---------------------------CCCCCCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCCCC
Q ss_conf             33221---------------------------1223333322111111122222------22322212222223332221
Q gi|254780290|r   90 EVCAL---------------------------VNGGGYAEYCLSHQGHTLPIPK------GYNAIQAASLPESFFTVWAN  136 (332)
Q Consensus        90 rV~~~---------------------------~~~G~~ae~~~~~~~~~~~iP~------~~s~~~aa~l~~~~~tA~~~  136 (332)
                      ||+..                           ..+|+||||+++++++++++|+      +++++++|.+.++..|+|++
T Consensus        79 rV~v~~~~~Cg~C~~C~~G~~~~C~~~~~~g~~~~Ggfaey~~vp~~~~~~v~~~~~~~~~~~~~~~a~~~~~~~t~~~a  158 (349)
T TIGR03201        79 AVIVPAVIPCGECELCKTGRGTICRAQKMPGNDMQGGFASHIVVPAKGLCVVDEARLAAAGLPLEHVSVVADAVTTPYQA  158 (349)
T ss_pred             EEEECCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEHHHEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             19994411578704204888553345534687888886135987504289866335565689988999876466655535


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCC
Q ss_conf             1122222222222211344444322222122222222111223221111112233222222222---1111222222222
Q gi|254780290|r  137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKE---DFLEILQKETQGR  213 (332)
Q Consensus       137 l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~---~~~~~i~~~t~g~  213 (332)
                      +. .+++++|++|+|.| +|++|++++|+||++|++|++++.+++|+++++++||++++|+++.   ++.+.+...+.+.
T Consensus       159 ~~-~~~v~~g~~V~V~G-~G~iGl~a~~~ak~~Ga~Vi~vd~~~~rle~a~~~Ga~~~i~~~~~~~~~~~~~~~~~~~~~  236 (349)
T TIGR03201       159 AV-QAGLKKGDLVIVIG-AGGVGGYMVQTAKAMGAAVVAIDIDPEKLEMMKGFGADLTLNPKDKSAREVKKLIKAFAKAR  236 (349)
T ss_pred             HH-HCCCCCCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHHCCCC
T ss_conf             63-11789998899989-74899999999998599799994999999999964998998787677899999997541456


Q ss_pred             CCC----CCCCCCCC-CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHH
Q ss_conf             111----22221111-1122222112234530479833787543222433430532167775124000113789999999
Q gi|254780290|r  214 GID----IILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQL  288 (332)
Q Consensus       214 g~D----ivid~~G~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~  288 (332)
                      |+|    ++||++|. ..+++++++++++|+++.+|.....  .++++..++.+++++.|++.....+          ..
T Consensus       237 G~~~~~~~v~e~~G~~~~~~~a~~~~~~gG~iv~vG~~~~~--~~~~~~~l~~~~~~i~Gs~~~~~~~----------~~  304 (349)
T TIGR03201       237 GLRSTGWKIFECSGSKPGQESALSLLSHGGTLVVVGYTMAK--TEYRLSNLMAFHARALGNWGCPPDR----------YP  304 (349)
T ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHCCCCCEEEEECCCCCC--CCCCHHHHHHCCEEEEECCCCCHHH----------HH
T ss_conf             75655636998248889999999973589799997505998--7554899873667999856899789----------99


Q ss_pred             HHHHHHHCCCCC--CCCEEEEEHHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             999999869831--02124741899999999998299813289839
Q gi|254780290|r  289 KIWPLLNSHVIA--PVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP  332 (332)
Q Consensus       289 ~~~~~i~~g~l~--p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~P  332 (332)
                      ++.+++.+|++.  +.+ +.|||+|+++||+.|++|+..||+||+|
T Consensus       305 ~~~~li~~gki~~~~~i-~~~pL~~~~eAf~~~~~gk~~~rvVl~P  349 (349)
T TIGR03201       305 AALDLVLDGKIQLGPFV-ERRPLDQIEHVFAAAHHHKLKRRAILTP  349 (349)
T ss_pred             HHHHHHHCCCCCCCCCE-EEEEHHHHHHHHHHHHCCCCCCEEEECC
T ss_conf             99999986988985648-9831999999999997799941499729


No 16 
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family; InterPro: IPR014188   This entry represents a subfamily of the alcohol dehydrogenase, a superfamily in which some members are zinc-binding medium-chain alcohol dehydrogenases while others are quinone oxidoreductases with no bound zinc. This entry includes YhdH from Escherichia coli and YhfP from Bacillus subtilis both of which bind NADPH or NAD, but not zinc. Both proteins have been studied crystallographically for insight into function. .
Probab=100.00  E-value=0  Score=389.46  Aligned_cols=314  Identities=19%  Similarity=0.292  Sum_probs=273.3

Q ss_pred             EEEEECC-CCC-CCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCC
Q ss_conf             8999915-688-53079998237877886289999999827878999868877876687300330002322222212222
Q gi|254780290|r    8 RHVAMSG-YGK-SNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHW   85 (332)
Q Consensus         8 ka~v~~~-~g~-~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~   85 (332)
                      ||+++++ -.+ .-.-++++.+.-.+.+|||||||+||+||+.|-+..+|..+-.+++|+|||+|++|+|++  |+..+|
T Consensus         1 ~Alvv~~d~~~~~~~~~~~~l~~~~Lp~GdVli~V~YSs~NYKDALA~tg~g~v~R~yP~~PGID~aG~Vv~--S~dp~F   78 (330)
T TIGR02823         1 KALVVEKDDEDGKVSAEVEELDLSDLPEGDVLIKVAYSSLNYKDALAITGKGGVVRSYPMIPGIDLAGTVVS--SEDPRF   78 (330)
T ss_pred             CCEEEEEECCCCCEEEEEEEEEHHHCCCCCEEEEEEECCCCHHHHHEECCCCCEEEECCCCCCCCCEEEEEE--CCCCCC
T ss_conf             915888755898489999982065578997399999868763033101387976887787688175468984--488775


Q ss_pred             CCCCCCC------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCC-CCCCC-CCCCCCCC
Q ss_conf             2233332------2112233333221111111222222232221222222333222111--2222-22222-22211344
Q gi|254780290|r   86 NIGDEVC------ALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLF--QTAN-LRSGQ-TVLIHGGS  155 (332)
Q Consensus        86 ~~GdrV~------~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~--~~~~-~~~g~-~vlV~ga~  155 (332)
                      ++||+|.      |..++|+||||++||+++++|+|+++|+.||++++.+++||..|+.  +... ++|.+ -|||+||+
T Consensus        79 ~~GD~VivTGyglG~~H~GGysqyaRVp~dWlVpLP~glsl~eAM~~GTAGfTAaL~V~aLe~~Gl~~P~~GpVlVTGAt  158 (330)
T TIGR02823        79 RPGDEVIVTGYGLGVSHDGGYSQYARVPADWLVPLPEGLSLREAMALGTAGFTAALSVMALERNGLLTPEDGPVLVTGAT  158 (330)
T ss_pred             CCCCEEEEEEECCCCCCCCCCEEEEEECHHHEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCC
T ss_conf             78871899740245651576223567332310158898898899986007789999999999726888888878870677


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             4443222221222222221112232211-111122332222222221111--2222222221112222111111222221
Q gi|254780290|r  156 SGIGTTAIQLASYFGATVYTTAKSEEKC-LACLKLGAKHAINYLKEDFLE--ILQKETQGRGIDIILDMVGAEYLNQHLT  232 (332)
Q Consensus       156 g~vG~~a~qla~~~G~~vi~~~~~~~~~-~~~~~lGa~~vi~~~~~~~~~--~i~~~t~g~g~Divid~~G~~~~~~~~~  232 (332)
                      ||||.+|+.|+..+|++|+|..+.+++. ++||+|||.+||+..+  +.+  ..+-+-+ +.++-++||+|++++...++
T Consensus       159 GGVGS~Av~~L~~lGY~V~A~tGk~~~~~~yL~~LGA~evi~R~~--l~~~a~~kPL~k-~~WAGAvDtVGG~~La~~l~  235 (330)
T TIGR02823       159 GGVGSLAVAILSKLGYEVVASTGKAEEEVEYLKELGASEVIDREE--LSEDAPGKPLEK-ERWAGAVDTVGGKTLANVLA  235 (330)
T ss_pred             CCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCHHH--CCCCCCCCCCCC-CCCCCEEECCCHHHHHHHHH
T ss_conf             877899999998379769997378377889998658110577112--276878886312-22221574687579999998


Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHH
Q ss_conf             12234530479833787543222433430532167775124000113789999999999999869831021247418999
Q gi|254780290|r  233 LLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV  312 (332)
Q Consensus       233 ~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i  312 (332)
                      .++.+|.+..||+.+|... +...+||+.|++++.|..    +-..+...|..+|+++..-+.-.+|.-...++.+|||+
T Consensus       236 ~~~ygG~VA~cGlagG~~L-~tTV~PFILRGV~LlGID----SV~~p~~~R~~~W~RLA~dl~~~~L~~~~~~ei~L~el  310 (330)
T TIGR02823       236 QLKYGGAVAACGLAGGADL-PTTVLPFILRGVSLLGID----SVYCPMALREAAWQRLATDLKPRNLESLTTQEITLEEL  310 (330)
T ss_pred             HHCCCCEEEEEECCCCCCC-CCEECCHHHCCCEEEEEC----HHCCCHHHHHHHHHHHHHHCCHHHHHHHHCCCCCHHHH
T ss_conf             4068978999942679863-501255043285388853----00188789999999887415977888784200157768


Q ss_pred             HHHHHHHHCCCCCCEEEEE
Q ss_conf             9999999829981328983
Q gi|254780290|r  313 AMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       313 ~~A~~~l~~g~~~GKvVi~  331 (332)
                      +++++.|.+|+++||+||+
T Consensus       311 p~~~~~~l~G~~~GRtvV~  329 (330)
T TIGR02823       311 PEAAEQILAGQVRGRTVVD  329 (330)
T ss_pred             HHHHHHHHCCCCCCEEEEE
T ss_conf             9999999738830058774


No 17 
>KOG0023 consensus
Probab=100.00  E-value=0  Score=381.06  Aligned_cols=309  Identities=26%  Similarity=0.350  Sum_probs=274.3

Q ss_pred             CCCCCCEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCC
Q ss_conf             98776208999915688530799982378778862899999998278789998688778766873003300023222222
Q gi|254780290|r    1 MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGE   80 (332)
Q Consensus         1 m~~~~~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~   80 (332)
                      |.+|+|.++|.++.+++...+++.+++.|+++++||+|||++||||++|+|.+.|..+. ..+|.|+|||++|+|+++|+
T Consensus         4 ~~~p~k~~g~~~~~~~G~l~p~~~~~~~~~~g~~dv~vkI~~cGIChsDlH~~~gdwg~-s~~PlV~GHEiaG~VvkvGs   82 (360)
T KOG0023           4 MSIPEKQFGWAARDPSGVLSPEVFSFPVREPGENDVLVKIEYCGVCHSDLHAWKGDWGL-SKYPLVPGHEIAGVVVKVGS   82 (360)
T ss_pred             CCCCHHHEEEEEECCCCCCCCCEEEECCCCCCCCCEEEEEEEEECCCHHHHHHHCCCCC-CCCCCCCCCEEEEEEEEECC
T ss_conf             44752117999977888888620670689999873799999973163467776255676-65885468520479999778


Q ss_pred             CCCCCCCCCCCC------------------------------CCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             122222233332------------------------------2112-----23333322111111122222223222122
Q gi|254780290|r   81 NTTHWNIGDEVC------------------------------ALVN-----GGGYAEYCLSHQGHTLPIPKGYNAIQAAS  125 (332)
Q Consensus        81 ~v~~~~~GdrV~------------------------------~~~~-----~G~~ae~~~~~~~~~~~iP~~~s~~~aa~  125 (332)
                      +|++|++||||=                              +...     .|+||+|+++++.++++||+++++++||.
T Consensus        83 ~V~~~kiGD~vGVg~~~~sC~~CE~C~~~~E~yCpk~~~t~~g~~~DGt~~~ggf~~~~~v~~~~a~kIP~~~pl~~aAP  162 (360)
T KOG0023          83 NVTGFKIGDRVGVGWLNGSCLSCEYCKSGNENYCPKMHFTYNGVYHDGTITQGGFQEYAVVDEVFAIKIPENLPLASAAP  162 (360)
T ss_pred             CCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEECCCCCCHHHCCC
T ss_conf             86544105766455772441576010258733587426743441227878556632048982046898899997100146


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC-CCCCC
Q ss_conf             2222333222111222222222222113444443222221222222221112232-211111122332222222-22111
Q gi|254780290|r  126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE-EKCLACLKLGAKHAINYL-KEDFL  203 (332)
Q Consensus       126 l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~-~~~~~~~~lGa~~vi~~~-~~~~~  203 (332)
                      +.|++.|.|.+|. ..++.||+++-|.|+.| +|++++|+||++|++|++++++. +|.+.++.||||+.++++ +++..
T Consensus       163 lLCaGITvYspLk-~~g~~pG~~vgI~GlGG-LGh~aVq~AKAMG~rV~vis~~~~kkeea~~~LGAd~fv~~~~d~d~~  240 (360)
T KOG0023         163 LLCAGITVYSPLK-RSGLGPGKWVGIVGLGG-LGHMAVQYAKAMGMRVTVISTSSKKKEEAIKSLGADVFVDSTEDPDIM  240 (360)
T ss_pred             HHHCCEEEEEHHH-HCCCCCCCEEEEECCCC-CCHHHHHHHHHHCCEEEEEECCCHHHHHHHHHCCCCEEEEECCCHHHH
T ss_conf             2215327730267-73999986898855764-016899999870867999927853489999854962158842787899


Q ss_pred             CCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHH
Q ss_conf             12222222221112222111---111222221122345304798337875432224334305321677751240001137
Q gi|254780290|r  204 EILQKETQGRGIDIILDMVG---AEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQ  280 (332)
Q Consensus       204 ~~i~~~t~g~g~Divid~~G---~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~  280 (332)
                      ++++..+.     .++|++.   ...++.++.+++.+|+++.+|.+..  +..++..++..+.+++.||..+++.+.   
T Consensus       241 ~~~~~~~d-----g~~~~v~~~a~~~~~~~~~~lk~~Gt~V~vg~p~~--~~~~~~~~lil~~~~I~GS~vG~~ket---  310 (360)
T KOG0023         241 KAIMKTTD-----GGIDTVSNLAEHALEPLLGLLKVNGTLVLVGLPEK--PLKLDTFPLILGRKSIKGSIVGSRKET---  310 (360)
T ss_pred             HHHHHHHC-----CCCEEEEECCCCCHHHHHHHHCCCCEEEEEECCCC--CCCCCCCCCEECCEEEEECCCCCHHHH---
T ss_conf             99987526-----75023210232443888876103978999836677--656765000024379874032548879---


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             89999999999999869831021247418999999999982998132898
Q gi|254780290|r  281 SIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL  330 (332)
Q Consensus       281 ~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi  330 (332)
                             ++++++++++.+++.+ +..+++++++||++|++++.++|.||
T Consensus       311 -------~E~Ldf~a~~~ik~~I-E~v~~~~v~~a~erm~kgdV~yRfVv  352 (360)
T KOG0023         311 -------QEALDFVARGLIKSPI-ELVKLSEVNEAYERMEKGDVRYRFVV  352 (360)
T ss_pred             -------HHHHHHHHCCCCCCCE-EEEEHHHHHHHHHHHHHCCEEEEEEE
T ss_conf             -------9999999717886746-99754277899999871670169999


No 18 
>TIGR00692 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627   L-threonine 3-dehydrogenase (1.1.1.103 from EC) is a tetrameric, zinc-binding, NAD-dependent enzyme of threonine catabolism. It catalyses the conversion of L-threonine and NAD+ to L-2-amino-3-oxobutanoate and NADH. In Escherichia coli His-90 modulates substrate specificity and is believed part of the active site. Closely related proteins include sorbitol dehydrogenase, xylitol dehydrogenase, and benzyl alcohol dehydrogenase. Eukaryotic examples of this enzyme have been demonstrated experimentally but are not detected by this HMM. ; GO: 0008270 zinc ion binding, 0008743 L-threonine 3-dehydrogenase activity, 0006567 threonine catabolic process.
Probab=100.00  E-value=0  Score=388.88  Aligned_cols=298  Identities=28%  Similarity=0.458  Sum_probs=259.6

Q ss_pred             CEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHC-CCCCC-CCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCC----
Q ss_conf             307999823787788628999999982787899986-88778-766873003300023222222122222233332----
Q gi|254780290|r   19 NVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRK-GLYPP-PKNANPILGLEVAGKIVDLGENTTHWNIGDEVC----   92 (332)
Q Consensus        19 ~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~-G~~~~-~~~~p~v~G~e~~G~V~~vG~~v~~~~~GdrV~----   92 (332)
                      +-..+.|+|+|+++++||||||++++||++|+|+|+ ....+ .=+.|.|.|||++|+|+.+|++|+++++||||.    
T Consensus         9 ~Ga~lteVpvPe~g~~evLIKv~atsICGTDvHIYnWdeWaq~rIk~P~v~GHE~~G~VvgiG~~V~g~kvGdyVS~EtH   88 (341)
T TIGR00692         9 YGAVLTEVPVPELGKNEVLIKVKATSICGTDVHIYNWDEWAQKRIKVPYVVGHEYAGEVVGIGEEVKGVKVGDYVSAETH   88 (341)
T ss_pred             CEEEEEECCCCCCCCCCEEEEEEEEECCCCCCCEECCCHHHHCCCCCCEEEEEEEEEEEEEECCCCCEEEECCEEECCCE
T ss_conf             50698761789888874165554300247743044324264345899827602588899877898245884766613611


Q ss_pred             -----------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             -----------------------211223333322111111122222223222122222233322211122222222222
Q gi|254780290|r   93 -----------------------ALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTV  149 (332)
Q Consensus        93 -----------------------~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~v  149 (332)
                                             |..+.|.||||+++|++|+||.|+++|++-| ++-.|+.-|-+..... + -.|+++
T Consensus        89 IvCG~C~~Cr~G~~HvC~NT~i~GVdt~GcFAEY~vvPA~Niwk~P~~i~p~~A-~iqePlGNAVhTvL~~-~-~~G~~v  165 (341)
T TIGR00692        89 IVCGKCVACRRGKSHVCRNTKIVGVDTDGCFAEYVVVPADNIWKNPKDIDPELA-AIQEPLGNAVHTVLES-D-LAGEDV  165 (341)
T ss_pred             EECCEECCCCCCCCEEEECCEEEEECCCCCEEEEEEECCCCCCCCCCCCCCCHH-HHHCCCCHHHHHHHCC-C-CCCCCE
T ss_conf             443600368888813452454788669980585676063111258798870158-6615411044465257-7-688718


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC
Q ss_conf             2113444443222221222222-22111223221111112233222222222111122222222211122221111-112
Q gi|254780290|r  150 LIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA-EYL  227 (332)
Q Consensus       150 lV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~-~~~  227 (332)
                      ||.| +|++|+||+..||+.|| +|++++.|+=|++++|++|++.++|-.+||+.+.++++|.++|+|+++|.+|. +.+
T Consensus       166 lv~G-aGPiGlma~AVAKa~GA~~Vi~~d~neyRleLAkk~Gat~~vn~~kEd~~k~v~~lt~geG~Dv~lEmSGaP~A~  244 (341)
T TIGR00692       166 LVIG-AGPIGLMAVAVAKAAGARNVIVIDKNEYRLELAKKMGATRVVNVAKEDLVKVVAELTSGEGVDVVLEMSGAPKAL  244 (341)
T ss_pred             EEEC-CCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHCCCCCEEEEEECCCCCHHH
T ss_conf             9985-774789999998772784059965864799999870986587010147689888403889647998648991799


Q ss_pred             CCCCCCCCCCCCCEEEEECCCCCCCCCCCC-HHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCC--CCCCE
Q ss_conf             222211223453047983378754322243-343053216777512400011378999999999999986983--10212
Q gi|254780290|r  228 NQHLTLLSKEGKLIIISFLGGNIATEINLN-PIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVI--APVIH  304 (332)
Q Consensus       228 ~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~-~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l--~p~i~  304 (332)
                      ++.+..++++||+..+|...+..  .+|+. .+++|.+++.|.+.+.+++.         |.++.+|+.++.|  .|.|+
T Consensus       245 ~~gL~~~~~gGR~~~Lglpp~~v--tID~tNkviFKgLtI~GItGR~mfeT---------Wy~vs~LiqS~~ldL~PiIT  313 (341)
T TIGR00692       245 EQGLDAVANGGRVALLGLPPSDV--TIDLTNKVIFKGLTIKGITGRKMFET---------WYKVSRLIQSNKLDLSPIIT  313 (341)
T ss_pred             HHHHHHHCCCCEEEECCCCCCCE--EEEECCCEEEEEEEEEEECCCCHHHH---------HHHHHHHHCCCCCCCCCEEE
T ss_conf             99999850688089813689761--26303747886427720007504678---------99999984268835684554


Q ss_pred             EEEE-HHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             4741-899999999998299813289839
Q gi|254780290|r  305 TVLP-LGKVAMAHDIMEKSEHIGKIILLP  332 (332)
Q Consensus       305 ~~~~-l~~i~~A~~~l~~g~~~GKvVi~P  332 (332)
                      |.|+ ||+++++|+.|++|| .||||+.|
T Consensus       314 H~f~G~d~fekgFelMRsGq-~GKVil~~  341 (341)
T TIGR00692       314 HKFKGLDEFEKGFELMRSGQ-SGKVILIL  341 (341)
T ss_pred             CCCCCCHHHHHHHHHHHCCC-CCEEEEEC
T ss_conf             02688314678888763789-53287629


No 19 
>PRK09880 L-idonate 5-dehydrogenase; Provisional
Probab=100.00  E-value=0  Score=379.99  Aligned_cols=304  Identities=20%  Similarity=0.267  Sum_probs=252.8

Q ss_pred             CCCCEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCC-CCCC-CCCCCCEECCCCCCCCCCCCC
Q ss_conf             77620899991568853079998237877886289999999827878999868-8778-766873003300023222222
Q gi|254780290|r    3 ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKG-LYPP-PKNANPILGLEVAGKIVDLGE   80 (332)
Q Consensus         3 ~~~~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G-~~~~-~~~~p~v~G~e~~G~V~~vG~   80 (332)
                      |+.||||+|+++++   .++++|.|+|.++ ++|||||.++|||++|++.+++ ..+. ....|.++|||++|+|++  +
T Consensus         1 m~~~~~a~v~~gp~---~~~~~e~~~~~~~-~~vlVkv~~~GICgSDl~~~~~g~~g~~~~~~P~i~GHE~~G~VV~--~   74 (343)
T PRK09880          1 MKVKTQSCVVAGKK---DVAVTEQEIEWNN-NGTLVQITRGGICGSDLHYYQEGKVGNFMIKAPMVLGHEVIGKIVH--S   74 (343)
T ss_pred             CCCEEEEEEEECCC---CEEEEECCCCCCC-CCEEEEEEEEEECHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEEE--C
T ss_conf             98568999998898---6379957989999-9889998089668878998708877886788982603268999993--3


Q ss_pred             CCCCCCCCCCCCCC---------------------------C-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             12222223333221---------------------------1-----223333322111111122222223222122222
Q gi|254780290|r   81 NTTHWNIGDEVCAL---------------------------V-----NGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE  128 (332)
Q Consensus        81 ~v~~~~~GdrV~~~---------------------------~-----~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~  128 (332)
                      ++++|++||||+..                           .     .+|+||||+++++++++|+|+++|++++| +..
T Consensus        75 ~~~~~kvGDrV~v~~~~~Cg~C~~C~~G~~~~C~~~~~~G~~~~~~~~dGgfaEy~~v~~~~~~~~p~~~~~~~aa-l~e  153 (343)
T PRK09880         75 DSSDLHEGQTVAINPSKPCGHCKYCLSHEENQCTEMRFFGSAMYFPHVDGGFTRYKVVDTAQCIPYPAKADEKVMA-FAE  153 (343)
T ss_pred             CCCCCCCCCEEEECCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHEECCCCCCCHHHHE-ECC
T ss_conf             8998889996998970588997576288855466741411123158878404117863578843366689878833-234


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2333222111222222222222113444443222221222222-221112232211111122332222222221111222
Q gi|254780290|r  129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQ  207 (332)
Q Consensus       129 ~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~  207 (332)
                      +..|+++++. .+...+|++|+|.| +|++|++++|+|+++|+ +|++++.+++|+++++++||++++|++++++.+...
T Consensus       154 pla~a~~a~~-~~~~~~g~~VlV~G-~G~iGl~~~~~ak~~Ga~~Vi~~d~~~~rl~~a~~~Ga~~~i~~~~~~~~~~~~  231 (343)
T PRK09880        154 PLAVAIHAAH-QAGDLQGKRVFISG-VGPIGCLIVSAVKTLGAAEIVCADLSPRSLSLARQMGADVLVNPQNDDMDHWKA  231 (343)
T ss_pred             HHHHHHHHHH-HCCCCCCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEEECCCCCCHHHHHH
T ss_conf             0332302665-24775698899984-776799999999986998799997978999999972997998798743999996


Q ss_pred             CCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHH
Q ss_conf             22222211122221111-11222221122345304798337875432224334305321677751240001137899999
Q gi|254780290|r  208 KETQGRGIDIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSL  286 (332)
Q Consensus       208 ~~t~g~g~Divid~~G~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~  286 (332)
                      .   ..++|++||++|. ..+++++++++++|+++.+|...  ....+++..++.|++++.|++.+.      .    . 
T Consensus       232 ~---~g~~Dvvie~~G~~~~~~~al~~~r~gG~iv~vG~~~--~~~~~~~~~l~~kei~i~Gs~~~~------~----~-  295 (343)
T PRK09880        232 E---KGYFDVSFEVSGHPSSVNTCLEVTRAKGVMVQVGMGG--AMPEFPMMTLISKEISLKGSFRFT------S----E-  295 (343)
T ss_pred             H---CCCCCEEEEECCCHHHHHHHHHHCCCCEEEEEEECCC--CCCCCCHHHHHHCCCEEEEECCCH------H----H-
T ss_conf             3---6997789992199999999997377983999997279--888708999985884999904867------9----9-


Q ss_pred             HHHHHHHHHCCCCC--CCCEEEEEHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             99999999869831--0212474189999999999829981328983
Q gi|254780290|r  287 QLKIWPLLNSHVIA--PVIHTVLPLGKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       287 ~~~~~~~i~~g~l~--p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~  331 (332)
                      ..+.++++++|+++  ++++++|+|+|+++||+.+.++...+||+|+
T Consensus       296 ~~~~l~li~~g~i~~~~lIt~~~~le~~~~Af~~a~~~~~~~KV~l~  342 (343)
T PRK09880        296 FNTAVSWLANGVINPLPLLSAEYPFTDLEEALIFAGDKTQAAKVQLV  342 (343)
T ss_pred             HHHHHHHHHCCCCCHHHEEEEEEEHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             99999999859998045588798799999999984287981799997


No 20 
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion]
Probab=100.00  E-value=0  Score=368.45  Aligned_cols=311  Identities=25%  Similarity=0.340  Sum_probs=276.2

Q ss_pred             CEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCC
Q ss_conf             20899991568853079998237877886289999999827878999868877876687300330002322222212222
Q gi|254780290|r    6 KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHW   85 (332)
Q Consensus         6 ~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~   85 (332)
                      ++||.|..+++.|  |+++|++++.|+++|||||+.++|+|++|.+.++|.+|..  +|.++|||++|+|++||++|+++
T Consensus         2 k~~aAV~~~~~~P--l~i~ei~l~~P~~gEVlVri~AtGVCHTD~~~~~G~~p~~--~P~vLGHEgAGiVe~VG~gVt~v   77 (366)
T COG1062           2 KTRAAVAREAGKP--LEIEEVDLDPPRAGEVLVRITATGVCHTDAHTLSGDDPEG--FPAVLGHEGAGIVEAVGEGVTSV   77 (366)
T ss_pred             CCEEEEEECCCCC--EEEEEEECCCCCCCEEEEEEEEEECCCCCHHHHCCCCCCC--CCEECCCCCCCEEEEECCCCCCC
T ss_conf             7147455247998--1899986589899838999988510213423224888888--86251345541799846986552


Q ss_pred             CCCCCCCCC------------------------------C------------------CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             223333221------------------------------1------------------2233333221111111222222
Q gi|254780290|r   86 NIGDEVCAL------------------------------V------------------NGGGYAEYCLSHQGHTLPIPKG  117 (332)
Q Consensus        86 ~~GdrV~~~------------------------------~------------------~~G~~ae~~~~~~~~~~~iP~~  117 (332)
                      ++||+|+..                              .                  .-++|+||.++++.+++|++++
T Consensus        78 kpGDhVI~~f~p~CG~C~~C~sGk~nlC~~~~~~~~kG~m~dGttrls~~~~~~~h~lG~stFa~y~vv~~~s~vki~~~  157 (366)
T COG1062          78 KPGDHVILLFTPECGQCKFCLSGKPNLCEAIRATQGKGTMPDGTTRLSGNGVPVYHYLGCSTFAEYTVVHEISLVKIDPD  157 (366)
T ss_pred             CCCCEEEEECCCCCCCCCHHHCCCCCCCCCHHHHCCCCCCCCCCEEEECCCCCEEEEECCCCHHHHEEECCCCEEECCCC
T ss_conf             88998997026777888134389963141024011465434883266549961031107652044402323415777999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             232221222222333222111222222222222113444443222221222222-2211122322111111223322222
Q gi|254780290|r  118 YNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAIN  196 (332)
Q Consensus       118 ~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~vi~  196 (332)
                      .+++.++.++|...|.+.+..+.+++++|+++.|+| +|++|++++|=|+..|+ ++|+++.+++|+++++++||++++|
T Consensus       158 ~p~~~a~llGCgV~TG~Gav~nta~v~~G~tvaV~G-lGgVGlaaI~gA~~agA~~IiAvD~~~~Kl~~A~~fGAT~~vn  236 (366)
T COG1062         158 APLEKACLLGCGVTTGIGAVVNTAKVEPGDTVAVFG-LGGVGLAAIQGAKAAGAGRIIAVDINPEKLELAKKFGATHFVN  236 (366)
T ss_pred             CCCCCEEEEEEEECCCHHHHHHCCCCCCCCEEEEEE-CCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEEEC
T ss_conf             983216887212315847764104689998489990-4276699999898748854999937778999998639824655


Q ss_pred             CCCC-CCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCC
Q ss_conf             2222-111122222222211122221111-11222221122345304798337875432224334305321677751240
Q gi|254780290|r  197 YLKE-DFLEILQKETQGRGIDIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR  274 (332)
Q Consensus       197 ~~~~-~~~~~i~~~t~g~g~Divid~~G~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~  274 (332)
                      .++. ++.+.+.++|++ |+|.+||++|. +++++++.++++.|+.+++|.........+++.++... .++.|++++.-
T Consensus       237 ~~~~~~vv~~i~~~T~g-G~d~~~e~~G~~~~~~~al~~~~~~G~~v~iGv~~~~~~i~~~~~~lv~g-r~~~Gs~~G~~  314 (366)
T COG1062         237 PKEVDDVVEAIVELTDG-GADYAFECVGNVEVMRQALEATHRGGTSVIIGVAGAGQEISTRPFQLVTG-RVWKGSAFGGA  314 (366)
T ss_pred             CCCHHHHHHHHHHHCCC-CCCEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCEECCCHHHEECC-CEEEEEEECCC
T ss_conf             40025489999986278-87789992599899999999874378189995279875420276880415-57988750576


Q ss_pred             HHCCHHHHHHHHHHHHHHHHHCCCCC--CCCEEEEEHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             00113789999999999999869831--0212474189999999999829981328983
Q gi|254780290|r  275 TDIAKQSIRDSLQLKIWPLLNSHVIA--PVIHTVLPLGKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       275 ~~~~~~~~~~~~~~~~~~~i~~g~l~--p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~  331 (332)
                      .-..       ...++.+++.+|+|.  ..++++|+|+|++|||++|.+|+.+ |-||.
T Consensus       315 ~p~~-------diP~lv~~y~~Gkl~~d~lvt~~~~Le~INeaf~~m~~G~~I-R~Vi~  365 (366)
T COG1062         315 RPRS-------DIPRLVDLYMAGKLPLDRLVTHTIPLEDINEAFDLMHEGKSI-RSVIR  365 (366)
T ss_pred             CCCC-------HHHHHHHHHHCCCCCHHHHHHCCCCHHHHHHHHHHHHCCCEE-EEEEC
T ss_conf             6601-------016799999849986677765567689999999876478245-67863


No 21 
>KOG1198 consensus
Probab=100.00  E-value=0  Score=351.58  Aligned_cols=323  Identities=35%  Similarity=0.553  Sum_probs=260.2

Q ss_pred             CCCEEEEE-ECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCC---CCCCEECCCCCCC---CC
Q ss_conf             76208999-91568853079998237877886289999999827878999868877876---6873003300023---22
Q gi|254780290|r    4 CKKMRHVA-MSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK---NANPILGLEVAGK---IV   76 (332)
Q Consensus         4 ~~~Mka~v-~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~---~~p~v~G~e~~G~---V~   76 (332)
                      ..+|+.+. .+..|+++....++.|+|+|.++++++++.++++||.|+++++|.+....   .+|-+++++++|+   +.
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~iP~~~~~~~~i~~~a~a~NpiD~~~~~g~~~~~~~~~~~p~ii~~~g~~~~~~~~   81 (347)
T KOG1198           2 VKKIRRVSLVSPPGGGEVLFSEEVPIPEPEDGEVLIKVVAVALNPIDLKIRNGYYSPIPLGREFPGIIGRDGSGVVGAVE   81 (347)
T ss_pred             CCCCCEEEEEECCCCCCEEEEECCCCCCCCCCCEEEEEEEEECCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEE
T ss_conf             63333278640589875688733657878888559999987518388999755767787766788400313577055775


Q ss_pred             CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------CCCCCCCC
Q ss_conf             222-21222222333322112233333221111111222222232221222222333222111222------22222222
Q gi|254780290|r   77 DLG-ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTA------NLRSGQTV  149 (332)
Q Consensus        77 ~vG-~~v~~~~~GdrV~~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~------~~~~g~~v  149 (332)
                      ..| ..+..+..||++......|+||||+++++..++++|+++++++||++|+++.|||.+|++..      ++++|++|
T Consensus        82 ~~g~~~~~~~~~g~~~~~~~~~g~~aey~v~p~~~~~~~P~~l~~~~aa~~p~~~~tA~~al~~~~~~~~~~~~~~g~~v  161 (347)
T KOG1198          82 SVGDDVVGGWVHGDAVVAFLSSGGLAEYVVVPEKLLVKIPESLSFEEAAALPLAALTALSALFQLAPGKRSKKLSKGKSV  161 (347)
T ss_pred             ECCCCCCCCEEECCEEECCCCCCCEEEEEECCHHHCCCCCCCCCHHHHHCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEE
T ss_conf             11666645437351774268898325578705020367988679656411761678999998750554432356899869


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             21134444432222212222222211122322111111223322222222211112222222221112222111111222
Q gi|254780290|r  150 LIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQ  229 (332)
Q Consensus       150 lV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~~~~~  229 (332)
                      ||+||+|+||++++|||++.|+..+.+++++++.++++++|||+++||+++++.+.++..+ +.+||+||||+|+.++..
T Consensus       162 Lv~ggsggVG~~aiQlAk~~~~~~v~t~~s~e~~~l~k~lGAd~vvdy~~~~~~e~~kk~~-~~~~DvVlD~vg~~~~~~  240 (347)
T KOG1198         162 LVLGGSGGVGTAAIQLAKHAGAIKVVTACSKEKLELVKKLGADEVVDYKDENVVELIKKYT-GKGVDVVLDCVGGSTLTK  240 (347)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHC-CCCCEEEEECCCCCCCHH
T ss_conf             9993874899999999987497479998155416899972996512488577999987622-788509998888973243


Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCHHH--CCC-----CEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             2211223453047983378754322243343--053-----216777512400011378999999999999986983102
Q gi|254780290|r  230 HLTLLSKEGKLIIISFLGGNIATEINLNPII--SKR-----ITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV  302 (332)
Q Consensus       230 ~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~--~~~-----~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~  302 (332)
                      +..++..+|+...++..++.. .+.+....+  .+.     ..+.+...........    ......+.+++++|+|+|.
T Consensus       241 ~~~~l~~~g~~~~i~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~l~~l~~~ie~gkikp~  315 (347)
T KOG1198         241 SLSCLLKGGGGAYIGLVGDEL-ANYKLDDLWQSANGIKLYSLGLKGVNYRWLYFVPS----AEYLKALVELIEKGKIKPV  315 (347)
T ss_pred             HHHHHCCCCCCEEEEECCCCC-CCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCC----HHHHHHHHHHHHCCCCCCC
T ss_conf             234332378726999437765-55444210345544434220001355035775488----8999999999971866388


Q ss_pred             CEEEEEHHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             124741899999999998299813289839
Q gi|254780290|r  303 IHTVLPLGKVAMAHDIMEKSEHIGKIILLP  332 (332)
Q Consensus       303 i~~~~~l~~i~~A~~~l~~g~~~GKvVi~P  332 (332)
                      +++.|+++++.+||+.+++++++||+++.+
T Consensus       316 i~~~~p~~~~~ea~~~~~~~~~~GK~vl~~  345 (347)
T KOG1198         316 IDSVYPFSQAKEAFEKLEKSHATGKVVLEK  345 (347)
T ss_pred             CCCCEEHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             743015468899999887557864189985


No 22 
>KOG0024 consensus
Probab=100.00  E-value=0  Score=352.72  Aligned_cols=312  Identities=20%  Similarity=0.293  Sum_probs=263.5

Q ss_pred             CCCCEEEEEECCCCCCCEEEEEEECCCCC-CCCEEEEEEEEEEECHHHHHHHCCCC-C-CCCCCCCEECCCCCCCCCCCC
Q ss_conf             77620899991568853079998237877-88628999999982787899986887-7-876687300330002322222
Q gi|254780290|r    3 ICKKMRHVAMSGYGKSNVMFLAESPIPQP-QKEEILIKVEAIGVNRPDVMQRKGLY-P-PPKNANPILGLEVAGKIVDLG   79 (332)
Q Consensus         3 ~~~~Mka~v~~~~g~~~~l~~~~~~~P~~-~~~~vlV~v~~~~in~~D~~~~~G~~-~-~~~~~p~v~G~e~~G~V~~vG   79 (332)
                      |..+|+|+|+.+.|+   +++++.|.|++ .|+||+|+++++|||.||+|.+.+.. . .....|+++|||.+|+|.++|
T Consensus         1 ~~~~~~A~vl~g~~d---i~i~~~p~p~i~~p~eVlv~i~a~GICGSDvHy~~~G~ig~~v~k~PmvlGHEssGiV~evG   77 (354)
T KOG0024           1 MAADNLALVLRGKGD---IRIEQRPIPTITDPDEVLVAIKAVGICGSDVHYYTHGRIGDFVVKKPMVLGHESSGIVEEVG   77 (354)
T ss_pred             CCCCCCEEEEECCCC---EEEEECCCCCCCCCCEEEEEEEEEEECCCCCHHHCCCCCCCCCCCCCCCCCCCCCCEEHHHC
T ss_conf             986660148974586---56720799998998779999667786276203023697675213455121542443405535


Q ss_pred             CCCCCCCCCCCCCC------------------------C----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             21222222333322------------------------1----1223333322111111122222223222122222233
Q gi|254780290|r   80 ENTTHWNIGDEVCA------------------------L----VNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFF  131 (332)
Q Consensus        80 ~~v~~~~~GdrV~~------------------------~----~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~  131 (332)
                      ++|+++|+||||+-                        +    .-+|++++|++.++++++|+|+++|+|++| |..+..
T Consensus        78 ~~Vk~LkVGDrVaiEpg~~c~~cd~CK~GrYNlCp~m~f~atpp~~G~la~y~~~~~dfc~KLPd~vs~eeGA-l~ePLs  156 (354)
T KOG0024          78 DEVKHLKVGDRVAIEPGLPCRDCDFCKEGRYNLCPHMVFCATPPVDGTLAEYYVHPADFCYKLPDNVSFEEGA-LIEPLS  156 (354)
T ss_pred             CCCCCCCCCCEEEECCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCEEEEEEECHHHEEECCCCCCHHHCC-CCCCHH
T ss_conf             6643034688478648986333356657551359752002479968853799982268526588987632130-146202


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC
Q ss_conf             3222111222222222222113444443222221222222-2211122322111111223322222222----2111122
Q gi|254780290|r  132 TVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLK----EDFLEIL  206 (332)
Q Consensus       132 tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~vi~~~~----~~~~~~i  206 (332)
                      ++++|. +++++++|+++||+| +|++|+.+...||++|+ +|+.++-.++|++++|++||+.+.+...    +++.+.+
T Consensus       157 V~~HAc-r~~~vk~Gs~vLV~G-AGPIGl~t~l~Aka~GA~~VVi~d~~~~Rle~Ak~~Ga~~~~~~~~~~~~~~~~~~v  234 (354)
T KOG0024         157 VGVHAC-RRAGVKKGSKVLVLG-AGPIGLLTGLVAKAMGASDVVITDLVANRLELAKKFGATVTDPSSHKSSPQELAELV  234 (354)
T ss_pred             HHHHHH-HHCCCCCCCEEEEEC-CCHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHCCEEEECCCCCCCHHHHHHHH
T ss_conf             212033-324766688689976-768999999999874987289960677799999982975773044556589999999


Q ss_pred             CCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHH
Q ss_conf             222222211122221111-1122222112234530479833787543222433430532167775124000113789999
Q gi|254780290|r  207 QKETQGRGIDIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDS  285 (332)
Q Consensus       207 ~~~t~g~g~Divid~~G~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~  285 (332)
                      ....+...+|+.|||+|. .+++.++.+++.+|+++..|.-+  ...++++.+...+++.+.|++-+...++        
T Consensus       235 ~~~~g~~~~d~~~dCsG~~~~~~aai~a~r~gGt~vlvg~g~--~~~~fpi~~v~~kE~~~~g~fry~~~~y--------  304 (354)
T KOG0024         235 EKALGKKQPDVTFDCSGAEVTIRAAIKATRSGGTVVLVGMGA--EEIQFPIIDVALKEVDLRGSFRYCNGDY--------  304 (354)
T ss_pred             HHHCCCCCCCEEEECCCCHHHHHHHHHHHCCCCEEEEECCCC--CCCCCCHHHHHHHEEEEEEEEEECCCCH--------
T ss_conf             864166679868986660466898998751287899965478--7653573352233356464222133648--------


Q ss_pred             HHHHHHHHHHCCCC--CCCCEEEEEHHHHHHHHHHHHCCCCCC-EEEEEC
Q ss_conf             99999999986983--102124741899999999998299813-289839
Q gi|254780290|r  286 LQLKIWPLLNSHVI--APVIHTVLPLGKVAMAHDIMEKSEHIG-KIILLP  332 (332)
Q Consensus       286 ~~~~~~~~i~~g~l--~p~i~~~~~l~~i~~A~~~l~~g~~~G-KvVi~P  332 (332)
                        ....+++.+|++  +|++++.|+|+++.+||+.++.++..+ |++|.|
T Consensus       305 --~~ai~li~sGki~~k~lIT~r~~~~~~~eAf~~~~~~~~~~iKv~i~~  352 (354)
T KOG0024         305 --PTAIELVSSGKIDVKPLITHRYKFDDADEAFETLQHGEEGVIKVIITG  352 (354)
T ss_pred             --HHHHHHHHCCCCCCHHHEECCCCCCCHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             --999999975896711330012464207999999973768743999738


No 23 
>KOG0025 consensus
Probab=100.00  E-value=0  Score=337.60  Aligned_cols=328  Identities=21%  Similarity=0.283  Sum_probs=282.3

Q ss_pred             CCCCCCEEEEEECCCCCC-CEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCC
Q ss_conf             987762089999156885-3079998237877886289999999827878999868877876687300330002322222
Q gi|254780290|r    1 MPICKKMRHVAMSGYGKS-NVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLG   79 (332)
Q Consensus         1 m~~~~~Mka~v~~~~g~~-~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG   79 (332)
                      |-||..-||++|+++|+| +++++++.++|+...+||+||+.|++|||+|+..++|.||..+++|.|-|.|++|+|+++|
T Consensus        14 ~q~~~~~kalvY~~hgdP~kVlql~~~~~p~~~~s~v~Vk~LAaPINPsDIN~IQGvYpvrP~~PAVgGnEGv~eVv~vG   93 (354)
T KOG0025          14 SQMPARSKALVYSEHGDPAKVLQLKNLELPAVPGSDVLVKMLAAPINPSDINQIQGVYPVRPELPAVGGNEGVGEVVAVG   93 (354)
T ss_pred             CCCCCCCCEEEECCCCCCHHHHEEECCCCCCCCCCCEEEEEEECCCCHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEEC
T ss_conf             03562010123212598156405421257889877626655306788677533336557789877424776548999836


Q ss_pred             CCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2122222233332211-223333322111111122222223222122222233322211122222222222211344444
Q gi|254780290|r   80 ENTTHWNIGDEVCALV-NGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGI  158 (332)
Q Consensus        80 ~~v~~~~~GdrV~~~~-~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~v  158 (332)
                      +++++|++||+|.-.. ..|+|.+|.+.+++.++++++.+++++||++..+..|||..|.+.-++++|++|.-+||.++|
T Consensus        94 s~vkgfk~Gd~VIp~~a~lGtW~t~~v~~e~~Li~vd~~~pl~~AAT~~VNP~TAyrmL~dfv~L~~GD~vIQNganS~V  173 (354)
T KOG0025          94 SNVKGFKPGDWVIPLSANLGTWRTEAVFSESDLIKVDKDIPLASAATLSVNPCTAYRMLKDFVQLNKGDSVIQNGANSGV  173 (354)
T ss_pred             CCCCCCCCCCEEEECCCCCCCCEEEEEECCCCEEECCCCCCHHHHHEECCCCHHHHHHHHHHHHCCCCCEEEECCCCCHH
T ss_conf             87676687775755588886324667604120477578678546430143752899999999833799824446752288


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             322222122222222111223221111----11223322222222211112222--222221112222111111222221
Q gi|254780290|r  159 GTTAIQLASYFGATVYTTAKSEEKCLA----CLKLGAKHAINYLKEDFLEILQK--ETQGRGIDIILDMVGAEYLNQHLT  232 (332)
Q Consensus       159 G~~a~qla~~~G~~vi~~~~~~~~~~~----~~~lGa~~vi~~~~~~~~~~i~~--~t~g~g~Divid~~G~~~~~~~~~  232 (332)
                      |++.+|+||++|++.+.++|+....+.    |+++|||+||.-  +.+.+.-+.  ......+.+.|||+|+.......+
T Consensus       174 G~~ViQlaka~GiktinvVRdR~~ieel~~~Lk~lGA~~ViTe--eel~~~~~~k~~~~~~~prLalNcVGGksa~~iar  251 (354)
T KOG0025         174 GQAVIQLAKALGIKTINVVRDRPNIEELKKQLKSLGATEVITE--EELRDRKMKKFKGDNPRPRLALNCVGGKSATEIAR  251 (354)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHCCCCEEECH--HHHCCHHHHHHHCCCCCCEEEEECCCCHHHHHHHH
T ss_conf             8999999998396447775158469999999997488668248--88555466665134877317875457566999999


Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCH-HHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHH
Q ss_conf             12234530479833787543222433430532167775124000113-78999999999999986983102124741899
Q gi|254780290|r  233 LLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAK-QSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGK  311 (332)
Q Consensus       233 ~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~-~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~  311 (332)
                      .|..||++++||..+- .+..++...+++|++.+.|+|+..|..... ++.+..+..++.+++..|+|+..-....+|++
T Consensus       252 ~L~~GgtmvTYGGMSk-qPv~~~ts~lIFKdl~~rGfWvt~W~~~~~~pe~~~~~i~~~~~l~~~G~i~~~~~e~v~L~~  330 (354)
T KOG0025         252 YLERGGTMVTYGGMSK-QPVTVPTSLLIFKDLKLRGFWVTRWKKEHKSPEERKEMIDELCDLYRRGKLKAPNCEKVPLAD  330 (354)
T ss_pred             HHHCCCEEEEECCCCC-CCCCCCCCHHEECCCEEEEEEEEEHHHCCCCCHHHHHHHHHHHHHHHCCEECCCCCEEEECHH
T ss_conf             9855966997567557-875044410102363133653010444147808999999999999974904246534543001


Q ss_pred             HHHHHHHHHCCCC-CCEEEEE
Q ss_conf             9999999982998-1328983
Q gi|254780290|r  312 VAMAHDIMEKSEH-IGKIILL  331 (332)
Q Consensus       312 i~~A~~~l~~g~~-~GKvVi~  331 (332)
                      .+.|++...+... .||-+++
T Consensus       331 ~~tald~~L~~~~~~~Kq~i~  351 (354)
T KOG0025         331 HKTALDAALSKFGKSGKQIIV  351 (354)
T ss_pred             HHHHHHHHHHHHCCCCCEEEE
T ss_conf             158999998874467735998


No 24 
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]
Probab=100.00  E-value=0  Score=328.11  Aligned_cols=309  Identities=30%  Similarity=0.460  Sum_probs=249.4

Q ss_pred             EEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCC-EECCCCCCCCCCCCCCCCCC
Q ss_conf             08999915688530799982378778862899999998278789998688778766873-00330002322222212222
Q gi|254780290|r    7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP-ILGLEVAGKIVDLGENTTHW   85 (332)
Q Consensus         7 Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~-v~G~e~~G~V~~vG~~v~~~   85 (332)
                      ||++++...++  ..++++.+.|.++++||+||+.+++||.+|+|.+.|..+... .+. ++|||++|+|+++| .++.|
T Consensus         1 m~a~~~~~~~~--~~~~~~~~~p~~~p~~vlVkv~~~gICGSDlh~~~g~~~~~~-~~~~i~GHE~~G~V~evG-~~~~~   76 (350)
T COG1063           1 MKAAVVYVGGG--DVRLEEPPPPIPGPGDVLIRVTATGICGSDLHIYRGGEPFVP-PGDIILGHEFVGEVVEVG-VVRGF   76 (350)
T ss_pred             CCEEEEECCCC--CEEEEECCCCCCCCCEEEEEEEEEEECCCCHHHHCCCCCCCC-CCCCCCCCEEEEEEEEEC-CCCCC
T ss_conf             96799954898--147520688889998399999998786324797658997656-888766641148999988-71575


Q ss_pred             CCCCCCCCC------------------C--------------CCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCC
Q ss_conf             223333221------------------1--------------223333322111111122-2222232221222222333
Q gi|254780290|r   86 NIGDEVCAL------------------V--------------NGGGYAEYCLSHQGHTLP-IPKGYNAIQAASLPESFFT  132 (332)
Q Consensus        86 ~~GdrV~~~------------------~--------------~~G~~ae~~~~~~~~~~~-iP~~~s~~~aa~l~~~~~t  132 (332)
                      ++||||+..                  +              .+|+||||+.++.+++++ +|+++ ..+++++..+..|
T Consensus        77 ~~GdrVvv~~~~~Cg~C~~C~~G~~~~C~~~~~~g~~~~~~~~~G~~aEyv~vp~~~~~~~~pd~~-~~~~aal~epla~  155 (350)
T COG1063          77 KVGDRVVVEPNIPCGHCRYCRAGEYNLCENPGFYGYAGLGGGIDGGFAEYVRVPADFNLAKLPDGI-DEEAAALTEPLAT  155 (350)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECHHHCEEECCCCC-CHHHECCCCCHHH
T ss_conf             489999977765899880103898120467543352233377787246899976687856089999-7553201580998


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222111222222222222113444443222221222222-22111223221111112-2332222222221111222222
Q gi|254780290|r  133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLK-LGAKHAINYLKEDFLEILQKET  210 (332)
Q Consensus       133 A~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~-lGa~~vi~~~~~~~~~~i~~~t  210 (332)
                      ++++.......+++.+|+|+| +|++|++++++|+..|+ +|++++.+++|++++++ .|++.+++...++..+.+++.+
T Consensus       156 ~~~~~a~~~~~~~~~~V~V~G-aGpIGLla~~~a~~~Ga~~Viv~d~~~~Rl~~A~~~~g~~~~~~~~~~~~~~~~~~~t  234 (350)
T COG1063         156 AYHGHAERAAVRPGGTVVVVG-AGPIGLLAIALAKLLGASVVIVVDRSPERLELAKEAGGADVVVNPSEDDAGAEILELT  234 (350)
T ss_pred             HHHHHHHHCCCCCCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCEEECCCCHHHHHHHHHHC
T ss_conf             999998424578899899988-8899999999998769827999799989999999877971872463014788999860


Q ss_pred             CCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEE-CCCHHCCHHHHHHHHHH
Q ss_conf             22211122221111-11222221122345304798337875432224334305321677751-24000113789999999
Q gi|254780290|r  211 QGRGIDIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTL-RRRTDIAKQSIRDSLQL  288 (332)
Q Consensus       211 ~g~g~Divid~~G~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~-~~~~~~~~~~~~~~~~~  288 (332)
                      .|.|+|++|||+|. ..+++++++++++|+++.+|....... .++...++.+++++.|+.. ....++          .
T Consensus       235 ~g~g~D~vie~~G~~~~~~~ai~~~r~gG~v~~vGv~~~~~~-~~~~~~~~~kel~l~g~~~~~~~~~~----------~  303 (350)
T COG1063         235 GGRGADVVIEAVGSPPALDQALEALRPGGTVVVVGVYGGEDI-PLPAGLVVSKELTLRGSLRPSGREDF----------E  303 (350)
T ss_pred             CCCCCCEEEECCCCHHHHHHHHHHCCCCCEEEEEECCCCCCC-CCCHHHHHHCCEEEECCCCCCCCCCH----------H
T ss_conf             898799999998997999999996025989999951588666-56888997535089734566564019----------9


Q ss_pred             HHHHHHHCCCCCC--CCEEEEEHHHHHHHHHHHHCCCC-CCEEEEEC
Q ss_conf             9999998698310--21247418999999999982998-13289839
Q gi|254780290|r  289 KIWPLLNSHVIAP--VIHTVLPLGKVAMAHDIMEKSEH-IGKIILLP  332 (332)
Q Consensus       289 ~~~~~i~~g~l~p--~i~~~~~l~~i~~A~~~l~~g~~-~GKvVi~P  332 (332)
                      ...+++++|++.+  .+++.++++|+++||+.+.+++. .-|++++|
T Consensus       304 ~~~~ll~~g~i~~~~lit~~~~l~~~~~a~~~~~~~~~~~iKv~i~~  350 (350)
T COG1063         304 RALDLLASGKIDPEKLITHRLPLDDAAEAYELFADRKEEAIKVVLKP  350 (350)
T ss_pred             HHHHHHHCCCCCHHHHCCEECCHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             99999985998807730243478889999999860677744999839


No 25 
>KOG0022 consensus
Probab=100.00  E-value=0  Score=323.04  Aligned_cols=313  Identities=22%  Similarity=0.289  Sum_probs=267.8

Q ss_pred             CCEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCC
Q ss_conf             62089999156885307999823787788628999999982787899986887787668730033000232222221222
Q gi|254780290|r    5 KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTH   84 (332)
Q Consensus         5 ~~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~   84 (332)
                      -++||.|..++|.|  |.+||+.++.|+..||+||+.++++|++|.+.++|.. ...-+|.|+|||++|+|+.+|++|++
T Consensus         6 I~CKAAV~w~a~~P--L~IEei~V~pPka~EVRIKI~~t~vCHTD~~~~~g~~-~~~~fP~IlGHEaaGIVESvGegV~~   82 (375)
T KOG0022           6 ITCKAAVAWEAGKP--LVIEEIEVAPPKAHEVRIKILATGVCHTDAYVWSGKD-PEGLFPVILGHEAAGIVESVGEGVTT   82 (375)
T ss_pred             EEEEEEEECCCCCC--EEEEEEEECCCCCCEEEEEEEEEEECCCCCEEECCCC-CCCCCCEEECCCCEEEEEEECCCCCC
T ss_conf             68867024268997--3688887379887469999999970356531653777-66567657624440478872577452


Q ss_pred             CCCCCCCCCCC-------------------------------------------------CCCCCCCCCCCCCCCCCCCC
Q ss_conf             22233332211-------------------------------------------------22333332211111112222
Q gi|254780290|r   85 WNIGDEVCALV-------------------------------------------------NGGGYAEYCLSHQGHTLPIP  115 (332)
Q Consensus        85 ~~~GdrV~~~~-------------------------------------------------~~G~~ae~~~~~~~~~~~iP  115 (332)
                      |++||+|....                                                 .-.+|+||.+++...++||+
T Consensus        83 vk~GD~Viplf~p~CgeCk~C~s~ktNlC~~~~~~~~~~~~~~DgtsRF~~~gk~iyHfmg~StFsEYTVv~~~~v~kId  162 (375)
T KOG0022          83 VKPGDHVIPLFTPQCGECKFCKSPKTNLCEKFRADNGKGGMPYDGTSRFTCKGKPIYHFMGTSTFSEYTVVDDISVAKID  162 (375)
T ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCEEEEECCCCEEEECCCCCCEEEEEEECCEEEECC
T ss_conf             58999986522567777612269987725653034556611258840156689725884376652116996011167669


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22232221222222333222111222222222222113444443222221222222-22111223221111112233222
Q gi|254780290|r  116 KGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHA  194 (332)
Q Consensus       116 ~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~v  194 (332)
                      +...++.++.|.|...|.|.|..+.++++||+++.|+| .|+||++++|-||+.|+ ++|+++-|++|.+.++++||++.
T Consensus       163 ~~aPl~kvcLLgCGvsTG~GAa~~~Akv~~GstvAVfG-LG~VGLav~~Gaka~GAsrIIgvDiN~~Kf~~ak~fGaTe~  241 (375)
T KOG0022         163 PSAPLEKVCLLGCGVSTGYGAAWNTAKVEPGSTVAVFG-LGGVGLAVAMGAKAAGASRIIGVDINPDKFEKAKEFGATEF  241 (375)
T ss_pred             CCCCHHHEEEEECCCCCCCHHHHHHCCCCCCCEEEEEE-CCHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHCCCCEE
T ss_conf             88982152686045345613443213467798799990-54578899876776186517998558789899876195022


Q ss_pred             CCCCC--CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCC-CCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEE
Q ss_conf             22222--2111122222222211122221111-1122222112234-530479833787543222433430532167775
Q gi|254780290|r  195 INYLK--EDFLEILQKETQGRGIDIILDMVGA-EYLNQHLTLLSKE-GKLIIISFLGGNIATEINLNPIISKRITITGST  270 (332)
Q Consensus       195 i~~~~--~~~~~~i~~~t~g~g~Divid~~G~-~~~~~~~~~l~~~-G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~  270 (332)
                      +|..|  ..+.+.+.++|+ .|+|+.|||+|. +++.+++.+.+.+ |+-+.+|.........++++.++. +.++.|+.
T Consensus       242 iNp~d~~~~i~evi~EmTd-gGvDysfEc~G~~~~m~~al~s~h~GwG~sv~iGv~~a~~~i~~~p~~l~~-GR~~~Gs~  319 (375)
T KOG0022         242 INPKDLKKPIQEVIIEMTD-GGVDYSFECIGNVSTMRAALESCHKGWGKSVVIGVAAAGQEISTRPFQLVT-GRTWKGSA  319 (375)
T ss_pred             CCHHHCCCCHHHHHHHHHC-CCCEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHCC-CCEEEEEE
T ss_conf             3703305339999999866-872089995589899999999730587759999754788622116666222-43798873


Q ss_pred             ECCCHHCCHHHHHHHHHHHHHHHHHCCCC--CCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             12400011378999999999999986983--10212474189999999999829981328983
Q gi|254780290|r  271 LRRRTDIAKQSIRDSLQLKIWPLLNSHVI--APVIHTVLPLGKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       271 ~~~~~~~~~~~~~~~~~~~~~~~i~~g~l--~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~  331 (332)
                      ++.+.....  +     ..+.+...+++|  ...|+++++|+++++||++|.+|+.. |.||.
T Consensus       320 FGG~K~~~~--i-----P~lV~~y~~~~l~ld~~ITh~l~f~~In~AF~ll~~Gk~i-R~vl~  374 (375)
T KOG0022         320 FGGFKSKSD--I-----PKLVKDYMKKKLNLDEFITHELPFEEINKAFDLLHEGKSI-RCVLW  374 (375)
T ss_pred             CCCCCCHHH--H-----HHHHHHHHHCCCCHHHHHHCCCCHHHHHHHHHHHHCCCEE-EEEEE
T ss_conf             256461444--5-----6999999737555325533466789989999998579667-99982


No 26 
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only]
Probab=100.00  E-value=1.4e-45  Score=319.50  Aligned_cols=320  Identities=21%  Similarity=0.296  Sum_probs=259.5

Q ss_pred             CCCCCE-EEEEECC--CCCC--CEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCC
Q ss_conf             877620-8999915--6885--3079998237877886289999999827878999868877876687300330002322
Q gi|254780290|r    2 PICKKM-RHVAMSG--YGKS--NVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIV   76 (332)
Q Consensus         2 ~~~~~M-ka~v~~~--~g~~--~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~   76 (332)
                      .|.... |.+++..  .|-|  +.++++|.++|+|++||||+|+.+.+++| ++..+....++ .-.|.-+|-..+|-++
T Consensus         3 ~m~~~~~~~~~la~rP~g~p~~d~F~lee~~vp~p~~GqvLl~~~ylS~DP-ymRgrm~d~~S-Y~~P~~lG~~~~gg~V   80 (340)
T COG2130           3 CMQTQVNRRIVLASRPEGAPVPDDFRLEEVDVPEPGEGQVLLRTLYLSLDP-YMRGRMSDAPS-YAPPVELGEVMVGGTV   80 (340)
T ss_pred             CHHHHHHHEEEECCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEECCCH-HHEECCCCCCC-CCCCCCCCCEEECCEE
T ss_conf             132213340650468778997887303742689988671699988740487-78102357832-3897479964677736


Q ss_pred             CCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222--2122222233332211223333322111111122222223222--122222233322211122222222222211
Q gi|254780290|r   77 DLG--ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ--AASLPESFFTVWANLFQTANLRSGQTVLIH  152 (332)
Q Consensus        77 ~vG--~~v~~~~~GdrV~~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~--aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~  152 (332)
                      ...  ++...|++||-|.+..   +|++|.+.+++.+.|++.+.-...  ...|+++++|||.+|.+.+++++|++++|.
T Consensus        81 ~~Vv~S~~~~f~~GD~V~~~~---GWq~y~i~~~~~l~Kvd~~~~pl~~~LgvLGmpG~TAY~gLl~igqpk~GetvvVS  157 (340)
T COG2130          81 AKVVASNHPGFQPGDIVVGVS---GWQEYAISDGEGLRKLDPSPAPLSAYLGVLGMPGLTAYFGLLDIGQPKAGETVVVS  157 (340)
T ss_pred             EEEEECCCCCCCCCCEEEECC---CCEEEEEECHHHCEECCCCCCCCCHHHHHCCCCHHHHHHHHHHHCCCCCCCEEEEE
T ss_conf             999834798888888898504---52688730664425668878883268763478318889999872689999889997


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             344444322222122222222111223221111112-2332222222221111222222222111222211111122222
Q gi|254780290|r  153 GGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK-LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHL  231 (332)
Q Consensus       153 ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~-lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~~~~~~~  231 (332)
                      +|+|+||+.+.||||.+||||++++++++|++++++ +|.|.+|||+++|+.+.+.+.+. +|+|+.||++|++.++..+
T Consensus       158 aAaGaVGsvvgQiAKlkG~rVVGiaGg~eK~~~l~~~lGfD~~idyk~~d~~~~L~~a~P-~GIDvyfeNVGg~v~DAv~  236 (340)
T COG2130         158 AAAGAVGSVVGQIAKLKGCRVVGIAGGAEKCDFLTEELGFDAGIDYKAEDFAQALKEACP-KGIDVYFENVGGEVLDAVL  236 (340)
T ss_pred             ECCCCCCHHHHHHHHHHCCEEEEECCCHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHCC-CCEEEEEECCCCHHHHHHH
T ss_conf             346653068899988607759996588899899987038713554476569999998789-8717999748965899999


Q ss_pred             CCCCCCCCCEEEEECCCCCCCCCC-----CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             112234530479833787543222-----433430532167775124000113789999999999999869831021247
Q gi|254780290|r  232 TLLSKEGKLIIISFLGGNIATEIN-----LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV  306 (332)
Q Consensus       232 ~~l~~~G~iv~~G~~~~~~~~~~~-----~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~  306 (332)
                      ..|+..+|++.||..+.+..+..+     ...++.+.+++.|+.....++...++    ...++..++++|+|+...+.+
T Consensus       237 ~~ln~~aRi~~CG~IS~YN~~~~~~gp~~l~~l~~kr~~v~Gfiv~~~~~~~~~e----~~~~l~~wv~~GKi~~~eti~  312 (340)
T COG2130         237 PLLNLFARIPVCGAISQYNAPELPPGPRRLPLLMAKRLRVQGFIVASDYDQRFPE----ALRELGGWVKEGKIQYRETIV  312 (340)
T ss_pred             HHHCCCCCEEEEEEHHHCCCCCCCCCCCHHHHHHHHHHEEEEEEECHHHHHHHHH----HHHHHHHHHHCCCEEEEEEEH
T ss_conf             8623045224610025338988998740166887643246789964135564699----999999998748636675602


Q ss_pred             EEHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             4189999999999829981328983
Q gi|254780290|r  307 LPLGKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       307 ~~l~~i~~A~~~l~~g~~~GKvVi~  331 (332)
                      -+||++++||..|-+|++.||+|||
T Consensus       313 dGlEnaP~Af~gLl~G~N~GK~vvK  337 (340)
T COG2130         313 DGLENAPEAFIGLLSGKNFGKLVVK  337 (340)
T ss_pred             HHHHCCHHHHHHHHCCCCCCEEEEE
T ss_conf             3343127999998547766627898


No 27 
>KOG1202 consensus
Probab=100.00  E-value=5.7e-44  Score=309.94  Aligned_cols=304  Identities=25%  Similarity=0.374  Sum_probs=265.1

Q ss_pred             CCCCEEEEEEECCC--C-CCCCEEEEEEEEEEECHHHHHHHCCCCCCCC------CCCCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             88530799982378--7-7886289999999827878999868877876------6873003300023222222122222
Q gi|254780290|r   16 GKSNVMFLAESPIP--Q-PQKEEILIKVEAIGVNRPDVMQRKGLYPPPK------NANPILGLEVAGKIVDLGENTTHWN   86 (332)
Q Consensus        16 g~~~~l~~~~~~~P--~-~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~------~~p~v~G~e~~G~V~~vG~~v~~~~   86 (332)
                      |+...|+|.|.|..  . ..++.=+.-|-|++||++|++...|+.+...      +-..++|.||+|+          .+
T Consensus      1424 GDlsSlrWies~~~~a~~~~~~~e~CtVYYAplNFRDiMLasGkL~~DAiPG~~a~qdclLGmEFsGR----------d~ 1493 (2376)
T KOG1202        1424 GDLSSLRWIESPLRHAQPTCPGLELCTVYYAPLNFRDIMLASGKLSPDAIPGDLASQDCLLGMEFSGR----------DA 1493 (2376)
T ss_pred             CCCCCEEEEECCHHHCCCCCCCCCEEEEEECCCCHHHHHHHCCCCCCCCCCCCCCHHHHEECEEECCC----------CC
T ss_conf             65110044405121037778887325789714447888776078784558874200100003033165----------67


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23333221122333332211111112222222322212222223332221112222222222221134444432222212
Q gi|254780290|r   87 IGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLA  166 (332)
Q Consensus        87 ~GdrV~~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla  166 (332)
                      -|.||+++.+--++|+.+.++.+++|.+|.+|.++||++.|+.|.||||+|+.+++.++|+++||++|+||||++|+.+|
T Consensus      1494 ~GrRvM~mvpAksLATt~l~~rd~lWevP~~WTleeAstVP~VYsTaYYALVvRG~mkkGekiLIHaGsGGVGQAAIaiA 1573 (2376)
T KOG1202        1494 SGRRVMGMVPAKSLATTVLASRDFLWEVPSKWTLEEASTVPVVYSTAYYALVVRGQMKKGEKILIHAGSGGVGQAAIAIA 1573 (2376)
T ss_pred             CCCEEEEEEEHHHHHHHHHCCHHHHHHCCCCCCHHHCCCCCEEEEEEHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHH
T ss_conf             78588774003554554200630352088534264446575576310223332024467867999527873308999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             2222222111223221111112----233222222222111122222222211122221111112222211223453047
Q gi|254780290|r  167 SYFGATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII  242 (332)
Q Consensus       167 ~~~G~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~~~~~~~~~l~~~G~iv~  242 (332)
                      .+.||+|+.|++|.+|+++++.    +-.++.-|+++.+|...++..|+|+|+|+|+++...+-+..+++||+.+||+..
T Consensus      1574 La~G~~VFTTVGSaEKRefL~~rFPqLqe~~~~NSRdtsFEq~vl~~T~GrGVdlVLNSLaeEkLQASiRCLa~~GRFLE 1653 (2376)
T KOG1202        1574 LAHGCTVFTTVGSAEKREFLLKRFPQLQETNFANSRDTSFEQHVLWHTKGRGVDLVLNSLAEEKLQASIRCLALHGRFLE 1653 (2376)
T ss_pred             HHCCCEEEEECCCHHHHHHHHHHCHHHHHHCCCCCCCCCHHHHHHHHHCCCCEEEEHHHHHHHHHHHHHHHHHHCCEEEE
T ss_conf             97487799841738889999985613332224665565599999987069872320555569998887899974675556


Q ss_pred             EEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC
Q ss_conf             98337875432224334305321677751240001137899999999999998698310212474189999999999829
Q gi|254780290|r  243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS  322 (332)
Q Consensus       243 ~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g  322 (332)
                      +|..+-..+.++.+ ..+.+|.+++|..+.+..+.. .+.+.+...-+.+-+.+|.++|+.+++|+-.++++||+.|.+|
T Consensus      1654 IGKfDLSqNspLGM-avfLkNvsfHGiLLDsvmege-~e~~~ev~~Lv~eGIksGvV~PL~ttvF~~~qvE~AFRfMasG 1731 (2376)
T KOG1202        1654 IGKFDLSQNSPLGM-AVFLKNVSFHGILLDSVMEGE-EEMWREVAALVAEGIKSGVVRPLPTTVFHGQQVEDAFRFMASG 1731 (2376)
T ss_pred             ECCEECCCCCCCHH-HHHHCCCCEEEEEHHHHHCCC-HHHHHHHHHHHHHHHCCCCEECCCCCCCCHHHHHHHHHHHHCC
T ss_conf             40041356885216-664225613124445561674-8999999999986521585231455434577799999988645


Q ss_pred             CCCCEEEEE
Q ss_conf             981328983
Q gi|254780290|r  323 EHIGKIILL  331 (332)
Q Consensus       323 ~~~GKvVi~  331 (332)
                      +++|||||+
T Consensus      1732 KHIGKVvik 1740 (2376)
T KOG1202        1732 KHIGKVVIK 1740 (2376)
T ss_pred             CCCCEEEEE
T ss_conf             733359999


No 28 
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase. This clade of zinc-binding alcohol dehydrogenases (members of pfam00107) are repeatedly associated with genes proposed to be involved with the catabolism of phosphonate compounds.
Probab=100.00  E-value=3.9e-39  Score=277.99  Aligned_cols=233  Identities=25%  Similarity=0.332  Sum_probs=196.7

Q ss_pred             EECCCCCCCCCCCCCCCC------CCCCCCCCCCC------------------C----------------CCCCCCCCCC
Q ss_conf             003300023222222122------22223333221------------------1----------------2233333221
Q gi|254780290|r   66 ILGLEVAGKIVDLGENTT------HWNIGDEVCAL------------------V----------------NGGGYAEYCL  105 (332)
Q Consensus        66 v~G~e~~G~V~~vG~~v~------~~~~GdrV~~~------------------~----------------~~G~~ae~~~  105 (332)
                      |+|||++|+|+++|++|+      +|++||||...                  +                .+|+||||+.
T Consensus         1 IlGHE~~G~V~~vG~~V~~~~~g~~~~vGdrV~~~~~~~Cg~C~~C~~G~~~~C~~~~~~G~~~~~~~~~~~Gg~aey~~   80 (280)
T TIGR03366         1 VLGHEIVGEVVALRGGFTPADDGVPLRLGQRVVWSVTVPCGRCFRCRRGLPQKCDSLRKYGHEALDSGWPLSGGYAEHCH   80 (280)
T ss_pred             CCCCCEEEEEEEECCCCCCCCCCCCCCCCCEEEECCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEE
T ss_conf             97716079999989998657569855689999889737999995670979354867434476666789885764201788


Q ss_pred             CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC
Q ss_conf             1111-11222222232221222222333222111222222222222113444443222221222222-221112232211
Q gi|254780290|r  106 SHQG-HTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKC  183 (332)
Q Consensus       106 ~~~~-~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~  183 (332)
                      +++. .++++|+++|++.++.+.++..|+|+++ +....+++++|+|.|+ |++|++++++|+++|+ +|++++.+++|+
T Consensus        81 v~~~~~~~~iPd~l~~~~aa~~~c~~~t~~~~~-~~~~~~~g~~V~V~G~-G~iGl~~~~~a~~~Ga~~Vi~~d~~~~rl  158 (280)
T TIGR03366        81 LPAGTAIVPVPDDLPDAVAAPAGCATATVMAAL-EAAGDLKGRRVLVVGA-GMLGLTAAAAAAAAGAARVVAADPSPDRR  158 (280)
T ss_pred             ECCCEEEEECCCCCCHHHHHHHCCHHHHHHHHH-HHCCCCCCCEEEEEEC-CHHHHHHHHHHHHCCCCEEEEEECCHHHH
T ss_conf             616528998798788778776401355779999-9717899998999907-86899999999984998799991998999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCC
Q ss_conf             11112233222222222111122222222211122221111-11222221122345304798337875432224334305
Q gi|254780290|r  184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISK  262 (332)
Q Consensus       184 ~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~-~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~  262 (332)
                      ++++++|++++++..  +..+..++.+.++|+|++||++|. ..+++++++++++|+++.+|......+.++++..++.+
T Consensus       159 ~~a~~~Ga~~~i~~~--~~~~~~~~~~~g~g~D~vie~~G~~~~~~~a~~~l~~gG~iv~vG~~~~~~~~~~~~~~l~~k  236 (280)
T TIGR03366       159 ELALSFGATALAEPE--VLAERQGGLQNGRGVDVALEFSGATAAVRACLESLDVGGTAVLAGSVFPGGPVALDPEQVVRR  236 (280)
T ss_pred             HHHHHCCCCEEECCC--CHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCEECHHHHHHC
T ss_conf             999973998983775--779999997278887099987898899999999860498999980468998414789999869


Q ss_pred             CCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHC--CCC--CCCCEEEEEHHHH
Q ss_conf             3216777512400011378999999999999986--983--1021247418999
Q gi|254780290|r  263 RITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS--HVI--APVIHTVLPLGKV  312 (332)
Q Consensus       263 ~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~--g~l--~p~i~~~~~l~~i  312 (332)
                      ++++.|++.++..++          .+.++++++  +++  +++|+++|||+|+
T Consensus       237 e~~i~Gs~~~~~~~~----------~~ai~ll~~~~~~~~~~~lIt~~~pL~di  280 (280)
T TIGR03366       237 WLTIRGVHNYEPRHL----------DQAVRFLAANGQRFPFEELVGKPFPLADV  280 (280)
T ss_pred             CEEEEEEECCCHHHH----------HHHHHHHHHCCCCCCHHHHCCCEECCCCC
T ss_conf             879999606898999----------99999999769974869950643604519


No 29 
>KOG1196 consensus
Probab=100.00  E-value=6.8e-36  Score=256.54  Aligned_cols=312  Identities=23%  Similarity=0.289  Sum_probs=240.1

Q ss_pred             EEEEEECCC--CCC--CEEEE--EEECCCC-CCCCEEEEEEEEEEECHHHHHHHCCCCCCC-----C-CCCCEECCCCCC
Q ss_conf             089999156--885--30799--9823787-788628999999982787899986887787-----6-687300330002
Q gi|254780290|r    7 MRHVAMSGY--GKS--NVMFL--AESPIPQ-PQKEEILIKVEAIGVNRPDVMQRKGLYPPP-----K-NANPILGLEVAG   73 (332)
Q Consensus         7 Mka~v~~~~--g~~--~~l~~--~~~~~P~-~~~~~vlV~v~~~~in~~D~~~~~G~~~~~-----~-~~p~v~G~e~~G   73 (332)
                      -|+|++..+  |-|  +.+.+  .+.++++ +++++||||..+.+..|-- .++.+.....     . ..-++.| .++|
T Consensus         4 nkqviLk~y~~g~P~~~d~~~~~~~~el~~~~~s~~vlvknlYLS~DPym-R~rM~~~~~~~y~~~~~~G~pi~g-~GV~   81 (343)
T KOG1196           4 NKQVILKNYVTGFPTESDFEFTTTTVELRVPLGSGEVLVKNLYLSCDPYM-RIRMGKPDPSDYAPPYEPGKPIDG-FGVA   81 (343)
T ss_pred             CCEEEEECCCCCCCCCCCCEEEEEEECCCCCCCCCCEEEEEEEECCCHHH-HHHCCCCCCCCCCCCCCCCCEECC-CCEE
T ss_conf             54799823679998644512566530126789986178584300478888-744269996554576546867247-7548


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCC--CCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             3222222122222233332211223333322111111--122222--223222-12222223332221112222222222
Q gi|254780290|r   74 KIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGH--TLPIPK--GYNAIQ-AASLPESFFTVWANLFQTANLRSGQT  148 (332)
Q Consensus        74 ~V~~vG~~v~~~~~GdrV~~~~~~G~~ae~~~~~~~~--~~~iP~--~~s~~~-aa~l~~~~~tA~~~l~~~~~~~~g~~  148 (332)
                      .|++  ++.+.|++||-|+++.   +|.||.++++..  .+++|.  ++++.- ..+++++++|||-.+++.+..++|++
T Consensus        82 kVi~--S~~~~~~~GD~v~g~~---gWeeysii~~~~~~~~ki~~~~~~pLs~ylg~lGm~glTAy~Gf~ei~~pk~geT  156 (343)
T KOG1196          82 KVID--SGHPNYKKGDLVWGIV---GWEEYSVITPNDLEHFKIQHPTDVPLSYYLGLLGMPGLTAYAGFYEICSPKKGET  156 (343)
T ss_pred             EEEE--CCCCCCCCCCEEEEEC---CCEEEEEECCCCHHCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHCCCCCCCE
T ss_conf             9993--4888777675478751---5368887647511021478887447766002057720677887888538778978


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2211344444322222122222222111223221111112-233222222222-11112222222221112222111111
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK-LGAKHAINYLKE-DFLEILQKETQGRGIDIILDMVGAEY  226 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~-lGa~~vi~~~~~-~~~~~i~~~t~g~g~Divid~~G~~~  226 (332)
                      ++|.||+|+||+++.|+||.+||+|++.++|++|++++++ +|.|.+|||.++ ++.+.+.+ ..++|+|+.||.+|+..
T Consensus       157 v~VSaAsGAvGql~GQ~Ak~~Gc~VVGsaGs~EKv~ll~~~~G~d~afNYK~e~~~~~aL~r-~~P~GIDiYfdNVGG~~  235 (343)
T KOG1196         157 VFVSAASGAVGQLVGQFAKLMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLSAALKR-CFPEGIDIYFENVGGKM  235 (343)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCCCCEECCCCCCHHHHHHH-HCCCCCEEEEECCCCHH
T ss_conf             99940342367899999986188799955872564666650687342423676688999997-48776238876267289


Q ss_pred             CCCCCCCCCCCCCCEEEEECCCCCCC---C-CCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             22222112234530479833787543---2-2243343053216777512400011378999999999999986983102
Q gi|254780290|r  227 LNQHLTLLSKEGKLIIISFLGGNIAT---E-INLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV  302 (332)
Q Consensus       227 ~~~~~~~l~~~G~iv~~G~~~~~~~~---~-~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~  302 (332)
                      ++..+..|+..||++.||..+.....   . -+....+.|++++.|+....+.+..+..     ...+.+++++|+|+-.
T Consensus       236 lDavl~nM~~~gri~~CG~ISqYN~~~~~~~~~l~~ii~Kr~~iqgflv~d~~d~~~k~-----l~~l~~~ikegKI~y~  310 (343)
T KOG1196         236 LDAVLLNMNLHGRIAVCGMISQYNLENPEGLHNLSTIIYKRIRIQGFLVSDYLDKYPKF-----LDFLLPYIKEGKITYV  310 (343)
T ss_pred             HHHHHHHHHHCCCEEEEEEEHHCCCCCCCCCCCCCCEEEEEEEEEEEEEECCHHHHHHH-----HHHHHHHHHCCCEEEE
T ss_conf             99999975541646765200002566775655410001466785247752306564789-----9988888743867884


Q ss_pred             CEEEEEHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             12474189999999999829981328983
Q gi|254780290|r  303 IHTVLPLGKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       303 i~~~~~l~~i~~A~~~l~~g~~~GKvVi~  331 (332)
                      -+-.-+|++.+.||..|.+|++.||.+++
T Consensus       311 edi~~Glen~P~A~vglf~GkNvGKqiv~  339 (343)
T KOG1196         311 EDIADGLENGPSALVGLFHGKNVGKQLVK  339 (343)
T ss_pred             HHHHHHHHCCHHHHHHHHCCCCCCCEEEE
T ss_conf             34777774457998887526754526898


No 30 
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase; InterPro: IPR014183   The members of this protein family show dual function. First, they remove formaldehyde, a toxic metabolite, by acting as S-(hydroxymethyl)glutathione dehydrogenase (1.1.1.284 from EC). S-(hydroxymethyl)glutathione can form spontaneously from formaldehyde and glutathione, and so this enzyme previously was designated glutathione-dependent formaldehyde dehydrogenase. These same proteins are also designated as class III alcohol dehydrogenases (1.1.1.1 from EC), i.e. alcohol dehydrogenases that do not require glutathione and they tend to show poor activity for ethanol among their various substrate alcohols..
Probab=99.97  E-value=1.5e-31  Score=227.84  Aligned_cols=312  Identities=24%  Similarity=0.313  Sum_probs=246.0

Q ss_pred             CEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCC
Q ss_conf             20899991568853079998237877886289999999827878999868877876687300330002322222212222
Q gi|254780290|r    6 KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHW   85 (332)
Q Consensus         6 ~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~   85 (332)
                      +.||.+--.++.|  |+++|+++..|+.+|||||+.+.++|++|...+.|.-+.- -+|.++|||+.|+|.++|++|+.+
T Consensus         1 k~~a~va~~~~~P--l~~~e~d~~~P~~Gevl~~~~~tGvChtd~ftlsG~d~eG-~fP~~lGheG~G~v~~vGeGv~~~   77 (368)
T TIGR02818         1 KSRAAVAWAAGEP--LKIEEVDVELPKKGEVLVRIVATGVCHTDAFTLSGADPEG-VFPVILGHEGAGIVEAVGEGVTSL   77 (368)
T ss_pred             CCCEEEEECCCCC--EEEEEEECCCCCCCCEEEEEEECCEEECCCEEECCCCCCC-CCEEEECCCCCCEEEECCCCEEEE
T ss_conf             9631465337998--0588741038877716898730230101101323788665-200577136870453306743453


Q ss_pred             CCCCCCCCC------------------------------CC------------------CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             223333221------------------------------12------------------233333221111111222222
Q gi|254780290|r   86 NIGDEVCAL------------------------------VN------------------GGGYAEYCLSHQGHTLPIPKG  117 (332)
Q Consensus        86 ~~GdrV~~~------------------------------~~------------------~G~~ae~~~~~~~~~~~iP~~  117 (332)
                      +.||.|+-+                              .+                  ..+|+||.++++-.+.|+.+.
T Consensus        78 ~~GdhviPlyt~eC~~C~fC~sGktnlC~~~r~tqG~GlmPd~t~rf~~~G~~i~hymG~stf~ey~v~~e~~l~k~~~~  157 (368)
T TIGR02818        78 KVGDHVIPLYTAECGECKFCKSGKTNLCVAVRETQGKGLMPDGTSRFSKDGQPIYHYMGCSTFSEYTVVPEISLAKINPE  157 (368)
T ss_pred             ECCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCCC
T ss_conf             05863664105455662101356447889998515871156642112216835787613330000124322322010222


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             232221222222333222111222222222222113444443222221222222-2211122322111111223322222
Q gi|254780290|r  118 YNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAIN  196 (332)
Q Consensus       118 ~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~vi~  196 (332)
                      -.+++.+.|+|...|...++.+.+++++|++|.|+| .|++|+.+++=|+..++ |+++++.+++|.++++++||+..+|
T Consensus       158 a~~~~vCllGCGvttG~Gav~ntakv~~G~~vavfG-lG~~Gl~~~~Ga~~a~a~ri~a~d~n~~k~~~a~~~Gatd~~n  236 (368)
T TIGR02818       158 APLEKVCLLGCGVTTGIGAVLNTAKVEEGDTVAVFG-LGGIGLSVIQGAKLAKASRIIAIDINPAKFELAKKLGATDLVN  236 (368)
T ss_pred             CCCCCEEEEECCHHHHHHHHHHHHCCCCCCEEEEEE-CCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCCCCC
T ss_conf             452455675264344244553320025787689982-1046778876432203511799831757999997627611217


Q ss_pred             CCCC--CCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCC-CCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEEC
Q ss_conf             2222--111122222222211122221111-1122222112234-53047983378754322243343053216777512
Q gi|254780290|r  197 YLKE--DFLEILQKETQGRGIDIILDMVGA-EYLNQHLTLLSKE-GKLIIISFLGGNIATEINLNPIISKRITITGSTLR  272 (332)
Q Consensus       197 ~~~~--~~~~~i~~~t~g~g~Divid~~G~-~~~~~~~~~l~~~-G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~  272 (332)
                      ..+.  .+.+.+.+++. .|+|..|+|+|. ..++.++++..++ |.-+.+|..+........++++...+ -..|+.++
T Consensus       237 P~~~~~Pi~~v~~~~~~-~Gvd~~fe~~Gn~~~mr~ale~~h~GWG~s~~iGva~aG~ei~trPfqlvtGr-vW~GsafG  314 (368)
T TIGR02818       237 PKDYDKPIQEVIVELTD-GGVDYSFECIGNVNVMRAALESAHKGWGESIIIGVAGAGQEISTRPFQLVTGR-VWRGSAFG  314 (368)
T ss_pred             CHHHCCHHHHHHHHHHC-CCCCEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCEEEEEEE-EEECCCCC
T ss_conf             52220316666543412-67112431102078999998764126774489984167862223752565310-65032125


Q ss_pred             CCHHCCHHHHHHHHHHHHHHHHHCCCC--CCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             400011378999999999999986983--10212474189999999999829981328983
Q gi|254780290|r  273 RRTDIAKQSIRDSLQLKIWPLLNSHVI--APVIHTVLPLGKVAMAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       273 ~~~~~~~~~~~~~~~~~~~~~i~~g~l--~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~  331 (332)
                      ...-..      .+ ..+.+..-+|.+  ...++++.+|+++++||+.|.+|+.+ +.||+
T Consensus       315 GvkG~~------~l-P~~v~~~~~G~~~~~~~~t~t~~l~~~n~af~~mh~Gk~i-r~v~~  367 (368)
T TIGR02818       315 GVKGRT------EL-PGIVEQYMKGEIALDDFVTHTMPLEDINEAFDLMHEGKSI-RTVIH  367 (368)
T ss_pred             CCCCCC------CC-HHHHHHHHCCCEEEHHHHHHCCCHHHHHHHHHHHHCCCEE-EEEEC
T ss_conf             545621------00-2688877336312034554203678999999887558523-54531


No 31 
>TIGR01202 bchC Chlorophyll synthesis pathway, bchC; InterPro: IPR005903   Some prokaryotes, such as the purple and green sulphur bacteria, gain energy from a mode of photosynthesis that does not generate oxygen, and is inhibited by its presence , . These organisms do not include chlorophylls in their photosynthetic pigments, but instead use closely related molecules known as bacteriochlorophylls. Like chlorophylls, bacteriochlorophylls are tetrapyroles with a five-membered ring structure, differing in the side chains and hydration state of the ring structure. These alterations in structure determine what light wavelengths can be harvested by the organism .   Bacteriochlorophyll a is a photosynthetic pigment found in many of the purple bacteria. It is synthesised from protoporphyrin IX in a series of reactions including magnesium-chelation, methyl transfer, ring formation, vinyl-group reduction protochlorophyllide reduction, and finally phytol addition . This entry represents 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide a dehydrogenase, the enzyme catalysing the penultimate step in light-independent bacteriochlorophyll a biosynthesis .; GO: 0016491 oxidoreductase activity, 0030494 bacteriochlorophyll biosynthetic process.
Probab=99.95  E-value=1.6e-28  Score=207.75  Aligned_cols=300  Identities=19%  Similarity=0.256  Sum_probs=235.3

Q ss_pred             CEEEEEECCCCCCCEEEEEEECCCCCCCCEEEEEEEEEEEC-HHHHHHHCCCCCCCC--CCCCEECCCCCCCCCCCCCCC
Q ss_conf             20899991568853079998237877886289999999827-878999868877876--687300330002322222212
Q gi|254780290|r    6 KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVN-RPDVMQRKGLYPPPK--NANPILGLEVAGKIVDLGENT   82 (332)
Q Consensus         6 ~Mka~v~~~~g~~~~l~~~~~~~P~~~~~~vlV~v~~~~in-~~D~~~~~G~~~~~~--~~p~v~G~e~~G~V~~vG~~v   82 (332)
                      +.||+|+++   |+.|+++++.+-+|.++|++|++.++||+ +++.+.++|.+|+.+  -+|+|||+|.+|+|++.|+++
T Consensus         1 ~t~aivlsg---p~~~~l~~~~L~~p~~~D~vVei~ySgISTGTEKl~~~G~~P~fPGmgyPlvPGYE~~G~vV~Ag~~~   77 (325)
T TIGR01202         1 KTQAIVLSG---PNQLELREVTLTPPSPGDLVVEIEYSGISTGTEKLFWNGLMPPFPGMGYPLVPGYESVGRVVEAGPDT   77 (325)
T ss_pred             CCEEEEECC---CCCEEEEEEEEECCCCCCEEEEEEECCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEECCCCC
T ss_conf             925899527---66103567874268998648987664731467999855898534777678877622525003045667


Q ss_pred             CCCCCCCCCCC-----CC---------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC
Q ss_conf             22222333322-----11---------223333322111111122222223222122222233322211122-2222222
Q gi|254780290|r   83 THWNIGDEVCA-----LV---------NGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQT-ANLRSGQ  147 (332)
Q Consensus        83 ~~~~~GdrV~~-----~~---------~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~-~~~~~g~  147 (332)
                      ..=++||||+.     +.         -.|+-+++++++.+.+.++.+.+..+-.+.|++ ..||+|++--. -+.....
T Consensus        78 ~~G~~G~~vfvpGs~cy~p~daG~vrglFGgAs~r~V~~~~r~~~ld~~~~~~~G~lLaL-aATA~H~vag~Gkr~~~~~  156 (325)
T TIGR01202        78 GFGRIGDRVFVPGSNCYEPTDAGDVRGLFGGASKRLVTPASRVCRLDPALGPQGGILLAL-AATARHAVAGAGKREVKVL  156 (325)
T ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCCCHHHCCCCEEEECCCEEEEECHHCCHHHHHHHHH-HHHHHHHHHHCCCCCCCCC
T ss_conf             888887746837767757666666420100001324632521576240106123454477-8899999850343222478


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C
Q ss_conf             2221134444432222212222222-2111223221111112233222222222111122222222211122221111-1
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA-E  225 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~-~  225 (332)
                      ..||.| .|.+|.++..|+...|.+ +.++..+++|++.+.+.   .++|..++|..-    ...++-++.+||.+|. .
T Consensus       157 pdLivG-~G~lGrLlArLt~~aG~~~p~VwEt~~~R~~~a~gy---~v~~P~~ddvsv----al~rrdy~~i~D~sG~~~  228 (325)
T TIGR01202       157 PDLIVG-HGTLGRLLARLTVAAGGSPPAVWETNPRRRDGATGY---EVLDPEKDDVSV----ALPRRDYRAIYDASGDPS  228 (325)
T ss_pred             CCEEEE-CCHHHHHHHHHHHHCCCCCCEEECCCHHHHHCCCCC---EEECCCCCCEEE----EECCCCEEEEEECCCCHH
T ss_conf             712871-678999999999971897635547866873014564---033774346357----425873017871578678


Q ss_pred             CCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCC--CC
Q ss_conf             1222221122345304798337875432224334305321677751240001137899999999999998698310--21
Q gi|254780290|r  226 YLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP--VI  303 (332)
Q Consensus       226 ~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p--~i  303 (332)
                      .+++.++-|+++|.++.+|...  .+..+++.+-+.|+.++.--     .++.+.     -...+.+|+++|+|..  ++
T Consensus       229 ~id~lv~rL~kgGe~vl~GfYt--~P~~f~f~pAF~kE~~~r~A-----aeWq~~-----DL~avr~Lie~G~lsl~~li  296 (325)
T TIGR01202       229 LIDTLVRRLAKGGEIVLAGFYT--EPVNFDFVPAFMKELRLRIA-----AEWQKG-----DLLAVRELIESGKLSLDGLI  296 (325)
T ss_pred             HHHHHHHHHHCCCEEEEECCCC--CCCEEEECHHHHHHHHHHHH-----HHCCHH-----HHHHHHHHHHHHHHHHHHCC
T ss_conf             9999999873299799803357--76301020678999999997-----513843-----58999999986033054213


Q ss_pred             EEEEEHHH-HHHHHH-HHHCCCCCCEEEE
Q ss_conf             24741899-999999-9982998132898
Q gi|254780290|r  304 HTVLPLGK-VAMAHD-IMEKSEHIGKIIL  330 (332)
Q Consensus       304 ~~~~~l~~-i~~A~~-~l~~g~~~GKvVi  330 (332)
                      +|.-+-+| +.|||+ .+.+-... |.||
T Consensus       297 TH~~~~~dnaaeAY~tAf~DpDCL-KMil  324 (325)
T TIGR01202       297 THQRPASDNAAEAYRTAFSDPDCL-KMIL  324 (325)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCCC-CCCC
T ss_conf             366887689999998743888600-0124


No 32 
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase; InterPro: IPR014190   Leukotriene B4 12-hydroxydehydrogenase is an NADP-dependent enzyme of arachidonic acid metabolism, responsible for converting leukotriene B4 to the much less active metabolite 12-oxo-leukotriene B4. The BRENDA database lists leukotriene B4 12-hydroxydehydrogenase as one of the synonyms of 2-alkenal reductase (1.3.1.74 from EC), while 1.3.1.48 from EC is 15-oxoprostaglandin 13-reductase..
Probab=99.94  E-value=6.7e-28  Score=203.67  Aligned_cols=310  Identities=21%  Similarity=0.262  Sum_probs=244.3

Q ss_pred             EEEEECCC--CCC--CEEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCC
Q ss_conf             89999156--885--30799982378778862899999998278789998688778766873003300023222222122
Q gi|254780290|r    8 RHVAMSGY--GKS--NVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTT   83 (332)
Q Consensus         8 ka~v~~~~--g~~--~~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~   83 (332)
                      |.|.+.++  |-|  ..+++++.++|.+..||||.+-...++   |..++-+.... ++.....|...+=+|+   ++..
T Consensus         4 k~Wtlkkhf~G~Pt~~~felkt~elPPl~nGevllealfl~v---dPymr~~~k~l-keGd~mmG~qva~vve---skn~   76 (327)
T TIGR02825         4 KSWTLKKHFEGYPTDSDFELKTVELPPLNNGEVLLEALFLSV---DPYMRVAAKRL-KEGDTMMGQQVARVVE---SKNS   76 (327)
T ss_pred             CCEEHHHCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHC---CCHHHHHHHHH-HHHHHHHHHHHHHHHH---HCCC
T ss_conf             520021110016778752034301787754067766677631---50244433441-0002567778887763---1244


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22223333221122333332211111112222222----32221-22222233322211122222222222211344444
Q gi|254780290|r   84 HWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGY----NAIQA-ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGI  158 (332)
Q Consensus        84 ~~~~GdrV~~~~~~G~~ae~~~~~~~~~~~iP~~~----s~~~a-a~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~v  158 (332)
                      .|..|.-|.+..   +|+++.+-|...+-+++..+    .+.-| .+++++++|||..|.+.+.++.|++|+|.+|+|.+
T Consensus        77 a~P~Gt~v~a~~---GW~~hsisdG~~l~kl~~eWPd~~PlslalGtvGmPG~tayfGll~iCG~k~G~tv~v~aaaGav  153 (327)
T TIGR02825        77 ALPKGTIVLASS---GWTSHSISDGKDLEKLLTEWPDTLPLSLALGTVGMPGLTAYFGLLEICGVKGGETVLVNAAAGAV  153 (327)
T ss_pred             CCCCCEEEEECC---CCCEEEECCCHHHHHHHHCCCCCCCHHHHHCCCCCCHHHHHHHHHHHCCCCCCCEEEEECCCCCH
T ss_conf             677541787406---76200000420123322116652431221003464057888767775046668757885124412


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             32222212222222211122322111111223322222222211112222222221112222111111222221122345
Q gi|254780290|r  159 GTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEG  238 (332)
Q Consensus       159 G~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~~~~~~~~~l~~~G  238 (332)
                      |...-|+|+..||+|+++++|++|.+.++++|.|.++||.+-.-.++..+...+.|+|..||.+|++..+..+.-++..|
T Consensus       154 G~vvGqiak~kGC~vvG~~Gs~ekv~yl~k~Gfd~~fnyktv~slee~l~~a~PdGydCyfdnvGGefsn~vi~qmk~fG  233 (327)
T TIGR02825       154 GSVVGQIAKLKGCKVVGAAGSDEKVAYLKKLGFDVAFNYKTVKSLEETLKKASPDGYDCYFDNVGGEFSNTVIRQMKKFG  233 (327)
T ss_pred             HHHHHHHHHHCCCEEEECCCCHHHHHHHHHCCCEEEEEHHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHCC
T ss_conf             44554343103524773367556899998706302550146788999887407885200010346135789999887508


Q ss_pred             CCEEEEECC-----CCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHH
Q ss_conf             304798337-----875432224334305321677751240001137899999999999998698310212474189999
Q gi|254780290|r  239 KLIIISFLG-----GNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA  313 (332)
Q Consensus       239 ~iv~~G~~~-----~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~  313 (332)
                      |+..||..+     +..+....+..++..+++..++.+.+|.-.    .++....+++.++.+|+++..-.-+-+|++.+
T Consensus       234 r~aiCGais~yn~tG~~P~GP~Pe~v~yq~~rme~f~~~rW~G~----~~qkal~~ll~Wv~eGk~q~~e~~~eGfe~mP  309 (327)
T TIGR02825       234 RIAICGAISTYNRTGPLPPGPAPEVVIYQELRMEGFIVNRWQGE----VRQKALKELLKWVLEGKIQYKEYVIEGFENMP  309 (327)
T ss_pred             CEEEEEHHHHCCCCCCCCCCCCCCEEEEEEEEEEEEEEEECCCC----HHHHHHHHHHHHHHCCCEEEHHHHHHHHHHHH
T ss_conf             24563003420136887546686445410000002244311450----45789999999875173112133242133125


Q ss_pred             HHHHHHHCCCCCCEEEEE
Q ss_conf             999999829981328983
Q gi|254780290|r  314 MAHDIMEKSEHIGKIILL  331 (332)
Q Consensus       314 ~A~~~l~~g~~~GKvVi~  331 (332)
                      .||-.|.+|.+.||.+++
T Consensus       310 aafm~mlkG~n~Gk~~~~  327 (327)
T TIGR02825       310 AAFMGMLKGENLGKTIVK  327 (327)
T ss_pred             HHHHHHHCCCCCCCCCCC
T ss_conf             899987413202100159


No 33 
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein; InterPro: IPR014187   Members of this entry form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases. The gene neighbourhood of members of this family is not conserved and it appears that no members are characterised. Sequence alignments reveal 6 invariant cysteine residues and one invariant histidine..
Probab=99.93  E-value=3.3e-27  Score=199.07  Aligned_cols=297  Identities=23%  Similarity=0.309  Sum_probs=233.3

Q ss_pred             EEEECCCCCCC--EEEEEEECCCCCCCCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCC----
Q ss_conf             99991568853--079998237877886289999999827878999868877876687300330002322222212----
Q gi|254780290|r    9 HVAMSGYGKSN--VMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT----   82 (332)
Q Consensus         9 a~v~~~~g~~~--~l~~~~~~~P~~~~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v----   82 (332)
                      +|.+.++|..+  .|+.++.++|.|+++|+||+|.+||+|.+|+|+.+|..+..+ ...+||||.+|.|++.|+.+    
T Consensus         1 ~W~v~~PGP~~~G~l~~~~~~vP~P~~~ellv~v~aCGvCrtdlhv~eGdl~vhr-~~v~PGhevv~~v~~~~~~~~~~~   79 (334)
T TIGR02822         1 AWEVERPGPVESGPLRFVEEEVPRPGPGELLVRVRACGVCRTDLHVSEGDLPVHR-ERVTPGHEVVGEVVEAGSAVGAAD   79 (334)
T ss_pred             CCCCCCCCCCCCCCCCHHHCCCCCCCCCCEEEEEEECCEEECCCEEECCCCCCCC-CCCCCCHHHHHHHHHCCHHHHHHC
T ss_conf             9302679867766400000237898875158886304312023245317521012-446771677878773111333210


Q ss_pred             -CCCCCCCCCC----------------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             -2222233332----------------------------21122333332211111112222222322212222223332
Q gi|254780290|r   83 -THWNIGDEVC----------------------------ALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTV  133 (332)
Q Consensus        83 -~~~~~GdrV~----------------------------~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA  133 (332)
                       ..|..||||-                            |...+|+||||..+|+.+...+|.++++++.|.+.|+++..
T Consensus        80 ~~~~~~G~rvG~~Wlr~t~G~C~yC~rG~enlCP~s~ytGWd~dGGyaey~tvPa~~a~~lP~~~~d~~laPllCaGiiG  159 (334)
T TIGR02822        80 EGEFAVGDRVGIAWLRRTCGVCRYCRRGAENLCPASRYTGWDADGGYAEYTTVPAAFAYRLPTGYADEELAPLLCAGIIG  159 (334)
T ss_pred             CCCCCCCCCCCHHHHHHCCCEEEECCCCHHHCCCCCCCCCCCCCCCEEEHHCCHHHHHHHCCCCCCHHHHHHHHHHHHHH
T ss_conf             34545665012133331166000012560123765335532578861200002579986567875523321456666777


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22111222222222222113444443222221222222221112232211111122332222222221111222222222
Q gi|254780290|r  134 WANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGR  213 (332)
Q Consensus       134 ~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~  213 (332)
                      |++|.+. .+.+|-++-++| -|+-.++..|+|.+.|++|-++.+.+...+++..+|+.-+-+..|.          .+.
T Consensus       160 y~~l~r~-~lP~GG~lG~yG-fGGsah~~aqvalaqGa~~hv~tr~~~~~~la~~lGaas~~~a~d~----------PP~  227 (334)
T TIGR02822       160 YRALLRA-ELPPGGRLGLYG-FGGSAHLTAQVALAQGAEVHVLTRGAAARKLALALGAASAQGAADR----------PPE  227 (334)
T ss_pred             HHHHHHH-CCCCCCEEEEEE-CCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHCCCCCC----------CCC
T ss_conf             7787741-288986356530-4713566666665358679998067678999988401221135678----------787


Q ss_pred             CCCCCC-CCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHH
Q ss_conf             111222-2111111222221122345304798337875432224334305321677751240001137899999999999
Q gi|254780290|r  214 GIDIIL-DMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWP  292 (332)
Q Consensus       214 g~Divi-d~~G~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~  292 (332)
                      +.|..| -...++....+++.|..+|.+...|..-.+. ++++...-++++..+....-.++.+-          .+.++
T Consensus       228 Pld~ailfaP~G~lv~~al~ald~GG~l~~aGihl~d~-P~l~y~~~lf~e~~~rsvt~ntra~~----------r~fl~  296 (334)
T TIGR02822       228 PLDAAILFAPAGELVPPALEALDRGGVLAVAGIHLTDV-PPLNYQRHLFRERQIRSVTSNTRADA----------REFLE  296 (334)
T ss_pred             CHHHHHHHCCCCHHHHHHHHHHCCCCEEEEEEEEECCC-CCHHHHHHHHHHHHHHHHHHHHHHHH----------HHHHH
T ss_conf             41123100265504799999740588378720221057-73235567654322111111102457----------89998


Q ss_pred             HHHCCCCCCCCEEEEEHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             99869831021247418999999999982998132898
Q gi|254780290|r  293 LLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL  330 (332)
Q Consensus       293 ~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi  330 (332)
                      +..+..++. -++.|||+++++|+.++..|+..|-.|+
T Consensus       297 ~a~~~~~~~-tt~~yPl~~a~~al~dl~aGr~~Gaavl  333 (334)
T TIGR02822       297 LAAQHRVRV-TTHEYPLDEADRALADLKAGRFDGAAVL  333 (334)
T ss_pred             HHHHCEEEE-ECCCCCHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             651113677-2143774789999986531321440330


No 34 
>pfam08240 ADH_N Alcohol dehydrogenase GroES-like domain. This is the catalytic domain of alcohol dehydrogenases. Many of them contain an inserted zinc binding domain. This domain has a GroES-like structure.
Probab=99.72  E-value=3e-18  Score=139.84  Aligned_cols=81  Identities=32%  Similarity=0.555  Sum_probs=72.8

Q ss_pred             CCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCC-------------------
Q ss_conf             8628999999982787899986887787668730033000232222221222222333322-------------------
Q gi|254780290|r   33 KEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCA-------------------   93 (332)
Q Consensus        33 ~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e~~G~V~~vG~~v~~~~~GdrV~~-------------------   93 (332)
                      |+|||||+++++||++|+++++|.++. .++|.++|||++|+|+++|+++++|++||||..                   
T Consensus         1 P~evlvkv~~~gic~sD~~~~~g~~~~-~~~p~v~GhE~~G~V~~~G~~v~~~~~GdrV~~~~~~~Cg~C~~C~~G~~~~   79 (108)
T pfam08240         1 PGEVLVRVKAAGICGSDLHIYRGEPPP-VKLPLILGHEGAGIVEEVGPGVTGLKVGDRVVVYPLIPCGKCAACREGRENL   79 (108)
T ss_pred             CCEEEEEEEEEEECHHHCCEEECCCCC-CCCCEECCEEEEEEEEECCCCCCCCCCCCEEEECCCCCCCCCHHHHCCCCCC
T ss_conf             999999999995675670635078898-9999976285379971138171326788999986734899897895909020


Q ss_pred             --------CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             --------112233333221111111222
Q gi|254780290|r   94 --------LVNGGGYAEYCLSHQGHTLPI  114 (332)
Q Consensus        94 --------~~~~G~~ae~~~~~~~~~~~i  114 (332)
                              +..+|+||||+++|+++++||
T Consensus        80 C~~~~~~G~~~~G~~aey~~vp~~~lv~l  108 (108)
T pfam08240        80 CPNGKFLGVHLDGGFAEYVVVPARNLVPL  108 (108)
T ss_pred             CCCCCEEEECCCCCCCCEEEEEHHHEEEC
T ss_conf             88889888087781576799755998989


No 35 
>pfam00107 ADH_zinc_N Zinc-binding dehydrogenase.
Probab=99.70  E-value=3.4e-18  Score=139.49  Aligned_cols=119  Identities=39%  Similarity=0.645  Sum_probs=108.6

Q ss_pred             CCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC
Q ss_conf             443222221222222-2211122322111111223322222222211112222222221112222111-11122222112
Q gi|254780290|r  157 GIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG-AEYLNQHLTLL  234 (332)
Q Consensus       157 ~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G-~~~~~~~~~~l  234 (332)
                      ++|++++|+|+++|+ +|++++++++|+++++++|+++++|+++.++.+.+++.+.+.|+|++|||+| ...++.+++++
T Consensus         1 giG~~~iq~ak~~Ga~~Vi~~~~~~~r~~~a~~lGa~~~i~~~~~~~~~~i~~~~~~~g~d~vid~~g~~~~~~~~~~~~   80 (131)
T pfam00107         1 GVGLAAVQLAKALGAARVIAVDRSEEKLELAKELGADHVINYRDEDFVERVRELTGGRGVDVVIDCVGAPATLEQALELL   80 (131)
T ss_pred             CHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHH
T ss_conf             95899999999849987999969889999999759973235332212455654049977649886688666799998753


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHH
Q ss_conf             234530479833787543222433430532167775124000
Q gi|254780290|r  235 SKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTD  276 (332)
Q Consensus       235 ~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~  276 (332)
                      +++|+++.+|..++ .+..+++.+++.+++++.|++.+++.+
T Consensus        81 ~~~G~iv~~G~~~~-~~~~~~~~~~~~k~i~i~Gs~~~~~~~  121 (131)
T pfam00107        81 RPGGRVVVVGLPGG-APVPFPLRDLLLKELTILGSLGGGREE  121 (131)
T ss_pred             CCCCEEEEEECCCC-CCCCCCHHHHHHCCEEEEEECCCCHHH
T ss_conf             59978999946789-974053899986985999981489999


No 36 
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent; InterPro: IPR014184   Members of this entry represent a distinct clade within the larger family of zinc-dependent dehydrogenases of medium chain alcohols. This entry includes the so-called glutathione-dependent formaldehyde dehydrogenase. Members of this entry have a tightly bound NAD that can act as a true cofactor, rather than a co-substrate in dehydrogenase reactions and in dismutase reactions for some aldehydes. The name given to this family, however, is formaldehyde dehydrogenase, glutathione-independent..
Probab=99.69  E-value=1.9e-17  Score=134.58  Aligned_cols=310  Identities=22%  Similarity=0.278  Sum_probs=202.6

Q ss_pred             EEEEEECCCCCCCEEEEEEECCCCCC----------------CCEEEEEEEEEEECHHHHHHHCCCCCCCCCCCCEECCC
Q ss_conf             08999915688530799982378778----------------86289999999827878999868877876687300330
Q gi|254780290|r    7 MRHVAMSGYGKSNVMFLAESPIPQPQ----------------KEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLE   70 (332)
Q Consensus         7 Mka~v~~~~g~~~~l~~~~~~~P~~~----------------~~~vlV~v~~~~in~~D~~~~~G~~~~~~~~p~v~G~e   70 (332)
                      -|++++...|..   +++++..|++.                .+-|+.|+.+..||.+|.|+..|.-.  .+...++|||
T Consensus         3 n~~v~y~G~G~v---~~~~i~~P~~~~~~~~~~~~~~~~~~~~hGvilk~~~tniCGsdqhmvrGrtt--a~~~lvlGhe   77 (403)
T TIGR02819         3 NKGVVYLGAGKV---EVQDIDYPKLELKDGPGVNKANVTRKIEHGVILKVVTTNICGSDQHMVRGRTT--APTGLVLGHE   77 (403)
T ss_pred             CCEEEEECCCEE---EEEECCCCCEEECCCCCCCHHHCCCEECCCEEEEEEEEECCCCCCCEEECCCC--CCCCCEEEEE
T ss_conf             844788348716---88642686112024666420110330015448987532003564403303222--5444264100


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC-------C--------------------------CCC----CCCCCCCCCCC--CCCC
Q ss_conf             0023222222122222233332-------2--------------------------112----23333322111--1111
Q gi|254780290|r   71 VAGKIVDLGENTTHWNIGDEVC-------A--------------------------LVN----GGGYAEYCLSH--QGHT  111 (332)
Q Consensus        71 ~~G~V~~vG~~v~~~~~GdrV~-------~--------------------------~~~----~G~~ae~~~~~--~~~~  111 (332)
                      ..|.|++.|.+|..++.||-|.       |                          +..    -|+.++|+.+|  ..++
T Consensus        78 itG~~~e~G~dve~~~~Gd~~svPfn~aCGrC~~C~~~~t~~C~~vnP~r~G~ayGyvdmG~W~GGq~~yv~vPyad~~l  157 (403)
T TIGR02819        78 ITGEVIEVGRDVEFLKIGDIVSVPFNIACGRCRNCKEQKTGVCLNVNPARAGAAYGYVDMGGWVGGQSEYVLVPYADFNL  157 (403)
T ss_pred             CCEEEEEECCCCCEEECCCEEECCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCEEEEECCCCCCCCEEEEEEECCCHHH
T ss_conf             01246740564002322767750520245620011245762433107787774022445375316630068851111164


Q ss_pred             CCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC
Q ss_conf             2222222----322212222223332221112222222222221134444432222212222222-21112232211111
Q gi|254780290|r  112 LPIPKGY----NAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLAC  186 (332)
Q Consensus       112 ~~iP~~~----s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~~~~~~~~  186 (332)
                      .+.|+.=    ...+..+|...+.|.|+... .+.+++|.+|.|.| +|++|+++..-++.+|+. +++-+-+++|+..+
T Consensus       158 l~~P~~~~al~k~~dl~~lsdi~PtG~hGa~-~aGv~~G~tvy~aG-aGPvGla~a~~a~llGaa~~ivGd~~~~rla~a  235 (403)
T TIGR02819       158 LKFPDRDQALEKIRDLTMLSDIFPTGYHGAV-TAGVKTGSTVYIAG-AGPVGLAAAASAQLLGAAVVIVGDLNEERLAQA  235 (403)
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHCCCCCCCCE-ECCCCCCCEEEEEC-CCHHHHHHHHHHHHHCCEEEEEECCCHHHHHHH
T ss_conf             5178667899998877887763267643201-12544575689844-761578887665540313688814536788777


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---------------CCCCCCCCCCCCCCCEEEEECCCCCC
Q ss_conf             122332222222221111222222222111222211111---------------12222211223453047983378754
Q gi|254780290|r  187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAE---------------YLNQHLTLLSKEGKLIIISFLGGNIA  251 (332)
Q Consensus       187 ~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~---------------~~~~~~~~l~~~G~iv~~G~~~~~~~  251 (332)
                      +++|.+.+=-..+..+.+.+.+..+..-+|..+||+|-+               .++...+..+.+|.+-.-|..-.+.+
T Consensus       236 ~~~G~e~v~l~~~~~~~~~i~~ilG~~~vd~avd~vGfea~~hG~~~~~e~Pa~vln~~m~~t~~~G~~GiPGlyvt~dP  315 (403)
T TIGR02819       236 RSFGCETVDLKKDATLAEQIEQILGEPEVDCAVDCVGFEAKGHGSDGKKEAPATVLNSLMEVTRVGGAIGIPGLYVTEDP  315 (403)
T ss_pred             HHCCCEEEEECCCCCHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEECCCC
T ss_conf             66361278611245247899987087520100012320023367654445327899999998740576157711661788


Q ss_pred             CC-----------CCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCC-CCCCEEEEEHHHHHHHHHHH
Q ss_conf             32-----------2243343053216777512400011378999999999999986983-10212474189999999999
Q gi|254780290|r  252 TE-----------INLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVI-APVIHTVLPLGKVAMAHDIM  319 (332)
Q Consensus       252 ~~-----------~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l-~p~i~~~~~l~~i~~A~~~l  319 (332)
                      -.           +.+..-|.|...|.  ..+    .+.....+.+...++  ..+-.+ +..-.++.+|+++++.|..+
T Consensus       316 G~~~~~a~~G~l~~~~G~GWak~~~f~--tGq----~P~~~y~r~lm~ail--~~~~~ia~~v~~~~i~l~~aP~Gy~~f  387 (403)
T TIGR02819       316 GAVDEAAKTGALSLRLGLGWAKSHSFV--TGQ----TPVMKYNRNLMQAIL--HDRVQIAKAVNVKVISLDDAPEGYAEF  387 (403)
T ss_pred             CCCHHHHHCCCEEEEEECCEEEEEEEE--CCC----CCHHHHHHHHHHHHH--HHHHHHHHHHCEEEEECCCCCCHHHHH
T ss_conf             742034313605898604310000031--277----420133378999999--866776542120588503364026775


Q ss_pred             HCCCCCCEEEEEC
Q ss_conf             8299813289839
Q gi|254780290|r  320 EKSEHIGKIILLP  332 (332)
Q Consensus       320 ~~g~~~GKvVi~P  332 (332)
                      ..|-.. |.||.|
T Consensus       388 d~G~~~-kfv~~P  399 (403)
T TIGR02819       388 DKGAAK-KFVIDP  399 (403)
T ss_pred             CCCCCC-EEEECC
T ss_conf             045430-367465


No 37 
>pfam11017 DUF2855 Protein of unknown function (DUF2855). This family of proteins has no known function.
Probab=98.31  E-value=3.2e-07  Score=66.89  Aligned_cols=238  Identities=12%  Similarity=0.062  Sum_probs=121.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---------------------------CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             002322222212222223333221122333---------------------------33221111111222222232221
Q gi|254780290|r   71 VAGKIVDLGENTTHWNIGDEVCALVNGGGY---------------------------AEYCLSHQGHTLPIPKGYNAIQA  123 (332)
Q Consensus        71 ~~G~V~~vG~~v~~~~~GdrV~~~~~~G~~---------------------------ae~~~~~~~~~~~iP~~~s~~~a  123 (332)
                      +.++|++  +++.++.+|+|++|+.+.+++                           -+|..+..+....    -+.+..
T Consensus        37 G~a~V~~--S~~~~i~~Ger~yGy~P~a~~l~~~p~~v~~~~f~D~~~hR~~l~pvYN~Y~r~~~d~~y~----~~~e~~  110 (314)
T pfam11017        37 GFATVVE--SNVPGIAVGERLYGYFPMASHLVLQPGKVSPGGFVDVSAHRQGLAPIYNQYLRVAADPGYD----PDEEAW  110 (314)
T ss_pred             EEEEEEE--ECCCCCCCCCEEEEECCCCCEEEEECCCCCCCCEEECCHHHHHCCHHHHHHHCCCCCCCCC----CCHHHH
T ss_conf             3788875--0699866675688724776558984454578863227154412634543241046775668----242579


Q ss_pred             CCCC-CCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             2222-22333222111222----2222222221134444432222212222--2222111223221111112233-2222
Q gi|254780290|r  124 ASLP-ESFFTVWANLFQTA----NLRSGQTVLIHGGSSGIGTTAIQLASYF--GATVYTTAKSEEKCLACLKLGA-KHAI  195 (332)
Q Consensus       124 a~l~-~~~~tA~~~l~~~~----~~~~g~~vlV~ga~g~vG~~a~qla~~~--G~~vi~~~~~~~~~~~~~~lGa-~~vi  195 (332)
                      -++. --++|+| .|.+..    -. -.+.|+|.+|+|=++....+.++..  +.++++++ |+.+.++++++|. |+|+
T Consensus       111 ~~LlrPLf~Tsf-ll~d~l~d~~~~-gA~qvii~SASSKTAiglA~~L~~~~~~~~vVGLT-S~~N~~Fve~lG~YD~Vl  187 (314)
T pfam11017       111 QALLRPLFITSF-LLDDFLADNDFF-GAAQVVLTSASSKTAIGLAFLLKQRSGGLKVVGLT-SARNVAFVEGLGCYDEVL  187 (314)
T ss_pred             HHHHHHHHHHHH-HHHHHHHCCCCC-CCCEEEEEECCCCHHHHHHHHHHHCCCCCCEEEEC-CCCCHHHHHCCCCCEEEE
T ss_conf             999889999999-999997412667-86228994034303888999998518998579962-885442665468741676


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCC-CEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECC
Q ss_conf             22222111122222222211122221111-112222211223453-0479833787543222433430532167775124
Q gi|254780290|r  196 NYLKEDFLEILQKETQGRGIDIILDMVGA-EYLNQHLTLLSKEGK-LIIISFLGGNIATEINLNPIISKRITITGSTLRR  273 (332)
Q Consensus       196 ~~~~~~~~~~i~~~t~g~g~Divid~~G~-~~~~~~~~~l~~~G~-iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~  273 (332)
                      .|.+-+      ++.... --+++|..|. +.+...-..++.+=+ .+.+|.+.-+....-...+-......+-...+..
T Consensus       188 tYd~i~------~l~~~~-~sV~VDmAGn~~vl~~Lh~~lgd~l~~s~~VG~Thw~~~~~~~~lpg~~p~fFFAP~~i~k  260 (314)
T pfam11017       188 TYDDID------SLDAAA-PSVIVDFAGNAALLGALHEHLGDNLVYSCRVGATHWDKVEAAGALPGPKPEFFFAPDQIQK  260 (314)
T ss_pred             ECCCHH------HCCCCC-CEEEEECCCCHHHHHHHHHHHHHHHHEEEEECCCCCCCCCCCCCCCCCCCEEEECHHHHHH
T ss_conf             322354------358789-8899988899899999999987645507887023534567744568898547856399999


Q ss_pred             C-HHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCCC
Q ss_conf             0-00113789999999999999869831021247418999999999982998
Q gi|254780290|r  274 R-TDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEH  324 (332)
Q Consensus       274 ~-~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~~  324 (332)
                      + .+..+....+.+.....+++..-.=-..+.+..+++.+.++|+.+.+|+.
T Consensus       261 R~kewG~~~~~~r~~~aw~~f~~~~~~wl~v~~~~G~ea~~~~y~~ll~G~v  312 (314)
T pfam11017       261 RIKDWGPEEFNRRVAAAWKAFAAAAMGWLTVEEIAGPEAIEAAYQDLLAGRV  312 (314)
T ss_pred             HHHHHCHHHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHCCCC
T ss_conf             9986199999999999999999861274799996488999999999976888


No 38 
>CHL00194 ycf39 Ycf39; Provisional
Probab=97.78  E-value=6.3e-06  Score=58.34  Aligned_cols=99  Identities=17%  Similarity=0.204  Sum_probs=67.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222113444443222221222222221112232211111122332222-222221111222222222111222211111
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI-NYLKEDFLEILQKETQGRGIDIILDMVGAE  225 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi-~~~~~~~~~~i~~~t~g~g~Divid~~G~~  225 (332)
                      .+|||+||+|.+|...+.-+...|.+|.+.+|++++...+++.|++.+. |.+++   +.+.+..  +|+|.||++.+..
T Consensus         1 M~ILV~GATG~lGr~vVr~Ll~~G~~Vr~lvRnp~ka~~l~~~Gve~v~gDl~dp---esl~~Al--~GvdaVi~~~~~~   75 (319)
T CHL00194          1 MSLLVIGATGTLGRQIVRRALDEGYQVKCLVRNLRKAAFLKEWGAELVYGDLSLP---ETIPPAL--EGITAIIDASTSR   75 (319)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEEEECCCCH---HHHHHHH--CCCCEEEEECCCC
T ss_conf             9799989985899999999996889089995786763234215967999427887---7899996--5996799945667


Q ss_pred             C-----CC--------CCCCCCCCCC--CCEEEEECCCCC
Q ss_conf             1-----22--------2221122345--304798337875
Q gi|254780290|r  226 Y-----LN--------QHLTLLSKEG--KLIIISFLGGNI  250 (332)
Q Consensus       226 ~-----~~--------~~~~~l~~~G--~iv~~G~~~~~~  250 (332)
                      .     ..        ..++..+..|  |++.++..+.+.
T Consensus        76 ~~~~~~~~~vd~~g~~~li~AAk~aGVkr~V~lS~lga~~  115 (319)
T CHL00194         76 PSDLNNAYQIDLEGKLALIEAAKAAKVKRFIFFSILNAEQ  115 (319)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             7886208898898899999999984998899961356666


No 39 
>PRK06953 short chain dehydrogenase; Provisional
Probab=97.39  E-value=1.1e-05  Score=56.71  Aligned_cols=77  Identities=29%  Similarity=0.327  Sum_probs=58.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222113444443222221222222221112232211111122332-2222222211112222222221112222111
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK-HAINYLKEDFLEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~-~vi~~~~~~~~~~i~~~t~g~g~Divid~~G  223 (332)
                      +++||+||++|+|.+.++-....|++|++++|++++.+.++++|++ ..+|..+++-.+.+.+...+...|+++.+.|
T Consensus         2 K~~LVTGas~GIG~a~a~~la~~G~~V~~~~R~~~~l~~l~~~~~~~~~~Dv~d~~~v~~~~~~~~~~~ldili~nAG   79 (222)
T PRK06953          2 KTVLIVGASRGIGLEFVRQYRADGWRVIATARDAAGLAALRALGAEALALDVADPESIAGLGWKLDGEALDAAVYVAG   79 (222)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCCEEEEECC
T ss_conf             999994757299999999999888999999688888999884215177740589999999998623677678998166


No 40 
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]
Probab=97.39  E-value=1.1e-05  Score=56.59  Aligned_cols=111  Identities=29%  Similarity=0.386  Sum_probs=73.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC----CCC---CCCCCCCCCCCCCCCCCCCC--C
Q ss_conf             22222221134444432222212222222211122322111111-22----332---22222222111122222222--2
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-KL----GAK---HAINYLKEDFLEILQKETQG--R  213 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~l----Ga~---~vi~~~~~~~~~~i~~~t~g--~  213 (332)
                      ..+.+++|+||++|+|...+..+...|.+++-++|+++|++.+. ++    |.+   ..+|.++++-.+.+.+....  .
T Consensus         4 ~~~~~~lITGASsGIG~~~A~~lA~~g~~liLvaR~~~kL~~la~~l~~~~~v~v~vi~~DLs~~~~~~~l~~~l~~~~~   83 (265)
T COG0300           4 MKGKTALITGASSGIGAELAKQLARRGYNLILVARREDKLEALAKELEDKTGVEVEVIPADLSDPEALERLEDELKERGG   83 (265)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHHCCC
T ss_conf             77867999778864899999999977997999967699999999999873086279997767883679999999982488


Q ss_pred             CCCCCCCCCCCC----CCCCCCCC----------------------C--CCCCCCEEEEECCCCCCCCC
Q ss_conf             111222211111----12222211----------------------2--23453047983378754322
Q gi|254780290|r  214 GIDIILDMVGAE----YLNQHLTL----------------------L--SKEGKLIIISFLGGNIATEI  254 (332)
Q Consensus       214 g~Divid~~G~~----~~~~~~~~----------------------l--~~~G~iv~~G~~~~~~~~~~  254 (332)
                      .+|+.+++.|-.    ..++.++.                      +  +..|+++.+|...+..+.+.
T Consensus        84 ~IdvLVNNAG~g~~g~f~~~~~~~~~~mi~lN~~a~~~LT~~~lp~m~~~~~G~IiNI~S~ag~~p~p~  152 (265)
T COG0300          84 PIDVLVNNAGFGTFGPFLELSLDEEEEMIQLNILALTRLTKAVLPGMVERGAGHIINIGSAAGLIPTPY  152 (265)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCC
T ss_conf             523899778747766542188589999999999999999999999998658966999843453288863


No 41 
>PRK05993 short chain dehydrogenase; Provisional
Probab=97.36  E-value=1.6e-05  Score=55.60  Aligned_cols=106  Identities=19%  Similarity=0.312  Sum_probs=68.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCC----CCCCCCCCCCCCCCCCCCC
Q ss_conf             22222113444443222221222222221112232211111122332-222222221----1112222222221112222
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK-HAINYLKED----FLEILQKETQGRGIDIILD  220 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~-~vi~~~~~~----~~~~i~~~t~g~g~Divid  220 (332)
                      .++|||+||++|+|.+.++.+...|++|+++++++++.+.++.-+.+ ..+|-++++    +.+++.+..+| .+|++++
T Consensus         4 ~K~vlITGassGIG~alA~~la~~G~~V~~~~R~~~~l~~l~~~~~~~~~~Dv~d~~~v~~~v~~~~~~~~g-~id~lvN   82 (277)
T PRK05993          4 KRSILITGCSSGIGAYCAHALQKRGWRVFATCRKPEDIAALEAEGLEAFYLDYAEPESIAALVAQVLELSGG-KLDALFN   82 (277)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHCC-CEEEEEE
T ss_conf             868999256869999999999987999999979999999998489819997266779999999999998089-7069996


Q ss_pred             CCCCC---CC-----------------------CCCCCCCC--CCCCCEEEEECCCCCCC
Q ss_conf             11111---12-----------------------22221122--34530479833787543
Q gi|254780290|r  221 MVGAE---YL-----------------------NQHLTLLS--KEGKLIIISFLGGNIAT  252 (332)
Q Consensus       221 ~~G~~---~~-----------------------~~~~~~l~--~~G~iv~~G~~~~~~~~  252 (332)
                      +.|-.   .+                       +..+..++  ..|+++.++...+..+.
T Consensus        83 nAg~~~~g~~e~~~~~~~~~~~~vN~~g~~~~~~~~lP~m~~~~~G~IVnisSi~g~~~~  142 (277)
T PRK05993         83 NGAYGQPGAVEDLPVEALRAQFEANFFGWHDLTRRIIPVMRKQGHGRIVQCSSILGLVPM  142 (277)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHCCCC
T ss_conf             664356770888679999999887018999999997233134898389998884448889


No 42 
>PRK05693 short chain dehydrogenase; Provisional
Probab=97.31  E-value=1.5e-05  Score=55.86  Aligned_cols=104  Identities=28%  Similarity=0.377  Sum_probs=68.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC----CCCCCCCCCCCCCCCCCCCC
Q ss_conf             22221134444432222212222222211122322111111223322-22222221----11122222222211122221
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKH-AINYLKED----FLEILQKETQGRGIDIILDM  221 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~-vi~~~~~~----~~~~i~~~t~g~g~Divid~  221 (332)
                      +.+||+||++|+|.+..+-+...|++|+++++++++.+.+++-+... .+|-++++    +.+++.+..  .++|+++++
T Consensus         2 KvvlITGassGIG~alA~~la~~G~~V~~~~R~~~~l~~l~~~~~~~~~~Dvtd~~~i~~~~~~~~~~~--g~iDiLVNN   79 (274)
T PRK05693          2 PVVLITGCSSGIGRALADAFKAAGYEVWATARKAEDVEALAAAGFTAVQLDVNDGAALARLAEELEAEH--QGLDVLINN   79 (274)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHC--CCCCEEEEC
T ss_conf             989994888589999999999879999999799999999984899189984699899999999999972--997689988


Q ss_pred             CCCCC---CC-----------------------CCCCCCC-CCCCCEEEEECCCCCCC
Q ss_conf             11111---22-----------------------2221122-34530479833787543
Q gi|254780290|r  222 VGAEY---LN-----------------------QHLTLLS-KEGKLIIISFLGGNIAT  252 (332)
Q Consensus       222 ~G~~~---~~-----------------------~~~~~l~-~~G~iv~~G~~~~~~~~  252 (332)
                      .|-..   ++                       ..+.+|+ .+|+++.++...+....
T Consensus        80 AG~~~~g~~~~~~~~~~~~~~~vN~~g~~~~~~~~lP~m~~~~G~IVnisS~ag~~~~  137 (274)
T PRK05693         80 AGYGAMGPLLDGGVEAMRRQFETNVFAVVGVTRALFPLLRRSRGLVVNIGSVSGVLVT  137 (274)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHCCCC
T ss_conf             8677887589876899999999981999999999999997589679998140532689


No 43 
>PRK06182 short chain dehydrogenase; Validated
Probab=97.31  E-value=1.6e-05  Score=55.58  Aligned_cols=105  Identities=28%  Similarity=0.426  Sum_probs=68.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCC----CCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111223322-222222211----11222222222111222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKH-AINYLKEDF----LEILQKETQGRGIDIIL  219 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~-vi~~~~~~~----~~~i~~~t~g~g~Divi  219 (332)
                      +++++||+||++|+|...++.+...|++|++++++.++.+.+.+.|++. .+|-++++-    .+++.+.. | ++|+.+
T Consensus         2 k~Kv~lITGassGIG~a~a~~la~~G~~V~~~~r~~~~l~~l~~~~~~~~~~Dvt~~~~v~~~~~~i~~~~-g-~iDiLV   79 (273)
T PRK06182          2 KKKVALVTGASSGIGKATARKLIAEGFTVYGAARRVDKMEDLASLGIHPLALDVTDEASMKAAVATILAEE-G-RIDVLV   79 (273)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHH-C-CCCEEE
T ss_conf             46989990632099999999999879989999798999999996799799985899999999999999983-9-988775


Q ss_pred             CCCCCCC---CC-----------------------CCCCCCC--CCCCCEEEEECCCCCC
Q ss_conf             2111111---22-----------------------2221122--3453047983378754
Q gi|254780290|r  220 DMVGAEY---LN-----------------------QHLTLLS--KEGKLIIISFLGGNIA  251 (332)
Q Consensus       220 d~~G~~~---~~-----------------------~~~~~l~--~~G~iv~~G~~~~~~~  251 (332)
                      ++.|...   ++                       ..+..|+  .+|+++.++...+...
T Consensus        80 NNAG~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~ag~~~  139 (273)
T PRK06182         80 NNAGYGSYGAIEDVPIDEARAQFEVNLFGAARLTQLVLPHMRAQRSGRIINITSMGGKIY  139 (273)
T ss_pred             ECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHCCC
T ss_conf             058677787488731999999999886999999998533421489958999868444077


No 44 
>PRK08306 dipicolinate synthase subunit A; Reviewed
Probab=97.25  E-value=8e-05  Score=51.00  Aligned_cols=181  Identities=16%  Similarity=0.166  Sum_probs=105.3

Q ss_pred             EECCCCCCCCCCCCCCC---------CCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             00330002322222212---------222223333221122333332211-11111222222232221222222333222
Q gi|254780290|r   66 ILGLEVAGKIVDLGENT---------THWNIGDEVCALVNGGGYAEYCLS-HQGHTLPIPKGYNAIQAASLPESFFTVWA  135 (332)
Q Consensus        66 v~G~e~~G~V~~vG~~v---------~~~~~GdrV~~~~~~G~~ae~~~~-~~~~~~~iP~~~s~~~aa~l~~~~~tA~~  135 (332)
                      +||..--|.|...-++-         ...++|.-|++    |...+|..- -+..=+++=+-+..++.| +--+..||-.
T Consensus        63 vpg~~d~g~i~~~~~~~~~~l~~~~~~~l~~~~~vf~----G~~~~~l~~~~~~~~~~~~d~~e~d~vA-i~NaipTAEG  137 (296)
T PRK08306         63 VPGTNDEGEVDTVFSNEKLVLTKELLEKTPEHCTIFS----GIANPYLKELAETTGRKLIELFERDDVA-IYNSIPTAEG  137 (296)
T ss_pred             CCCCCCCCEEECCCCCCCCCHHHHHHHHCCCCCEEEE----ECCCHHHHHHHHHCCCCEEEEECCCHHH-HHCCCCCHHH
T ss_conf             8322589638553467876322999974699987999----5599899999997598367620020355-5627014899


Q ss_pred             CCCCCCC---CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1112222---22-2222221134444432222212222222211122322111111223322222222211112222222
Q gi|254780290|r  136 NLFQTAN---LR-SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQ  211 (332)
Q Consensus       136 ~l~~~~~---~~-~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~  211 (332)
                      ++...-+   +. .|.+++|.| -|-+|..+.+.++.+|++|.+.+++++.+..++++|..- +..+  ++.+.+.    
T Consensus       138 ai~~ai~~tp~ti~gs~~lVlG-~Gr~G~~lA~~l~~lGA~V~V~aR~~~~~a~a~~~G~~~-v~~~--~L~~~~~----  209 (296)
T PRK08306        138 AIMMAIEHTPITIHGSNVLVLG-FGRTGMTLARTLKALGAKVKVGARKSAHLARITEMGYSP-VHLS--ELAEEVG----  209 (296)
T ss_pred             HHHHHHHCCCCCCCCCCEEEEC-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEE-EEHH--HHHHHHC----
T ss_conf             9999996599632476589989-868999999999977996999979999999999769858-7199--9997735----


Q ss_pred             CCCCCCCCCCCCCCCC-CCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCE
Q ss_conf             2211122221111112-22221122345304798337875432224334305321
Q gi|254780290|r  212 GRGIDIILDMVGAEYL-NQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRIT  265 (332)
Q Consensus       212 g~g~Divid~~G~~~~-~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~  265 (332)
                        .+|++|+++-...+ +..++.++++..++.+....|.    +++...-..+++
T Consensus       210 --~~D~i~NTIPa~Vlt~~~l~~~~~~avIIDLAS~PGG----~Df~~A~~~Gik  258 (296)
T PRK08306        210 --EADIIFNTIPALVLTKNVLSKMPPHALIIDLASKPGG----TDFEYAKKLGIK  258 (296)
T ss_pred             --CCCEEEECCCHHHCCHHHHHCCCCCCEEEEECCCCCC----CCHHHHHHHCCE
T ss_conf             --6999998985254399999418999699994779997----388999983985


No 45 
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional
Probab=97.25  E-value=0.00021  Score=48.30  Aligned_cols=148  Identities=16%  Similarity=0.182  Sum_probs=87.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC-------------CCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112233222-222222-------------1111222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHA-INYLKE-------------DFLEILQKET  210 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~v-i~~~~~-------------~~~~~i~~~t  210 (332)
                      |.-+|+|.| +|-.|+.|+..|+.+|+.|.+.+.+++..+.++++|++.+ +++.++             ++.+.-+++.
T Consensus       164 pPAkVlViG-aGVAGlqAi~tA~~LGA~V~a~DvR~~~~EqveSlGa~fv~v~~~e~~~~~gGYAk~~s~e~~~~q~~~~  242 (510)
T PRK09424        164 PPAKVLVIG-AGVAGLAAIGAAGSLGAIVRAFDTRPEVKEQVESMGAEFLELDFEEEGGSGDGYAKVMSEEFIKAEMALF  242 (510)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             885289974-6477799999996279789996587889999997067425521010244578503545678999999999


Q ss_pred             C--CCCCCCCCCCCC---CC----CCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHH-H-CCCCEEEEEEECCCHHCCH
Q ss_conf             2--221112222111---11----1222221122345304798337875432224334-3-0532167775124000113
Q gi|254780290|r  211 Q--GRGIDIILDMVG---AE----YLNQHLTLLSKEGKLIIISFLGGNIATEINLNPI-I-SKRITITGSTLRRRTDIAK  279 (332)
Q Consensus       211 ~--g~g~Divid~~G---~~----~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~-~-~~~~~i~g~~~~~~~~~~~  279 (332)
                      .  =+.+|+||-+.-   ..    ..+..++.|++|+.++.+..-.|....-.-+.+. . .++.++.|...  ....-+
T Consensus       243 ~e~~~~aDiVItTalIPG~~AP~LIt~emV~~MKpGSVIVDlAadqGGN~E~T~pge~~~~~~GV~iiG~~n--lps~~~  320 (510)
T PRK09424        243 AEQAKEVDIIITTALIPGKPAPKLITKEMVDSMKPGSVIVDLAAANGGNCELTVPGEVVVTDNGVKIIGYTD--LPSRLP  320 (510)
T ss_pred             HHHHHHCCEEEEEEECCCCCCCEECCHHHHHHCCCCCEEEEECCCCCCCCCCCCCCEEEEECCCEEEECCCC--HHCCCH
T ss_conf             999742477998654189989970379999526999789995255799710663994899419969988885--110377


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             7899999999999998
Q gi|254780290|r  280 QSIRDSLQLKIWPLLN  295 (332)
Q Consensus       280 ~~~~~~~~~~~~~~i~  295 (332)
                      .+........+..++.
T Consensus       321 ~~aS~lya~Ni~~~l~  336 (510)
T PRK09424        321 TQSSQLYGTNLVNLLK  336 (510)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             8999999999999999


No 46 
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. This family consist of Cyclopropane-fatty-acyl-phospholipid synthase or CFA synthase EC:2.1.1.79 this enzyme catalyse the reaction: S-adenosyl-L-methionine + phospholipid olefinic fatty acid <= S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.
Probab=97.23  E-value=3.3e-05  Score=53.60  Aligned_cols=101  Identities=21%  Similarity=0.339  Sum_probs=71.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1112222222222221134444432222212222222211122322111111----223322222222211112222222
Q gi|254780290|r  136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL----KLGAKHAINYLKEDFLEILQKETQ  211 (332)
Q Consensus       136 ~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~----~lGa~~vi~~~~~~~~~~i~~~t~  211 (332)
                      .+.+++++++|++||=+| | |-|.++..+|+..|++|++++.|++..+.++    +.|....++..-.|+.+    . .
T Consensus        53 ~i~~~l~l~~g~~vLDiG-C-GWG~~a~~~a~~~g~~v~giTlS~~Q~~~~~~r~~~~gl~~~v~v~~~Dyrd----~-~  125 (273)
T pfam02353        53 LILDKLGLKPGMTLLDIG-C-GWGGLMRRAAERYDVNVVGLTLSKNQYKLARQRVAAEGLQRKVEVLLQDYRD----F-D  125 (273)
T ss_pred             HHHHHCCCCCCCEEEEEC-C-CCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCCEEECCHHH----C-C
T ss_conf             999865889999899978-8-8089999999847951899979789999999999870874321200062654----7-6


Q ss_pred             CCCCCCCC-----CCCCCC----CCCCCCCCCCCCCCCEEEE
Q ss_conf             22111222-----211111----1222221122345304798
Q gi|254780290|r  212 GRGIDIIL-----DMVGAE----YLNQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       212 g~g~Divi-----d~~G~~----~~~~~~~~l~~~G~iv~~G  244 (332)
                       ..+|.|+     +.+|..    .++...++|+++|+++.-.
T Consensus       126 -~~fD~IvSiem~Ehvg~~~~~~~f~~i~~~LkpgG~~~iq~  166 (273)
T pfam02353       126 -EPFDRIVSVGMFEHVGHENYDTFFKKLYNLLPPGGLMLLHT  166 (273)
T ss_pred             -CCCCEEEEEHHHHHCCHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             -66666776516876287779999999998658897399999


No 47 
>PRK08177 short chain dehydrogenase; Provisional
Probab=97.18  E-value=2.5e-05  Score=54.32  Aligned_cols=77  Identities=25%  Similarity=0.303  Sum_probs=55.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22221134444432222212222222211122322111111223322--222222211112222222221112222111
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKH--AINYLKEDFLEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~--vi~~~~~~~~~~i~~~t~g~g~Divid~~G  223 (332)
                      +++||+||++|+|.+.++-+...|++|+++++++++.+.++++...+  .+|-++.+-.+.+.+...+..+|+++++.|
T Consensus         2 K~~lITGas~GIG~aia~~l~~~G~~V~~~~R~~~~~~~~~~~~~~~~~~~D~~~~~~i~~~~~~~~~~~iDvlinNAG   80 (225)
T PRK08177          2 RTALIIGASRGLGLGLVDRLLERGWQVTATVRGPQQDTALQALPGVHIERLDMNDPASLDQLLQRLQGQRFDLLFVNAG   80 (225)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCCCEEEECCC
T ss_conf             9899927342999999999998869999997988778998725487289984588899999999960677888998784


No 48 
>PRK09072 short chain dehydrogenase; Provisional
Probab=97.12  E-value=2.4e-05  Score=54.45  Aligned_cols=106  Identities=22%  Similarity=0.285  Sum_probs=66.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC----CCCCCCCCCCCCCCCC-CCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-1223322----2222222111122222-222211122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKH----AINYLKEDFLEILQKE-TQGRGIDII  218 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~----vi~~~~~~~~~~i~~~-t~g~g~Div  218 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.+++++++++.+ +++....    ..|-++++-.+.+.+. ....++|++
T Consensus         4 ~~K~vlITGassGIG~a~A~~la~~G~~vil~~R~~~~L~~~~~~l~~~~~~~~~~Dls~~~~~~~~~~~~~~~g~iDiL   83 (262)
T PRK09072          4 KDKRVLLTGASGGIGEALAEALCAAGARLLLVGRNAEKLEALAARPYPGRVRWVVADLTSEAGREAVLARAREMGGINVL   83 (262)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             99889994862399999999999879989999898999999999845897699997179999999999999984999899


Q ss_pred             CCCCCCCC---CC-----------------------CCCCCCC--CCCCCEEEEECCCCC
Q ss_conf             22111111---22-----------------------2221122--345304798337875
Q gi|254780290|r  219 LDMVGAEY---LN-----------------------QHLTLLS--KEGKLIIISFLGGNI  250 (332)
Q Consensus       219 id~~G~~~---~~-----------------------~~~~~l~--~~G~iv~~G~~~~~~  250 (332)
                      +++.|...   ++                       ..+..++  .+|+++.++...+..
T Consensus        84 InNAG~~~~~~~~~~~~~~~~~~~~vN~~g~~~lt~~~lp~m~~~~~G~IvnisS~ag~~  143 (262)
T PRK09072         84 INNAGVNHFALLDQQDPEAIDRLLALNLTAPMQLTRALLPLLRAQPSAAVVNVGSTFGSI  143 (262)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHC
T ss_conf             989977889863549999999999995689999999999999876994899966866625


No 49 
>PRK08263 short chain dehydrogenase; Provisional
Probab=97.01  E-value=5.1e-05  Score=52.31  Aligned_cols=103  Identities=25%  Similarity=0.338  Sum_probs=65.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC---CCCCCCCCC----CCCCCCCCCCCCCCC
Q ss_conf             22222113444443222221222222221112232211111-1223322---222222211----112222222221112
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKH---AINYLKEDF----LEILQKETQGRGIDI  217 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~---vi~~~~~~~----~~~i~~~t~g~g~Di  217 (332)
                      |+++||+||++|+|...++.+...|++|+.++++.++++.+ +++|...   ..|-++++-    .+++.+..  .++|+
T Consensus         3 gKv~lITGassGIG~a~A~~la~~G~~Vv~~~R~~~~l~~l~~~~~~~~~~~~~Dvtd~~~v~~~v~~~~~~~--G~iDi   80 (275)
T PRK08263          3 GKVWFITGASRGFGREWTEAALERGDRVVATARDTATLADLAERYGDALLPLALDVTDRAAVFAAVEQAVKHF--GRLDI   80 (275)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHH--CCCCE
T ss_conf             9989994674399999999999879989999798999999999759967999964899999999999999984--99878


Q ss_pred             CCCCCCCCC---C-----------------------CCCCCCCC--CCCCCEEEEECCCCC
Q ss_conf             222111111---2-----------------------22221122--345304798337875
Q gi|254780290|r  218 ILDMVGAEY---L-----------------------NQHLTLLS--KEGKLIIISFLGGNI  250 (332)
Q Consensus       218 vid~~G~~~---~-----------------------~~~~~~l~--~~G~iv~~G~~~~~~  250 (332)
                      ++++.|...   +                       +..++.|+  .+|+++.++...+..
T Consensus        81 LVNNAG~~~~~~~~e~~~~~~~~~~~vNl~g~~~~~~a~lp~m~~~~~G~IvnisS~ag~~  141 (275)
T PRK08263         81 VVNNAGYGLFGMIEEVTESEARAQIDTNVFGALWVTQAVLPYLRAQRSGHIIQISSIGGIS  141 (275)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCEEEEECCHHHCC
T ss_conf             9988866788874769999999999986199999876426133516997799945701056


No 50 
>PRK06500 short chain dehydrogenase; Provisional
Probab=96.98  E-value=5.1e-05  Score=52.34  Aligned_cols=180  Identities=17%  Similarity=0.217  Sum_probs=93.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC---CCCCCCC----CCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-12233222---2222221----111222222222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKHA---INYLKED----FLEILQKETQGRGID  216 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~v---i~~~~~~----~~~~i~~~t~g~g~D  216 (332)
                      .|++++|+||++|+|...++.+...|++|+.+.+++++.+.+ +++|.+..   .|-++.+    +.+.+.+..  .++|
T Consensus         5 ~gK~~lITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~Dv~~~~~~~~~~~~~~~~~--g~iD   82 (249)
T PRK06500          5 QGKTALITGGTSGIGLETARQFAAEGARVAITGRDAATLEAARAELGEDALVIRNDAGSVAAQRALAQALAEAG--GRLD   82 (249)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHC--CCCC
T ss_conf             99889993768789999999999879999999699899999999858975999951799999999999999976--9998


Q ss_pred             CCCCCCCCCC-----------C---------------CCCCCCCCCCCCCEEEEECCCCCCCCCC---------------
Q ss_conf             2222111111-----------2---------------2222112234530479833787543222---------------
Q gi|254780290|r  217 IILDMVGAEY-----------L---------------NQHLTLLSKEGKLIIISFLGGNIATEIN---------------  255 (332)
Q Consensus       217 ivid~~G~~~-----------~---------------~~~~~~l~~~G~iv~~G~~~~~~~~~~~---------------  255 (332)
                      +.+++.|...           |               +..++.++.+|.++.++...+....+..               
T Consensus        83 iLvnnAG~~~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~p~m~~~g~iI~~sS~~~~~~~~~~~aY~asKaal~~ltk  162 (249)
T PRK06500         83 AVFINAGVAKFAPLEDWDEAMFDRSFNTNVKGPYFLIQALLPLLNNPASIVLNGSINAHIGMPNSSVYAASKAALLSLAK  162 (249)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             99989987899991669999999999986456999999999986229818998223076168973778999999999999


Q ss_pred             --CCHHHCCCCEEEEEEECCCHHCCH-HHH--HHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CCCCE
Q ss_conf             --433430532167775124000113-789--9999999999998698310212474189999999999829---98132
Q gi|254780290|r  256 --LNPIISKRITITGSTLRRRTDIAK-QSI--RDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EHIGK  327 (332)
Q Consensus       256 --~~~~~~~~~~i~g~~~~~~~~~~~-~~~--~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~~GK  327 (332)
                        ..++-.+++++....-+... ... ...  ...-.+++.+.+.+  ..| ..+.-..+|+.++.-.|.+-   -.+|-
T Consensus       163 ~lA~E~a~~gIrVNaIaPG~i~-T~~~~~~~~~~~~~~~~~~~~~~--~iP-l~R~g~peeia~~v~fL~S~~as~iTG~  238 (249)
T PRK06500        163 TLSGELLPRGIRVNAVSPGPVQ-TPLYGKLGLSEADLEATAAQIQG--LVP-LGRFGTPEEIAKAVVFLASDESAFIVGS  238 (249)
T ss_pred             HHHHHHCCCCEEEEEEEECCCC-CHHHHHCCCCHHHHHHHHHHHHH--CCC-CCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             9999965049599999778897-73355317980105999999983--799-9998599999999999958742281486


Q ss_pred             EEE
Q ss_conf             898
Q gi|254780290|r  328 IIL  330 (332)
Q Consensus       328 vVi  330 (332)
                      ++.
T Consensus       239 ~i~  241 (249)
T PRK06500        239 EII  241 (249)
T ss_pred             EEE
T ss_conf             388


No 51 
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=96.89  E-value=0.00062  Score=45.14  Aligned_cols=181  Identities=18%  Similarity=0.203  Sum_probs=90.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC----CCCCCCCCCCCC---CCCCCC----CCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322-11----111122332222---222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE-KC----LACLKLGAKHAI---NYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~-~~----~~~~~lGa~~vi---~~~~~~----~~~~i~~~t~g  212 (332)
                      .|+++||+||++++|.+.+.-+...|++|+...++.+ ..    +.+++.|.+...   |-++.+    +.+++.+..  
T Consensus         2 ~gKvalITGgs~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~--   79 (249)
T PRK06077          2 KDKVVVVTGSGRGIGRAIAVRLAKEGAKVVVNAKKRAEEMNETLRMVKEYGGEGIGVLADVSTREGCRTLAKAALDNF--   79 (249)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH--
T ss_conf             619899926367899999999998799899984887689999999999759958999847999999999999999981--


Q ss_pred             CCCCCCCCCCCCC----C----------------------CCCCCCCCCCCCCCEEEEECCCCCCCCC------------
Q ss_conf             2111222211111----1----------------------2222211223453047983378754322------------
Q gi|254780290|r  213 RGIDIILDMVGAE----Y----------------------LNQHLTLLSKEGKLIIISFLGGNIATEI------------  254 (332)
Q Consensus       213 ~g~Divid~~G~~----~----------------------~~~~~~~l~~~G~iv~~G~~~~~~~~~~------------  254 (332)
                      .+.|+.+++.|..    .                      .+..++.|+.+|+++.++...+..+.+-            
T Consensus        80 g~iDiLVnNAG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~~G~IInisS~~~~~~~~~~~~Y~asKaal~  159 (249)
T PRK06077         80 GVVDILVNNAGLGLFSPFLNADDRLIEKHISTDLKSVIYCSQEAAKVMREGGEIINIASIAGIRPFVGLSIYGAMKAAVI  159 (249)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHCCCCCCCHHHHHHHHHHH
T ss_conf             99888998577578875010999999999988621899999999999616978998267654568999778999999999


Q ss_pred             C----CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC-CCCEEE
Q ss_conf             2----43343053216777512400011378999999999999986983102124741899999999998299-813289
Q gi|254780290|r  255 N----LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE-HIGKII  329 (332)
Q Consensus       255 ~----~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~-~~GKvV  329 (332)
                      .    +..-+..++++....-+...-.......+.......+.....   +...+.-.-+|+.++...|.+-. .+|-++
T Consensus       160 ~ltr~lA~ela~~IrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~---~~~~R~~~peeia~~v~fLas~~~iTGq~i  236 (249)
T PRK06077        160 NLTQYLALELAPRIRVNAVAPGVVKTKMGESLVKLLGMTEEEFAKKH---TLTGKILDPEDVAELVWALVKIESITGQVI  236 (249)
T ss_pred             HHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHCCCCCHHHHHHCC---CCCCCCCCHHHHHHHHHHHHCCCCCCCCEE
T ss_conf             99999999986998899998468987425555540486789998607---987897399999999999964589998838


Q ss_pred             E
Q ss_conf             8
Q gi|254780290|r  330 L  330 (332)
Q Consensus       330 i  330 (332)
                      .
T Consensus       237 ~  237 (249)
T PRK06077        237 V  237 (249)
T ss_pred             E
T ss_conf             8


No 52 
>PRK06914 short chain dehydrogenase; Provisional
Probab=96.88  E-value=4.9e-05  Score=52.44  Aligned_cols=107  Identities=21%  Similarity=0.289  Sum_probs=65.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCC-----CCCCCCCCCCCCCCCCC-CCCCC
Q ss_conf             2222211344444322222122222222111223221111112----23322-----22222221111222222-22211
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK----LGAKH-----AINYLKEDFLEILQKET-QGRGI  215 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~----lGa~~-----vi~~~~~~~~~~i~~~t-~g~g~  215 (332)
                      ++.+||+||++|+|.+.++.+...|++|+++++++++.+.+.+    .+...     .+|-++++-.+.+.+.. .-..+
T Consensus         3 ~K~alITGassGIG~a~A~~la~~G~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~Dvtd~~~v~~~~~~~~~~g~i   82 (280)
T PRK06914          3 KKIAIITGASSGFGLLTTLELAKKDYLVIATMRNLEKQENLISQAAQLNLSQNIKVQQLDVTDQNSIHNFQLFLKEYGRI   82 (280)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             19899907344999999999998799899998988999999999996499976699968899999999999999982998


Q ss_pred             CCCCCCCCCC---CCC-----------------------CCCCCCC--CCCCCEEEEECCCCCCC
Q ss_conf             1222211111---122-----------------------2221122--34530479833787543
Q gi|254780290|r  216 DIILDMVGAE---YLN-----------------------QHLTLLS--KEGKLIIISFLGGNIAT  252 (332)
Q Consensus       216 Divid~~G~~---~~~-----------------------~~~~~l~--~~G~iv~~G~~~~~~~~  252 (332)
                      |+.+++.|..   .++                       ..+..|+  .+|+++.++...+....
T Consensus        83 DvLVNNAG~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~~g~~~~  147 (280)
T PRK06914         83 DLLVNNAGYANGGFVEEIPVEEYRKQFETNVFGAISVTQAVLPYMRKQKSGKIINISSISGQVGF  147 (280)
T ss_pred             CEEEECCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCC
T ss_conf             78997886677874211779999999987128999899999787775699589998341332689


No 53 
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=96.82  E-value=0.00077  Score=44.53  Aligned_cols=177  Identities=20%  Similarity=0.258  Sum_probs=88.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC----CCCCCCCC---CCCCCCCC----CCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122-3221111----11223322---22222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK-SEEKCLA----CLKLGAKH---AINYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~-~~~~~~~----~~~lGa~~---vi~~~~~~----~~~~i~~~t~g  212 (332)
                      .|+++||+||++++|...++.....|++|+.+.+ ++++.+.    +++.|.+.   ..|-++++    +.+.+.+..+ 
T Consensus         4 ~gK~vlITGgs~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~g-   82 (247)
T PRK05565          4 MGKVAIVTGASGGIGRAIAELLAKEGAKVVIAYDKNEEAANELLEEIKEVGGDAIAVKADVSSEDDVENLVEQIVEKFG-   82 (247)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC-
T ss_conf             9988999378458999999999987998999817998999999999996399089998358999999999999999809-


Q ss_pred             CCCCCCCCCCCCCC-----------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC---------
Q ss_conf             21112222111111-----------22---------------222112--234530479833787543222---------
Q gi|254780290|r  213 RGIDIILDMVGAEY-----------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN---------  255 (332)
Q Consensus       213 ~g~Divid~~G~~~-----------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~---------  255 (332)
                       ++|+++++.|...           |+               ..++.|  +.+|+++.++...+....+-.         
T Consensus        83 -~iD~lVnnAg~~~~~~~~~~~~~~~~~~~~~Nl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~~~~~~~Y~asKaa  161 (247)
T PRK05565         83 -KIDILVNNAGISKFGLVTDMTDEEWDRVINVNLTGVMRLTRYALPIMIKRGSGVIVNISSIWGLIGASCEVLYSASKGA  161 (247)
T ss_pred             -CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
T ss_conf             -9849998998789999155999999999998547899999985798875699759997351225789983388999999


Q ss_pred             ---C-----CHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC---CCC
Q ss_conf             ---4-----33430532167775124000113789999999999999869831021247418999999999982---998
Q gi|254780290|r  256 ---L-----NPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK---SEH  324 (332)
Q Consensus       256 ---~-----~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~---g~~  324 (332)
                         +     .++-..++++....-+...-.........   +. +.+.+  ..|. .+.-..+|+.++...|.+   +..
T Consensus       162 l~~ltr~lA~e~~~~gIrvN~V~PG~~~T~~~~~~~~~---~~-~~~~~--~~p~-~R~~~p~dva~~v~fL~s~~s~~i  234 (247)
T PRK05565        162 VNAFTKALAKELAPSGIRVNAIAPGAIETEMNSSFSEE---DK-EGLAE--EIPL-GRLGEPEEIAKVVLFLASDDASYI  234 (247)
T ss_pred             HHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHH---HH-HHHHH--CCCC-CCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             99999999999543094999996098957421004977---89-99985--5998-899399999999999968622185


Q ss_pred             CCEEEE
Q ss_conf             132898
Q gi|254780290|r  325 IGKIIL  330 (332)
Q Consensus       325 ~GKvVi  330 (332)
                      +|-++.
T Consensus       235 tG~~i~  240 (247)
T PRK05565        235 TGQIIT  240 (247)
T ss_pred             CCCEEE
T ss_conf             686487


No 54 
>PRK08017 short chain dehydrogenase; Provisional
Probab=96.79  E-value=8.3e-05  Score=50.90  Aligned_cols=76  Identities=21%  Similarity=0.232  Sum_probs=52.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC----CCCCCCCCCCCCCCCCCC
Q ss_conf             22221134444432222212222222211122322111111223322-2222222111----122222222211122221
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKH-AINYLKEDFL----EILQKETQGRGIDIILDM  221 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~-vi~~~~~~~~----~~i~~~t~g~g~Divid~  221 (332)
                      +++||+||++|+|.+.++.+...|++|+.+++++++.+.+++.|.+. .+|.++.+-.    +++.+...+ ..|+++++
T Consensus         3 K~vlITGassGIG~a~A~~la~~G~~V~~~~r~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~~~g-~id~linn   81 (256)
T PRK08017          3 KSVLITGCSSGIGLESALELKRQGFRVLAGCRKPDDVARMNSMGFTGVLIDLDSPESVDRAADEVIALTDN-RLYGIFNN   81 (256)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHCC-CEEEEEEC
T ss_conf             78999658768999999999987999999969989999998569946998358989999999999998489-74899988


Q ss_pred             CC
Q ss_conf             11
Q gi|254780290|r  222 VG  223 (332)
Q Consensus       222 ~G  223 (332)
                      .|
T Consensus        82 AG   83 (256)
T PRK08017         82 AG   83 (256)
T ss_pred             CC
T ss_conf             96


No 55 
>KOG1014 consensus
Probab=96.78  E-value=0.00014  Score=49.41  Aligned_cols=80  Identities=29%  Similarity=0.401  Sum_probs=60.5

Q ss_pred             CCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCC-C----CCC---CCCCCCCCCCC-CCCCCCCCCCC
Q ss_conf             22222221134444432-222212222222211122322111111-2----233---22222222211-11222222222
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGT-TAIQLASYFGATVYTTAKSEEKCLACL-K----LGA---KHAINYLKEDF-LEILQKETQGR  213 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~-~a~qla~~~G~~vi~~~~~~~~~~~~~-~----lGa---~~vi~~~~~~~-~~~i~~~t~g~  213 (332)
                      +.|+|.+|+||+.|+|- .|-++|+ +|.+|+-+.|+++|++.++ +    .++   ..++|+.+++. .+.+++.+.+.
T Consensus        47 ~~g~WAVVTGaTDGIGKayA~eLAk-rG~nvvLIsRt~~KL~~v~kEI~~~~~vev~~i~~Dft~~~~~ye~i~~~l~~~  125 (312)
T KOG1014          47 KLGSWAVVTGATDGIGKAYARELAK-RGFNVVLISRTQEKLEAVAKEIEEKYKVEVRIIAIDFTKGDEVYEKLLEKLAGL  125 (312)
T ss_pred             HCCCEEEEECCCCCCHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             4697799977888522999999997-598799996888999999999988758079999986489815689999886278


Q ss_pred             CCCCCCCCCCC
Q ss_conf             11122221111
Q gi|254780290|r  214 GIDIILDMVGA  224 (332)
Q Consensus       214 g~Divid~~G~  224 (332)
                      .+.+.++++|-
T Consensus       126 ~VgILVNNvG~  136 (312)
T KOG1014         126 DVGILVNNVGM  136 (312)
T ss_pred             CEEEEEECCCC
T ss_conf             64899965531


No 56 
>PRK07201 short chain dehydrogenase; Provisional
Probab=96.78  E-value=8.9e-05  Score=50.71  Aligned_cols=77  Identities=25%  Similarity=0.358  Sum_probs=53.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111----2233222---2222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL----KLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~----~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+.++|+||++|+|.+...-+...|++|+.++++.++++.++    +.|.+..   .|-++.+    +.+++.+..  .
T Consensus       375 ~GKvalITGASSGIG~A~A~~LA~~GA~Vvl~AR~~e~Le~v~~ei~~~Gg~a~~~~~DVtd~~~v~~lv~~i~~~~--G  452 (663)
T PRK07201        375 EGKHVIITGASSGIGRATAIKVAEAGATVFALARDGEKLDELVAEIRARGGQAHAYTCDLTDSASVEHTVKDILGRH--G  452 (663)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHC--C
T ss_conf             99479993887599999999999879989999899999999999999559918999962799999999999999967--9


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      ++|+.+++.|
T Consensus       453 ~IDVLVNNAG  462 (663)
T PRK07201        453 HVDYLVNNAG  462 (663)
T ss_pred             CCCEEEECCC
T ss_conf             9888998964


No 57 
>PRK06101 short chain dehydrogenase; Provisional
Probab=96.73  E-value=0.00011  Score=50.21  Aligned_cols=44  Identities=25%  Similarity=0.228  Sum_probs=35.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22221134444432222212222222211122322111111223
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLG  190 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lG  190 (332)
                      ++|||+||++|+|...++.....|++|+.+++++++.+.+.+.+
T Consensus         2 ktvlITGassGIG~a~A~~la~~G~~Vi~~~R~~~~l~~~~~~~   45 (241)
T PRK06101          2 TSVLITGATSGIGKQLALDYAKAGWKVIACGRNEAVLDELHDQS   45 (241)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC
T ss_conf             98999224049999999999987998999989999999999732


No 58 
>PRK07109 short chain dehydrogenase; Provisional
Probab=96.69  E-value=1e-04  Score=50.38  Aligned_cols=106  Identities=19%  Similarity=0.207  Sum_probs=67.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCCCC----CCCCCCCCC
Q ss_conf             2222222113444443222221222222221112232211111----12233222---222222111----122222222
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKEDFL----EILQKETQG  212 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~~~----~~i~~~t~g  212 (332)
                      -.++.|+|+||++|+|....+.+...|++|+.+++++++++.+    ++.|.+..   .|-++.+-.    +.+.+..+ 
T Consensus         6 l~~KvVvITGASsGIGra~A~~fA~~Ga~Vvl~aR~~~~L~~~a~e~~~~G~~~~~~~~DVsd~~~v~~~~~~~~~~~G-   84 (338)
T PRK07109          6 LGRQVVVITGASAGVGRATARAFARRGAKVVLLARGEEGLEGLAAEIRAAGGEALAVVADVADAEAVQAAADRAEEELG-   84 (338)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHHHHC-
T ss_conf             6989899948434999999999998799899998999999999999996398189998017999999999999999849-


Q ss_pred             CCCCCCCCCCCCCCCC--------------------------CCCCCCC--CCCCCEEEEECCCCCC
Q ss_conf             2111222211111122--------------------------2221122--3453047983378754
Q gi|254780290|r  213 RGIDIILDMVGAEYLN--------------------------QHLTLLS--KEGKLIIISFLGGNIA  251 (332)
Q Consensus       213 ~g~Divid~~G~~~~~--------------------------~~~~~l~--~~G~iv~~G~~~~~~~  251 (332)
                       ++|+.+++.|...+.                          .++..|+  .+|+++.++...+...
T Consensus        85 -~IDvlVNNAGi~~~g~~~~~~~e~~~~vi~vNl~G~v~~t~aaLp~m~~~~~G~IInvsSvag~~~  150 (338)
T PRK07109         85 -PIDTWVNNAMVTVFGPFEDVTPEEFRRVTDVTYLGVVHGTLAALRHMRPRDRGAIIQVGSALAYRS  150 (338)
T ss_pred             -CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC
T ss_conf             -988886546667787632299999999987751899999999999998679978999889555457


No 59 
>PRK05872 short chain dehydrogenase; Provisional
Probab=96.67  E-value=0.00011  Score=50.02  Aligned_cols=173  Identities=19%  Similarity=0.248  Sum_probs=91.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC---CCCCCCCC----CCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-1223322---22222221----111222222222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKH---AINYLKED----FLEILQKETQGRGID  216 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~---vi~~~~~~----~~~~i~~~t~g~g~D  216 (332)
                      .|++++|+||++|+|.+..+.+...|++|+.+++++++.+.+ .++|...   ..|-++.+    +.+++.+..+  ++|
T Consensus         8 ~gKvalITGassGIG~aiA~~la~~Ga~Vvl~dr~~~~l~~~~~~lg~~~~~~~~DVtd~~~v~~~v~~i~~~~G--~iD   85 (296)
T PRK05872          8 DGKVVFVTGAARGVGAELARRLHARGAKVALVDLEEAELAALAAELGDRVLTVVADVTDLAAMQAAAEEAVERFG--GID   85 (296)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHC--CCC
T ss_conf             998799927105899999999998799899998999999999998388738999827999999999999999719--987


Q ss_pred             CCCCCCCCC----C-------CC---------------CCCCC-CCCCCCCEEEEECCCCCCCCCCC-------------
Q ss_conf             222211111----1-------22---------------22211-22345304798337875432224-------------
Q gi|254780290|r  217 IILDMVGAE----Y-------LN---------------QHLTL-LSKEGKLIIISFLGGNIATEINL-------------  256 (332)
Q Consensus       217 ivid~~G~~----~-------~~---------------~~~~~-l~~~G~iv~~G~~~~~~~~~~~~-------------  256 (332)
                      +++++.|..    .       |+               ..+.. ++.+|+++.++...+....+...             
T Consensus        86 iLVnNAGi~~~~~~~~~~~e~~~~v~dVNl~G~~~~~ra~lp~m~~~~G~IVnisS~ag~~~~p~~~aY~ASKaav~~~t  165 (296)
T PRK05872         86 VVVANAGIASYGSVLQVDPAAFRRVIDVNLLGVFHTVRATLPAVIERRGYVLQVSSLAAFAAAPGMAPYCASKAGVEAFA  165 (296)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             87655625799764219989972584244599999999999999977998999960543245899807999999999999


Q ss_pred             ----CHHHCCCCEEEEEEECCC-HHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHH-HHHHCCC
Q ss_conf             ----334305321677751240-001137899999999999998698310212474189999999-9998299
Q gi|254780290|r  257 ----NPIISKRITITGSTLRRR-TDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAH-DIMEKSE  323 (332)
Q Consensus       257 ----~~~~~~~~~i~g~~~~~~-~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~-~~l~~g~  323 (332)
                          .++-..++++....-+.. .+.......+   ...+.-+.. .+-+...++|+.+++.+++ +.++.++
T Consensus       166 ~sLa~Ela~~GIrVn~V~PG~V~T~m~r~a~~~---~~~~~~~~~-~~p~p~~~~~~~~~~a~~i~~~i~r~~  234 (296)
T PRK05872        166 NALRLEVAHRGVSVGSAYLSWIDTDLVRDADAD---LPAFRELRA-RLPWPLNRTTSVEKCAAAFVDGIERRA  234 (296)
T ss_pred             HHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCC---CCHHHHHHC-CCCCCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             999998400193899997088977567476645---755678861-289987886599999999999984488


No 60 
>PRK06139 short chain dehydrogenase; Provisional
Probab=96.62  E-value=0.00015  Score=49.20  Aligned_cols=78  Identities=29%  Similarity=0.394  Sum_probs=53.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCC---CCCCCCC----CCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----122332222---2222211----11222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHAI---NYLKEDF----LEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~vi---~~~~~~~----~~~i~~~t~g~  213 (332)
                      .|+.++|+||++|+|.+..+.+...|++|+.+++++++++.+    ++.|.+...   |-++.+-    .+++.+.. | 
T Consensus         5 ~gKvvlITGASsGIG~aiA~~~A~~Ga~Vvl~~R~~~~L~~~a~e~~~~G~~~~~v~~DVsd~~~v~~~~~~~~~~~-G-   82 (324)
T PRK06139          5 HGAVVVITGASSGIGRATAEAFARRGARLVLAARDEEALFEVAEECRALGAEVLVVPTDVTHADQVQALATQAASFL-G-   82 (324)
T ss_pred             CCCEEEEECHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC-C-
T ss_conf             99779993825499999999999879989999899999999999999549948999766788578999999999974-9-


Q ss_pred             CCCCCCCCCCC
Q ss_conf             11122221111
Q gi|254780290|r  214 GIDIILDMVGA  224 (332)
Q Consensus       214 g~Divid~~G~  224 (332)
                      ++|+.+++.|.
T Consensus        83 ~IDiLVNNAGi   93 (324)
T PRK06139         83 RIDVWFNNVGV   93 (324)
T ss_pred             CCCEEEECCCC
T ss_conf             98788645755


No 61 
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional
Probab=96.62  E-value=0.00015  Score=49.29  Aligned_cols=96  Identities=23%  Similarity=0.300  Sum_probs=67.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCC---CCCCCCCCCCCCCCCCC
Q ss_conf             111222222222222113444443222221222222221112232211111122--3322---22222221111222222
Q gi|254780290|r  136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKL--GAKH---AINYLKEDFLEILQKET  210 (332)
Q Consensus       136 ~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~l--Ga~~---vi~~~~~~~~~~i~~~t  210 (332)
                      .+.++++++||++||=+| || =|.+++..|+..||+|++++.|+++.+++++.  |.+.   ..||++         . 
T Consensus       158 ~i~~kl~l~~G~~VLeIG-cG-WGgla~~aA~~~g~~VtgiTlS~eQ~~~a~~r~~gl~v~v~l~DYRd---------~-  225 (383)
T PRK11705        158 LICRKLQLKPGMRVLDIG-CG-WGGLARYAAEHYGVSVVGVTISAEQQKLAQERCAGLPVEIRLQDYRD---------L-  225 (383)
T ss_pred             HHHHHCCCCCCCEEEEEC-CC-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCCEEEECCHHH---------C-
T ss_conf             999864899999798857-87-49999999997497599985889999999999738987899715244---------3-


Q ss_pred             CCCCCCCCC-----CCCCCC----CCCCCCCCCCCCCCCEEEE
Q ss_conf             222111222-----211111----1222221122345304798
Q gi|254780290|r  211 QGRGIDIIL-----DMVGAE----YLNQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       211 ~g~g~Divi-----d~~G~~----~~~~~~~~l~~~G~iv~~G  244 (332)
                      .| .+|.|+     +++|..    .++.+-++|+++|+.+.-.
T Consensus       226 ~g-~fD~IvSIeM~EhVG~~~~~~yF~~i~~lLkp~G~~~lqt  267 (383)
T PRK11705        226 NG-QFDRIVSVGMFEHVGPKNYRTYFEVVDRCLKPDGLFLLHT  267 (383)
T ss_pred             CC-CCCEEEEEEHHHHCCHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             67-7355999714865287779999999998569997399999


No 62 
>PRK07326 short chain dehydrogenase; Provisional
Probab=96.61  E-value=0.00011  Score=50.06  Aligned_cols=103  Identities=25%  Similarity=0.384  Sum_probs=65.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC----CCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-12233222----2222221----11122222222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKHA----INYLKED----FLEILQKETQGRGI  215 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~v----i~~~~~~----~~~~i~~~t~g~g~  215 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.+.+++++.+.+ .+++...+    .|-++++    +.+++.+..+  ++
T Consensus         4 ~GKvalITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~~Dv~d~~~v~~~v~~~~~~~G--~i   81 (235)
T PRK07326          4 NGKAALVTGGSKGIGFAVAEALAAAGYRVAICARDESELEAAAQELGKRNVLGLACDVRDEADVRQAVDAHVEAFG--GL   81 (235)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCC--CC
T ss_conf             9989999382679999999999987999999989889999999984239869999638999999999999999829--96


Q ss_pred             CCCCCCCCCCC-----------CC---------------CCCCCC--CCCCCCEEEEECCCC
Q ss_conf             12222111111-----------22---------------222112--234530479833787
Q gi|254780290|r  216 DIILDMVGAEY-----------LN---------------QHLTLL--SKEGKLIIISFLGGN  249 (332)
Q Consensus       216 Divid~~G~~~-----------~~---------------~~~~~l--~~~G~iv~~G~~~~~  249 (332)
                      |+.+++.|...           |+               .+++.|  +.+|+++.++...+.
T Consensus        82 DiLVNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IinisS~ag~  143 (235)
T PRK07326         82 DILVNNAGVGHFAPVEELTLEEWRLVIDTNLTGAFYTIKAAVPALLKRGGGYIVNISSLAGK  143 (235)
T ss_pred             EEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHH
T ss_conf             69998887789988265999999999999879999999999999997199889998365550


No 63 
>pfam01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain. This family now also contains the lysine 2-oxoglutarate reductases.
Probab=96.60  E-value=0.00031  Score=47.15  Aligned_cols=98  Identities=17%  Similarity=0.167  Sum_probs=71.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222221134444432222212222222211122322111111223322222---222211112222222221112
Q gi|254780290|r  141 ANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAIN---YLKEDFLEILQKETQGRGIDI  217 (332)
Q Consensus       141 ~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~---~~~~~~~~~i~~~t~g~g~Di  217 (332)
                      ..++| -+++|.| +|-+|+.|++.|+.+|++|.+.+.++++.+.+++.+...+..   ++...+.+.+.      .+|+
T Consensus        16 ~gv~p-a~vvViG-~Gv~G~~A~~~A~~lGa~V~v~D~~~~~l~~~~~~~~~~v~~~~~~~~~~l~~~i~------~aDv   87 (150)
T pfam01262        16 GGVPP-AKVVVIG-GGVVGLGAAATAKGLGAPVTILDVRPERLEQLDSLFAEFVETDIFSNCEYLAEAIA------EADL   87 (150)
T ss_pred             CCCCC-CEEEEEC-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCHHHCCHHHHHHHHH------HCCE
T ss_conf             99767-7799989-87899999999986799899972999999999986476200166537999999974------3879


Q ss_pred             CCCCC---CCC----CCCCCCCCCCCCCCCEEEEEC
Q ss_conf             22211---111----122222112234530479833
Q gi|254780290|r  218 ILDMV---GAE----YLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       218 vid~~---G~~----~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      +|-++   |..    ..+..++.|+++.-++.+..-
T Consensus        88 vIgavl~pg~~aP~lIt~~mv~~MkpGsVIVDvaiD  123 (150)
T pfam01262        88 VIGTVLIPGARAPKLVTREMVKTMKPGSVIVDVAID  123 (150)
T ss_pred             EEEEEECCCCCCCCEECHHHHHHHCCCCEEEEEECC
T ss_conf             997203178869922079999844799399996204


No 64 
>PRK06181 short chain dehydrogenase; Provisional
Probab=96.60  E-value=0.0001  Score=50.24  Aligned_cols=76  Identities=29%  Similarity=0.411  Sum_probs=51.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCCCC----CCCCCCCCCCC
Q ss_conf             22222113444443222221222222221112232211111----1223322---2222222111----12222222221
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKEDFL----EILQKETQGRG  214 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~~~----~~i~~~t~g~g  214 (332)
                      |++++|+||++|+|.+..+.+...|++|+.+++++++.+.+    ++.|.+.   ..|-++++-.    +++.+..  .+
T Consensus         1 GKv~lITGassGIG~a~A~~la~~Ga~vvl~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvs~~~~~~~~~~~~~~~~--G~   78 (263)
T PRK06181          1 GKVVIITGASEGIGRALAVRLARAGARLVLAARNEERLASLAQELANYGAEALVVATDVSDAEACERLIEAAVAHF--GG   78 (263)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHH--CC
T ss_conf             9999995810199999999999879989999889999999999999549967999807999999999999999982--99


Q ss_pred             CCCCCCCCC
Q ss_conf             112222111
Q gi|254780290|r  215 IDIILDMVG  223 (332)
Q Consensus       215 ~Divid~~G  223 (332)
                      +|+.+++.|
T Consensus        79 iDiLVNNAG   87 (263)
T PRK06181         79 IDILVNNAG   87 (263)
T ss_pred             CCEEEECCC
T ss_conf             648998785


No 65 
>PRK05866 short chain dehydrogenase; Provisional
Probab=96.59  E-value=0.00011  Score=50.10  Aligned_cols=79  Identities=28%  Similarity=0.436  Sum_probs=52.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C---CCCCC---CCCCCCCCCCCCCCCCCC--CCCC
Q ss_conf             2222221134444432222212222222211122322111111-2---23322---222222211112222222--2211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-K---LGAKH---AINYLKEDFLEILQKETQ--GRGI  215 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~---lGa~~---vi~~~~~~~~~~i~~~t~--g~g~  215 (332)
                      .|+++||+||++|+|.+..+-....|++|+.+++++++.+.+. +   .|.+.   ..|-++.+-.+.+.+...  -.++
T Consensus        39 ~GKvaLITGassGIG~aiA~~la~~Ga~Vvl~~R~~~~l~~~~~~i~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~i  118 (290)
T PRK05866         39 TGKRILLTGASSGIGEAAAEKFARRGATVVAVARRKDLLDAVADRITAAGGDAMAIPCDLSDLDAVDALVADVEERIGGV  118 (290)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             99989990813099999999999869989999899999999999999649908999778898999999999999985998


Q ss_pred             CCCCCCCC
Q ss_conf             12222111
Q gi|254780290|r  216 DIILDMVG  223 (332)
Q Consensus       216 Divid~~G  223 (332)
                      |+.+++.|
T Consensus       119 DiLVNNAG  126 (290)
T PRK05866        119 DILINNAG  126 (290)
T ss_pred             CEEEECCC
T ss_conf             88997576


No 66 
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233   This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , . A separate methylase (MenG/UbiE) catalyses the single C-methylation step. The most commonly used names for genes in this family do not indicate whether this gene is an O-methyl, or C-methyl transferase.; GO: 0008425 2-polyprenyl-6-methoxy-14-benzoquinone methyltransferase activity, 0006744 ubiquinone biosynthetic process.
Probab=96.56  E-value=0.00022  Score=48.07  Aligned_cols=95  Identities=27%  Similarity=0.342  Sum_probs=67.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCC----CCC----CCCCCCCCCCCCCCCCCC-CCC
Q ss_conf             22222221134444432222212222222-21112232211111122----332----222222221111222222-222
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLKL----GAK----HAINYLKEDFLEILQKET-QGR  213 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~~~~~~~~~~l----Ga~----~vi~~~~~~~~~~i~~~t-~g~  213 (332)
                      ++|-+||=.| ||| |+++--||| .|+. |++++.+++..+.||..    |..    ..|+|+..+..+ +.+.. ...
T Consensus        83 ~~G~~vLDVG-CGG-GlLsE~lAR-~Ga~~V~GID~~~~~i~~Ak~Ha~~~~~~~~~~K~i~Y~~~~~E~-l~~~~h~~~  158 (275)
T TIGR01983        83 DSGLRVLDVG-CGG-GLLSEPLAR-LGANKVTGIDASEENIEVAKLHAKKDPLQEALDKKIEYRCTSVEE-LAEEQHTKK  158 (275)
T ss_pred             CCCCEEEEEC-CCH-HHHHHHHHH-CCCCEEEEEECHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH-HHCCCCCCC
T ss_conf             7897799842-785-788899975-588425775211779999998887334023311114544430788-730557841


Q ss_pred             CCCCCC-----CCCC--CCCCCCCCCCCCCCCCCEE
Q ss_conf             111222-----2111--1112222211223453047
Q gi|254780290|r  214 GIDIIL-----DMVG--AEYLNQHLTLLSKEGKLII  242 (332)
Q Consensus       214 g~Divi-----d~~G--~~~~~~~~~~l~~~G~iv~  242 (332)
                      .||+|+     +.|-  ...+..++.+++|||.+..
T Consensus       159 ~FD~V~~mEvlEHV~dp~~f~~~c~~llkPgG~lF~  194 (275)
T TIGR01983       159 SFDVVTCMEVLEHVPDPQAFIKACAQLLKPGGILFF  194 (275)
T ss_pred             CCCEEEEEEEEECCCCHHHHHHHHHHHCCCCCCEEE
T ss_conf             573376432000027888999999985089984897


No 67 
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR011283   This entry represent acetoacetyl-CoA reductase, a member of the family short-chain-alcohol dehydrogenases. Note that, despite the precision implied by the enzyme name, the reaction of 1.1.1.36 from EC is defined more generally as (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH. Members of this family may act in the biosynthesis of poly-beta-hydroxybutyrate (e.g. Rhizobium meliloti) and related poly-beta-hydroxyalkanoates. Note that the member of this family from Azospirillum brasilense, designated NodG, appears to lack acetoacetyl-CoA reductase activity and to act instead in the production of nodulation factor. ; GO: 0018454 acetoacetyl-CoA reductase activity, 0042619 poly-hydroxybutyrate biosynthetic process, 0005737 cytoplasm.
Probab=96.56  E-value=0.00037  Score=46.60  Aligned_cols=165  Identities=20%  Similarity=0.243  Sum_probs=87.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCC-CCCCCCCCC---CCCCCC----CCCC---CCCCCCCCCCCCCC
Q ss_conf             221134444432222212222222211122--3221-111112233---222222----2221---11122222222211
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTAK--SEEK-CLACLKLGA---KHAINY----LKED---FLEILQKETQGRGI  215 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~~--~~~~-~~~~~~lGa---~~vi~~----~~~~---~~~~i~~~t~g~g~  215 (332)
                      .||+||.||+|.+.++=+...|++|++.+.  ++++ .+++++.++   |-.+-.    +-++   ..+++.+..+  ++
T Consensus         3 ALVTGg~GGIGtAIC~rL~~dG~~V~An~~p~N~~~a~~W~~~~~~~g~~~~~~~~DV~~~e~c~~~v~~v~a~lG--pv   80 (244)
T TIGR01829         3 ALVTGGTGGIGTAICTRLAKDGYRVAANYVPSNEERAEAWLQEQGAQGFDFAVVEGDVSSFEDCKAAVAKVEAELG--PV   80 (244)
T ss_pred             EEEECCCCCHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCC--CE
T ss_conf             7885787744689999998759889881789825899999986269851478987276777899999999997119--53


Q ss_pred             CCCCCCCC--CC-CCC----------------CCCCC-------C--CCCCCCEEEEECCCCCCC--CCC----------
Q ss_conf             12222111--11-122----------------22211-------2--234530479833787543--222----------
Q gi|254780290|r  216 DIILDMVG--AE-YLN----------------QHLTL-------L--SKEGKLIIISFLGGNIAT--EIN----------  255 (332)
Q Consensus       216 Divid~~G--~~-~~~----------------~~~~~-------l--~~~G~iv~~G~~~~~~~~--~~~----------  255 (332)
                      |+.+++.|  .| +|+                ..|+.       |  +--||++.+++..|.+..  ..|          
T Consensus        81 DvLVNNAGITRD~~F~KM~~~qW~~VI~TNL~SvFNVT~pV~~gM~eRGwGRIiNISSvNG~KGQfGQtNYSAAKAG~iG  160 (244)
T TIGR01829        81 DVLVNNAGITRDKTFKKMTYEQWSEVIDTNLNSVFNVTRPVIEGMRERGWGRIINISSVNGQKGQFGQTNYSAAKAGMIG  160 (244)
T ss_pred             EEEEECCCCCCCHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHH
T ss_conf             68986886440303124998468889863132441554001476621688416884121477565430458988621567


Q ss_pred             -----CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCC-CCCCCCEEEEE-HHHHHHHHHHHHCCC
Q ss_conf             -----433430532167775124000113789999999999999869-83102124741-899999999998299
Q gi|254780290|r  256 -----LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH-VIAPVIHTVLP-LGKVAMAHDIMEKSE  323 (332)
Q Consensus       256 -----~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g-~l~p~i~~~~~-l~~i~~A~~~l~~g~  323 (332)
                           ..+.-.+++++--..-+. -  ..+ .-..+.++++    +. .+.-.+-++.+ -|||..|-.+|.+-+
T Consensus       161 FTkALA~E~A~kGvTVN~i~PGY-i--~T~-MV~A~redVl----~~rIva~IP~~RLg~PeEIA~aV~fLase~  227 (244)
T TIGR01829       161 FTKALAQEGARKGVTVNVIAPGY-I--ATD-MVMAVREDVL----QSRIVAQIPVKRLGRPEEIAAAVAFLASEE  227 (244)
T ss_pred             HHHHHHHHCCCCCCEEEEECCCC-C--CCH-HHHHHHHHHH----HCCCCCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             77999972110385675455889-8--866-7786368887----405778898321578157888998865410


No 68 
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]
Probab=96.55  E-value=0.00016  Score=48.95  Aligned_cols=107  Identities=26%  Similarity=0.370  Sum_probs=68.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC----CCCCCCCCCCC-CCCCCCCCCCC-CCCC
Q ss_conf             222222113444443222221222222221112232211111-12233----22222222211-11222222222-1112
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGA----KHAINYLKEDF-LEILQKETQGR-GIDI  217 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa----~~vi~~~~~~~-~~~i~~~t~g~-g~Di  217 (332)
                      .++.++|+||+||+|.+..+.....|++|+.+.|+.++++.+ .+++.    -..+|-+|.+- .+.+..+...- .+|+
T Consensus         5 ~~kv~lITGASSGiG~A~A~~l~~~G~~vvl~aRR~drL~~la~~~~~~~~~~~~~DVtD~~~~~~~i~~~~~~~g~iDi   84 (246)
T COG4221           5 KGKVALITGASSGIGEATARALAEAGAKVVLAARREERLEALADEIGAGAALALALDVTDRAAVEAAIEALPEEFGRIDI   84 (246)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             78689994686568899999999789969998636889999998625674378961367889999999999975176058


Q ss_pred             CCCCCCCCC-----------CCCC---------------CCCC--CCCCCCEEEEECCCCCC
Q ss_conf             222111111-----------2222---------------2112--23453047983378754
Q gi|254780290|r  218 ILDMVGAEY-----------LNQH---------------LTLL--SKEGKLIIISFLGGNIA  251 (332)
Q Consensus       218 vid~~G~~~-----------~~~~---------------~~~l--~~~G~iv~~G~~~~~~~  251 (332)
                      .++..|...           |++.               +..+  +..|+++.+|...+.++
T Consensus        85 LvNNAGl~~g~~~~~~~~~dw~~Mid~Ni~G~l~~~~avLP~m~~r~~G~IiN~~SiAG~~~  146 (246)
T COG4221          85 LVNNAGLALGDPLDEADLDDWDRMIDTNVKGLLNGTRAVLPGMVERKSGHIINLGSIAGRYP  146 (246)
T ss_pred             EEECCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC
T ss_conf             99668777687035489999999999888999999988666888647963999535133366


No 69 
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional
Probab=96.54  E-value=0.00016  Score=48.98  Aligned_cols=77  Identities=26%  Similarity=0.370  Sum_probs=52.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCC---CCCCCC----CCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-122332222---222221----111222222222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKHAI---NYLKED----FLEILQKETQGRGID  216 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~vi---~~~~~~----~~~~i~~~t~g~g~D  216 (332)
                      .|+++||+||++++|.+.++-+...|++|+.+.+++++.+.+ +++|.+...   |-++.+    +.+++.+..+  ++|
T Consensus         5 ~gK~alVTGas~GIG~aia~~l~~~Ga~V~~~~r~~~~l~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~G--~iD   82 (263)
T PRK06200          5 TGQVALITGGGSGIGRALVERFLAEGARVAVLERSAEKCASLRQRFGDDVLVVEGDVTSYADNQRAVAQTVDRFG--KLD   82 (263)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHC--CCC
T ss_conf             728899958667999999999998799999997999999999998188646871799999999999999999849--988


Q ss_pred             CCCCCCC
Q ss_conf             2222111
Q gi|254780290|r  217 IILDMVG  223 (332)
Q Consensus       217 ivid~~G  223 (332)
                      +.+++.|
T Consensus        83 iLVnnAG   89 (263)
T PRK06200         83 CFVGNAG   89 (263)
T ss_pred             EEEECCC
T ss_conf             8997575


No 70 
>PRK06180 short chain dehydrogenase; Provisional
Probab=96.52  E-value=0.00013  Score=49.69  Aligned_cols=103  Identities=25%  Similarity=0.271  Sum_probs=63.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112233222----22222211----11222222222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHA----INYLKEDF----LEILQKETQGRGID  216 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~v----i~~~~~~~----~~~i~~~t~g~g~D  216 (332)
                      .-+++||+||++|+|.+.++.+...|++|+++++++++.+.+.+...+.+    .|-++++-    .+++.+..  .++|
T Consensus         3 ~~KvvlITGassGIG~aiA~~l~~~G~~Vi~~~R~~~~l~~l~~~~~~~~~~~~~Dvtd~~~v~~~v~~~~~~~--G~iD   80 (277)
T PRK06180          3 SMKTWLITGVSSGFGRALAQAALAAGHRVVGTVRSAAARRDFEALHPGRALARVLDVTDFDAIDGVVADAEATV--GPID   80 (277)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHH--CCCC
T ss_conf             99889991787399999999999879999999899999999998679957999983799999999999999981--9986


Q ss_pred             CCCCCCCCC---CCC-----------------------CCCCCC--CCCCCCEEEEECCCC
Q ss_conf             222211111---122-----------------------222112--234530479833787
Q gi|254780290|r  217 IILDMVGAE---YLN-----------------------QHLTLL--SKEGKLIIISFLGGN  249 (332)
Q Consensus       217 ivid~~G~~---~~~-----------------------~~~~~l--~~~G~iv~~G~~~~~  249 (332)
                      +++++.|..   .++                       ..++.|  +.+|+++.++...+.
T Consensus        81 vLVNNAG~~~~~~~e~~~~~~~~~~~~vN~~g~~~~~~a~lp~m~~~~~G~IvnisS~ag~  141 (277)
T PRK06180         81 VLVNNAGYGHEGAIEESPLAEMRRQFEVNVFGAVAMIKAVLPGMRARRRGHIVNITSMGGL  141 (277)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCCCEEEEECCHHHC
T ss_conf             9998997788886333999999999988537765442004888896589657753546652


No 71 
>PRK06128 oxidoreductase; Provisional
Probab=96.50  E-value=0.00023  Score=47.95  Aligned_cols=182  Identities=18%  Similarity=0.173  Sum_probs=91.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------CCCCCCCCCCC---CCCCCCCCC----CCC
Q ss_conf             22222222222113444443222221222222221112232211------11112233222---222222111----122
Q gi|254780290|r  140 TANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC------LACLKLGAKHA---INYLKEDFL----EIL  206 (332)
Q Consensus       140 ~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~------~~~~~lGa~~v---i~~~~~~~~----~~i  206 (332)
                      .++| .|+++||+||++|+|.+.+......|++|+.+..+.++.      +.+++.|...+   .|-++++..    +++
T Consensus        50 ~grL-~GKvAlVTGgssGIG~AiA~~lA~eGA~Vvi~~~~~~~~~a~~~~~~i~~~G~~a~~v~~Dvsd~~~~~~~v~~~  128 (300)
T PRK06128         50 FGRL-QGRKALITGADSGIGRATAIAFAREGADIVLNYLPEEEQDAAEVVQLIQAEGRKAVAVPGDLKDEAFCRQLVERA  128 (300)
T ss_pred             CCCC-CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             8878-999589917366999999999998699999942995567899999999965981899974789999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCC----CC-----------------------CCCCCCCCCCCCCEEEEECCCCCCCCCC----
Q ss_conf             2222222111222211111----12-----------------------2222112234530479833787543222----
Q gi|254780290|r  207 QKETQGRGIDIILDMVGAE----YL-----------------------NQHLTLLSKEGKLIIISFLGGNIATEIN----  255 (332)
Q Consensus       207 ~~~t~g~g~Divid~~G~~----~~-----------------------~~~~~~l~~~G~iv~~G~~~~~~~~~~~----  255 (332)
                      .+..+  ++|+.+++.|..    .+                       +.++..|+.+|+++.++...+....+-.    
T Consensus       129 ~~~~G--~iDiLVNNAG~~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~aa~p~m~~gGsIInisSi~~~~~~~~~~~Y~  206 (300)
T PRK06128        129 VKELG--GLDILVNIAGKQTARKDIADITTEQFDATFKTNVYAMFWLCKAAIPHLPPGASIINTGSIQSYQPSPTLLDYA  206 (300)
T ss_pred             HHHHC--CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCHHHH
T ss_conf             99809--9998998999977899917799999999986611589999999999875387147874212405788617789


Q ss_pred             -------------CCHHHCCCCEEEEEEECCCH-HCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC
Q ss_conf             -------------43343053216777512400-0113789999999999999869831021247418999999999982
Q gi|254780290|r  256 -------------LNPIISKRITITGSTLRRRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK  321 (332)
Q Consensus       256 -------------~~~~~~~~~~i~g~~~~~~~-~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~  321 (332)
                                   ..++-.+++++....-+... .......  .....+.++...   .| ..+.=.-+|+..+.-.|.+
T Consensus       207 asKaav~~lTrslA~ela~~gIRVNaVaPG~i~T~l~~~~~--~~~e~~~~~~~~---~P-lgR~g~PeEIA~~v~FLaS  280 (300)
T PRK06128        207 STKAAIVNFTKGLAQQVAEKGIRVNAVAPGPVWTPLQPSGG--QPPEKIPDFGSE---TP-MKRAGQPVEMAPLYVLLAS  280 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCC--CCHHHHHHHHHC---CC-CCCCCCHHHHHHHHHHHHC
T ss_conf             99999999999999997416979999961889871200169--999999999836---99-8998399999999999958


Q ss_pred             C---CCCCEEEE
Q ss_conf             9---98132898
Q gi|254780290|r  322 S---EHIGKIIL  330 (332)
Q Consensus       322 g---~~~GKvVi  330 (332)
                      .   -.+|-++.
T Consensus       281 d~asyiTGq~i~  292 (300)
T PRK06128        281 QESSYVTGEVFG  292 (300)
T ss_pred             CHHCCCCCCEEE
T ss_conf             242585585489


No 72 
>PRK12742 oxidoreductase; Provisional
Probab=96.46  E-value=0.00033  Score=46.93  Aligned_cols=175  Identities=20%  Similarity=0.240  Sum_probs=88.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC-CCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322-1111-112233222-222222111122222222211122221
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE-KCLA-CLKLGAKHA-INYLKEDFLEILQKETQGRGIDIILDM  221 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~-~~~~-~~~lGa~~v-i~~~~~~~~~~i~~~t~g~g~Divid~  221 (332)
                      .|+++||+||++++|.+.++-+...|++|+.+.++.+ ..+. ..+.+...+ .|..+.+....+.+..  .++|+++++
T Consensus         5 ~gK~alITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~--g~iD~lVnn   82 (237)
T PRK12742          5 TGKSVLVLGGSRGIGAAIVRRFVTDGANVVFTYAGSKDAAERLAAETGATAVFTDSADRDAVIDVVRKS--GPLDILVVN   82 (237)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCEEEEECCCCHHHHHHHHHHH--CCCCEEEEC
T ss_conf             999899927887999999999998799999977999899999988639828993545899999999986--999899989


Q ss_pred             CCCC----CCC----------------------CCCCCCCCCCCCEEEEECCCCC-CC-CCC----------------CC
Q ss_conf             1111----122----------------------2221122345304798337875-43-222----------------43
Q gi|254780290|r  222 VGAE----YLN----------------------QHLTLLSKEGKLIIISFLGGNI-AT-EIN----------------LN  257 (332)
Q Consensus       222 ~G~~----~~~----------------------~~~~~l~~~G~iv~~G~~~~~~-~~-~~~----------------~~  257 (332)
                      .|..    .++                      ..++.++.+|+++.++...+.. +. ...                ..
T Consensus        83 Ag~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~G~ii~i~S~~~~~~~~~~~~~Y~asKaal~~ltk~lA~  162 (237)
T PRK12742         83 AGIALFGDALELDADAIDRLFKINIHAPYHASVEAARQMPEGGRILIIGSVNGDRMPVAGMAAYAASKSALQGMARGLAR  162 (237)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             97789998134999999999987506799999999997123785999995300236888607889999999999999999


Q ss_pred             HHHCCCCEEEEEEECCCH-HCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---CCCEEEE
Q ss_conf             343053216777512400-011378999999999999986983102124741899999999998299---8132898
Q gi|254780290|r  258 PIISKRITITGSTLRRRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---HIGKIIL  330 (332)
Q Consensus       258 ~~~~~~~~i~g~~~~~~~-~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~~GKvVi  330 (332)
                      ++-.+++++....-+... +..+..  .    ...+.+.+  ..| ..+.-.-+|+.++...|.+.+   .+|-++.
T Consensus       163 ela~~gIrVNaIaPG~i~T~~~~~~--~----~~~~~~~~--~~p-l~R~g~p~eia~~v~fL~S~~a~~iTG~~i~  230 (237)
T PRK12742        163 DFGPRGITINVVQPGPIDTDANPAN--G----PMRDLMHS--FMA-IKRHGRPEEVAGMVAWLAGPEASFVTGAMHT  230 (237)
T ss_pred             HHCCCCEEEEEEEECCCCCCCCCCC--C----HHHHHHHH--CCC-CCCCCCHHHHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             9740297999996278888888677--1----79999982--599-8998789999999999958653575588177


No 73 
>TIGR01137 cysta_beta cystathionine beta-synthase; InterPro: IPR005857    This model discriminates cystathionine beta-synthase, a protein found primarily in eukaryotes and carrying a C-terminal CBS domain from cysteine synthases. Cysteine synthase (O-acetylserine (thiol)-lyase) is the enzyme responsible for the formation of cysteine from O-acetyl-serine and hydrogen sulphide with the concomitant release of acetic acid - the function of many of these enzymes is unproven.; GO: 0004122 cystathionine beta-synthase activity, 0019343 cysteine biosynthetic process via cystathionine, 0005737 cytoplasm.
Probab=96.45  E-value=0.00067  Score=44.91  Aligned_cols=105  Identities=22%  Similarity=0.272  Sum_probs=59.2

Q ss_pred             CCCCCCCCC-CCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCC-----------
Q ss_conf             122222222-22221-134444432222212222222211122---32211111122332222222221-----------
Q gi|254780290|r  138 FQTANLRSG-QTVLI-HGGSSGIGTTAIQLASYFGATVYTTAK---SEEKCLACLKLGAKHAINYLKED-----------  201 (332)
Q Consensus       138 ~~~~~~~~g-~~vlV-~ga~g~vG~~a~qla~~~G~~vi~~~~---~~~~~~~~~~lGa~~vi~~~~~~-----------  201 (332)
                      .+.++++|| +|++= +.|.+||||+.  +|..+|+|.|-|+.   |.+|++.||.+||+-+.-.+.-+           
T Consensus        56 E~sG~lkPGr~TiiEPTSGNTGiGLAL--~Aa~kGYk~Iiv~PeKmS~eKv~VL~AlGAEivrtPT~a~~d~PeSh~gVa  133 (527)
T TIGR01137        56 EASGRLKPGRDTIIEPTSGNTGIGLAL--VAAIKGYKCIIVLPEKMSEEKVDVLKALGAEIVRTPTAAAFDSPESHIGVA  133 (527)
T ss_pred             HHCCCEECCCCCEEECCCCCHHHHHHH--HHHHCCCEEEEECCCCCCHHHHHHHHHHCCEEEECCCCCCCCCCCCCCHHH
T ss_conf             207843068872460688844689999--995268639998687546147899998198077878887888486520488


Q ss_pred             -----------------------------CCCCCCCCCCC----CCCCCCCCCCC-CCCCCCCCCCCC--CCCCCEEEE
Q ss_conf             -----------------------------11122222222----21112222111-111222221122--345304798
Q gi|254780290|r  202 -----------------------------FLEILQKETQG----RGIDIILDMVG-AEYLNQHLTLLS--KEGKLIIIS  244 (332)
Q Consensus       202 -----------------------------~~~~i~~~t~g----~g~Divid~~G-~~~~~~~~~~l~--~~G~iv~~G  244 (332)
                                                   -.++|.+.+.|    ..+|.++-.+| |.++.=..+.||  ..+.+..+|
T Consensus       134 ~rL~~EiPga~KIlDQY~N~~NP~aHY~~Tg~Ei~~q~EGlnlfdk~~~~VAg~GTGGTItGi~ryLK~~~~~~~~ivG  212 (527)
T TIGR01137       134 KRLVREIPGAHKILDQYANPSNPLAHYDGTGPEILEQCEGLNLFDKLDMFVAGVGTGGTITGIARYLKDESNPKVRIVG  212 (527)
T ss_pred             HHHCCCCCCCEECCCCCCCCCCCCCCCCCCHHHHHHHHCCCCHHCCCCEEEECCCCCCHHHHHHHHHHHCCCCCEEEEE
T ss_conf             8522278884335200478878610134105899986057301212117885057883155455654321389338998


No 74 
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional
Probab=96.45  E-value=0.00037  Score=46.60  Aligned_cols=113  Identities=21%  Similarity=0.242  Sum_probs=71.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCC----CCCCCCCCCCC
Q ss_conf             222222333222111222222222222113444443222221222222--221112232211111----12233222222
Q gi|254780290|r  124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA--TVYTTAKSEEKCLAC----LKLGAKHAINY  197 (332)
Q Consensus       124 a~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~--~vi~~~~~~~~~~~~----~~lGa~~vi~~  197 (332)
                      .++.-+.+.|+  +.+..++++|++||..|.  |.|..+.-+|+..|-  +|+++.+.++=.+.+    +.+|...++..
T Consensus        53 ~tis~P~~~a~--ml~~L~~~~~~~VLeIGt--GsGY~tAlla~l~~~~g~V~siE~~~~L~~~A~~~l~~l~~~n~v~v  128 (205)
T PRK13944         53 ATISAPHMVAM--MCELIEPRPGMKILEVGT--GSGYQAAVCAEAIERRGKVYTVEIVKELAIYAAQNIERLGYWGVVEV  128 (205)
T ss_pred             CEECHHHHHHH--HHHHHCCCCCCEEEEECC--CCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             89977999999--999706899998999789--85199999999837477179995369999999999998598633067


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCEEE
Q ss_conf             222111122222222211122221111112-2222112234530479
Q gi|254780290|r  198 LKEDFLEILQKETQGRGIDIILDMVGAEYL-NQHLTLLSKEGKLIII  243 (332)
Q Consensus       198 ~~~~~~~~i~~~t~g~g~Divid~~G~~~~-~~~~~~l~~~G~iv~~  243 (332)
                      ...|...-..   ...+||.|+=+.+.+.. ...++.|++||+++.-
T Consensus       129 ~~gdg~~G~~---~~apfD~Iiv~aa~~~iP~~l~~QL~~gGrLV~P  172 (205)
T PRK13944        129 YHGDGKRGLE---KHAPFDAIIVTAAASTIPSALVRQLKDGGVLVIP  172 (205)
T ss_pred             EECCCCCCCC---CCCCCCEEEEEEECCCCCHHHHHHCCCCCEEEEE
T ss_conf             9765565774---3498048999850776899999854879799999


No 75 
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed
Probab=96.44  E-value=0.00042  Score=46.27  Aligned_cols=122  Identities=21%  Similarity=0.273  Sum_probs=74.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCC
Q ss_conf             1111222222232221222222333222111222222222222113444443222221222222--22111223221111
Q gi|254780290|r  108 QGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA--TVYTTAKSEEKCLA  185 (332)
Q Consensus       108 ~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~--~vi~~~~~~~~~~~  185 (332)
                      ++.+-.+|++.++    .++|.--      ...+++++|++||=.|  +|.|..+...|+..|-  +|++++.+++-++.
T Consensus        46 ~~~l~~~p~~a~~----~~gCGnP------~~~a~l~pGe~VLDLG--cG~G~d~~~aA~~VG~~G~ViGVD~s~~ML~~  113 (258)
T PRK11873         46 EEDLAAVPEGANL----GLGCGNP------TALAELKPGETVLDLG--SGAGFDCFLAARRVGPTGKVIGVDMTPEMLAK  113 (258)
T ss_pred             HHHHHHCCHHHHC----CCCCCCC------CCCCCCCCCCEEEEEC--CCCCHHHHHHHHHHCCCCEEEEECCCHHHHHH
T ss_conf             9998647276640----8788985------4546579999899947--88777599999986999779998599999999


Q ss_pred             CCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC------CCCCCCCCCCCCCCCCCEEEEE
Q ss_conf             112----23322222222211112222222221112222-111------1112222211223453047983
Q gi|254780290|r  186 CLK----LGAKHAINYLKEDFLEILQKETQGRGIDIILD-MVG------AEYLNQHLTLLSKEGKLIIISF  245 (332)
Q Consensus       186 ~~~----lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid-~~G------~~~~~~~~~~l~~~G~iv~~G~  245 (332)
                      +++    .|..++ .....++.+ +. + ....||+|+- |+-      ...+...++.|+||||+++.-.
T Consensus       114 Ar~~a~~~G~~NV-eF~~Gdae~-LP-l-~D~SfDvViSncVlnl~pDk~~vl~E~~RVLKPGGRl~ISDi  180 (258)
T PRK11873        114 ARANARKAGYTNV-EFRLGEIEA-LP-V-ADGSVDVIISNCVINLSPDKERVFREAFRVLKPGGRFAISDV  180 (258)
T ss_pred             HHHHHHHCCCCCE-EEEEECCCC-CC-C-CCCCEEEEEECCEEECCCCHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             9999997599755-999955531-36-8-988351998824676079879999999996288978999974


No 76 
>PRK06482 short chain dehydrogenase; Provisional
Probab=96.41  E-value=0.00017  Score=48.92  Aligned_cols=104  Identities=20%  Similarity=0.266  Sum_probs=64.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC-C--CCCCCCCCCCCC-CCCCCC-CCCCCCCCC
Q ss_conf             222211344444322222122222222111223221111112-2332-2--222222211112-222222-221112222
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK-LGAK-H--AINYLKEDFLEI-LQKETQ-GRGIDIILD  220 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~-lGa~-~--vi~~~~~~~~~~-i~~~t~-g~g~Divid  220 (332)
                      +++||+||++|+|...++.+...|.+|+++.|++++++.+.+ .+-. .  .+|-++.+-.+. +.+... -.++|++++
T Consensus         3 Kv~lITGaSsGiG~ala~~l~~~G~~Vi~t~R~~~~l~~l~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDvLVN   82 (276)
T PRK06482          3 KTWFITGASSGFGRGLTERLLARGDRVAATVRRPDALDDLKARYGERLWVLQLDVTDTAAVRAVVDRAFAELGRIDVVVS   82 (276)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             78999158659999999999988998999978989999999866995799995379999999999999998099878874


Q ss_pred             CCCCC---CCC-----------------------CCCCCCC--CCCCCEEEEECCCCC
Q ss_conf             11111---122-----------------------2221122--345304798337875
Q gi|254780290|r  221 MVGAE---YLN-----------------------QHLTLLS--KEGKLIIISFLGGNI  250 (332)
Q Consensus       221 ~~G~~---~~~-----------------------~~~~~l~--~~G~iv~~G~~~~~~  250 (332)
                      +.|..   .++                       ..+..|+  .+|+++.++...+..
T Consensus        83 NAG~~~~g~~ee~~~~~~~~~~~vN~~g~~~~~ra~lP~mr~~~~G~IinisS~~g~~  140 (276)
T PRK06482         83 NAGYGLFGAAEELSDAQIRRQIDTNLTGSIQVIRAALPHLRRQGGGRIVQVSSEGGQI  140 (276)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHCCCCEEEEECCHHHCC
T ss_conf             6877788876767757799998874177999999857355755897799954524346


No 77 
>PRK08267 short chain dehydrogenase; Provisional
Probab=96.39  E-value=0.00017  Score=48.94  Aligned_cols=104  Identities=22%  Similarity=0.271  Sum_probs=65.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC----CCCCCCCC-CCCCCCCCC--CCCCCCC
Q ss_conf             2222113444443222221222222221112232211111-12233222----22222211-112222222--2211122
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKHA----INYLKEDF-LEILQKETQ--GRGIDII  218 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~v----i~~~~~~~-~~~i~~~t~--g~g~Div  218 (332)
                      +++||+||++|+|.+..+.....|++|+.+++++++.+.+ ++++.+.+    +|-++++- .+.+.+...  +..+|+.
T Consensus         2 K~vlITGassGIG~a~A~~~a~~G~~V~~~~r~~~~l~~~~~~l~~~~~~~~~~Dvtd~~~v~~~~~~~~~~~~G~iDiL   81 (258)
T PRK08267          2 KSIFITGAASGIGRATARLFAARGWRVGAYDINEDGLAALAAELGAERAWTGALDVTDRAAWDAALADFCAATGGRLDVL   81 (258)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             98999072268999999999987999999988899999999983699679999117999999999999999958998689


Q ss_pred             CCCCCCC---CCC-----------------------CCCCCCC--CCCCCEEEEECCCCC
Q ss_conf             2211111---122-----------------------2221122--345304798337875
Q gi|254780290|r  219 LDMVGAE---YLN-----------------------QHLTLLS--KEGKLIIISFLGGNI  250 (332)
Q Consensus       219 id~~G~~---~~~-----------------------~~~~~l~--~~G~iv~~G~~~~~~  250 (332)
                      +++.|-.   .++                       .++..|+  .+|+++.++...+..
T Consensus        82 VNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~m~~~~~g~IvnisS~~g~~  141 (258)
T PRK08267         82 FNNAGILRGGPFEDIPLEAHDRVIDINVKGVLNGAYAALPYLKATPGARVINTSSASAIY  141 (258)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCC
T ss_conf             988877999882449999999999997399999999999999977992799990654467


No 78 
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]
Probab=96.38  E-value=0.00055  Score=45.49  Aligned_cols=110  Identities=24%  Similarity=0.272  Sum_probs=72.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCC
Q ss_conf             2222233322211122222222222211344444322222122222222111223221111----112233222222222
Q gi|254780290|r  125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA----CLKLGAKHAINYLKE  200 (332)
Q Consensus       125 ~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~----~~~lGa~~vi~~~~~  200 (332)
                      .+.-+.+.|.  +.+...++++++||-+|  +|.|..+.-+|+..| +|+.+.+.++=.+.    ++.+|.+++ .....
T Consensus        54 tis~P~~vA~--m~~~L~~~~g~~VLEIG--tGsGY~aAvla~l~~-~V~siEr~~~L~~~A~~~L~~lg~~nV-~v~~g  127 (209)
T COG2518          54 TISAPHMVAR--MLQLLELKPGDRVLEIG--TGSGYQAAVLARLVG-RVVSIERIEELAEQARRNLETLGYENV-TVRHG  127 (209)
T ss_pred             EECCCHHHHH--HHHHHCCCCCCEEEEEC--CCCHHHHHHHHHHHC-EEEEEEECHHHHHHHHHHHHHCCCCCE-EEEEC
T ss_conf             5057479999--99974899998688877--783099999999748-499999719999999999997698734-99978


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCEEE
Q ss_conf             111122222222211122221111112-2222112234530479
Q gi|254780290|r  201 DFLEILQKETQGRGIDIILDMVGAEYL-NQHLTLLSKEGKLIII  243 (332)
Q Consensus       201 ~~~~~i~~~t~g~g~Divid~~G~~~~-~~~~~~l~~~G~iv~~  243 (332)
                      |-..-.   ....++|.|+-+.+.+.. +..++.|++||+++..
T Consensus       128 DG~~G~---~~~aPyD~I~Vtaaa~~vP~~Ll~QL~~gGrlv~P  168 (209)
T COG2518         128 DGSKGW---PEEAPYDRIIVTAAAPEVPEALLDQLKPGGRLVIP  168 (209)
T ss_pred             CCCCCC---CCCCCCCEEEEEECCCCCCHHHHHHCCCCCEEEEE
T ss_conf             855688---77798478999503577998999850659889999


No 79 
>PRK07832 short chain dehydrogenase; Provisional
Probab=96.37  E-value=0.00027  Score=47.57  Aligned_cols=76  Identities=18%  Similarity=0.362  Sum_probs=51.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC----CCCCCCCCCC----CCCCCCCCCCC
Q ss_conf             2222113444443222221222222221112232211111----1223322----2222222111----12222222221
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH----AINYLKEDFL----EILQKETQGRG  214 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~----vi~~~~~~~~----~~i~~~t~g~g  214 (332)
                      ++++|+||++|+|...++-+...|++|+.+++++++.+.+    +..|.+.    ..|-++.+-.    +++.+..  .+
T Consensus         1 K~alITGassGIG~a~A~~la~~Ga~v~l~~r~~~~l~~~~~~l~~~g~~~~~~~~~Dvsd~~~v~~~~~~~~~~~--g~   78 (272)
T PRK07832          1 KRCFVTGAASGIGRATALRLAAQGAELFLTDRDADGLAQTVADARALGGTVPEHRALDISDYDAVAAFAADIHAAH--PS   78 (272)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHC--CC
T ss_conf             9799947201999999999998899899998988999999999984589714788566899999999999999972--99


Q ss_pred             CCCCCCCCCC
Q ss_conf             1122221111
Q gi|254780290|r  215 IDIILDMVGA  224 (332)
Q Consensus       215 ~Divid~~G~  224 (332)
                      +|+++++.|-
T Consensus        79 iDiLiNNAGi   88 (272)
T PRK07832         79 MDVVMNIAGI   88 (272)
T ss_pred             CCEEEECCCC
T ss_conf             8889987876


No 80 
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]
Probab=96.36  E-value=0.00041  Score=46.33  Aligned_cols=108  Identities=25%  Similarity=0.377  Sum_probs=72.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCC
Q ss_conf             22211122222222222211344444322222122222222111223221111112----23322222222211112222
Q gi|254780290|r  133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQK  208 (332)
Q Consensus       133 A~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~  208 (332)
                      ++..+.++.+++||+++|=+| || =|.+++..|+..|++|++++-|++..+.+++    .|.+.-+.-.-.|+    +.
T Consensus        60 k~~~~~~kl~L~~G~~lLDiG-CG-WG~l~~~aA~~y~v~V~GvTlS~~Q~~~~~~r~~~~gl~~~v~v~l~d~----rd  133 (283)
T COG2230          60 KLDLILEKLGLKPGMTLLDIG-CG-WGGLAIYAAEEYGVTVVGVTLSEEQLAYAEKRIAARGLEDNVEVRLQDY----RD  133 (283)
T ss_pred             HHHHHHHHCCCCCCCEEEEEC-CC-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEECCC----CC
T ss_conf             999999756999999898747-88-4499999999849979996689999999999999759976607996562----10


Q ss_pred             CCCCCCCCCC-----CCCCCC----CCCCCCCCCCCCCCCCEEEEECCC
Q ss_conf             2222211122-----221111----112222211223453047983378
Q gi|254780290|r  209 ETQGRGIDII-----LDMVGA----EYLNQHLTLLSKEGKLIIISFLGG  248 (332)
Q Consensus       209 ~t~g~g~Div-----id~~G~----~~~~~~~~~l~~~G~iv~~G~~~~  248 (332)
                      ..+  .||.|     |+.+|.    +.++.+.++|+++|++..-.....
T Consensus       134 ~~e--~fDrIvSvgmfEhvg~~~~~~ff~~~~~~L~~~G~~llh~I~~~  180 (283)
T COG2230         134 FEE--PFDRIVSVGMFEHVGKENYDDFFKKVYALLKPGGRMLLHSITGP  180 (283)
T ss_pred             CCC--CCCEEEEHHHHHHHCCCCHHHHHHHHHHHCCCCCEEEEEEECCC
T ss_conf             324--34205560068873710289999999964599965999996678


No 81 
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT).
Probab=96.35  E-value=0.00052  Score=45.63  Aligned_cols=112  Identities=21%  Similarity=0.230  Sum_probs=69.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCC----CCCCCCCCCC
Q ss_conf             222222333222111222222222222113444443222221222222--2211122322111111----2233222222
Q gi|254780290|r  124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA--TVYTTAKSEEKCLACL----KLGAKHAINY  197 (332)
Q Consensus       124 a~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~--~vi~~~~~~~~~~~~~----~lGa~~vi~~  197 (332)
                      ..+..+.+.|.  +.+..++++|++||..|  +|.|..++-+|+..|-  +|+++.++++-.+.++    ++|.+++. .
T Consensus        54 ~tis~P~~~a~--ml~~L~l~~g~~VLeIG--tGsGY~tAlLa~l~~~~g~V~~iE~~~~l~~~A~~~l~~~~~~nV~-~  128 (205)
T pfam01135        54 QTISAPHMHAM--MLELLELKPGMRVLEIG--SGSGYLTACFARMVGEVGRVVSIEHIPELVEIARRNLEKLGLENVI-V  128 (205)
T ss_pred             CEECHHHHHHH--HHHHCCCCCCCEEEEEC--CCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEE-E
T ss_conf             88863899999--99970789999899966--9965999999998387876999835899999999999984888658-9


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCEEE
Q ss_conf             222111122222222211122221111112-2222112234530479
Q gi|254780290|r  198 LKEDFLEILQKETQGRGIDIILDMVGAEYL-NQHLTLLSKEGKLIII  243 (332)
Q Consensus       198 ~~~~~~~~i~~~t~g~g~Divid~~G~~~~-~~~~~~l~~~G~iv~~  243 (332)
                      ...|..+-..   ...+||.|+-+.+.+.. ...++.|++||+++..
T Consensus       129 ~~gdg~~g~~---~~apfD~Iiv~aa~~~iP~~l~~qL~~gGrLv~p  172 (205)
T pfam01135       129 VVGDGRQGWP---EFAPYDAIHVGAAAPEIPEALIDQLKEGGRLVIP  172 (205)
T ss_pred             EECCCCCCCC---CCCCCCEEEEEEECCCCCHHHHHHCCCCCEEEEE
T ss_conf             8456455883---3398058999750676889999962879789999


No 82 
>PRK07024 short chain dehydrogenase; Provisional
Probab=96.35  E-value=0.00021  Score=48.22  Aligned_cols=75  Identities=25%  Similarity=0.271  Sum_probs=49.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC----CCCCCCCCCCC----CCCCCCCCCCCCC
Q ss_conf             2222113444443222221222222221112232211111-1223322----22222221111----2222222221112
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKH----AINYLKEDFLE----ILQKETQGRGIDI  217 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~----vi~~~~~~~~~----~i~~~t~g~g~Di  217 (332)
                      ++|||+||++|+|...++.....|++|+.+++++++++.+ .+++...    .+|-++.+-.+    ++.+..  .+.|+
T Consensus         3 ~~VlITGassGIG~a~A~~la~~G~~v~l~~R~~~~L~~~~~~~~~~~~~~~~~Dv~d~~~~~~~~~~~~~~~--g~iDi   80 (256)
T PRK07024          3 LKVFITGASSGIGQALAREYARQGATLGLVARRTDALQAFAARLPKARVSVYAADVRDADALAAAAADFIAAH--GCPDV   80 (256)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHH--CCCCE
T ss_conf             9899984602999999999998899899998988999999997679976999811799999999999999983--99879


Q ss_pred             CCCCCC
Q ss_conf             222111
Q gi|254780290|r  218 ILDMVG  223 (332)
Q Consensus       218 vid~~G  223 (332)
                      ++++.|
T Consensus        81 linNAG   86 (256)
T PRK07024         81 VIANAG   86 (256)
T ss_pred             EEECCC
T ss_conf             998885


No 83 
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional
Probab=96.34  E-value=0.00028  Score=47.46  Aligned_cols=103  Identities=21%  Similarity=0.350  Sum_probs=65.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----12233222---2222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++|+|...+..+...|++|+.+.+++++.+.+    ++.|.+..   .|-++++    +.+++.+..+  
T Consensus         6 ~gKvalVTGgs~GIG~a~A~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G--   83 (262)
T PRK13394          6 NGKTAVVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVADEINKAGGKAIGVAMDVTNEDAVNAGIDKVAERFG--   83 (262)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHC--
T ss_conf             999899958577899999999998799999997988999999999996299399998158999999999999999819--


Q ss_pred             CCCCCCCCCCCCC---CC-----------------------CCCCCC---CCCCCCEEEEECCCC
Q ss_conf             1112222111111---22-----------------------222112---234530479833787
Q gi|254780290|r  214 GIDIILDMVGAEY---LN-----------------------QHLTLL---SKEGKLIIISFLGGN  249 (332)
Q Consensus       214 g~Divid~~G~~~---~~-----------------------~~~~~l---~~~G~iv~~G~~~~~  249 (332)
                      ++|+.+++.|...   ++                       .+++.|   +.+|+++.++...+.
T Consensus        84 ~iDiLVnnAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~M~k~~~~G~IVnisS~~~~  148 (262)
T PRK13394         84 SVDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSH  148 (262)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC
T ss_conf             99999989988999991659999999999997589999999999999983799689997457767


No 84 
>PRK07806 short chain dehydrogenase; Provisional
Probab=96.34  E-value=0.00024  Score=47.82  Aligned_cols=100  Identities=19%  Similarity=0.356  Sum_probs=62.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC----CCCCCCCCCC---CCCCCCCC----CCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232-2111----1112233222---22222211----1122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE-EKCL----ACLKLGAKHA---INYLKEDF----LEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~-~~~~----~~~~lGa~~v---i~~~~~~~----~~~i~~~t~g  212 (332)
                      .|+++||+||++++|...++.+...|++|+.+.++. ++.+    .+++.|.+..   .|-++++-    .+++.+.. |
T Consensus         5 ~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~~~~~~~a~~~~~~i~~~g~~a~~~~~Dvtd~~~v~~l~~~~~~~~-G   83 (248)
T PRK07806          5 PGKIALVTGSSRGIGAEVAKYLAGAGAHVVVNYRNKAARAEKVVAEIRAAGGRASAVGADLTDEASVAALMDAIRAEF-G   83 (248)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHC-C
T ss_conf             998899937885999999999998799899983895689999999999619839999789999999999999999984-9


Q ss_pred             CCCCCCCCCCCCC--------------------CCCCCCCCCCCCCCCEEEEEC
Q ss_conf             2111222211111--------------------122222112234530479833
Q gi|254780290|r  213 RGIDIILDMVGAE--------------------YLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       213 ~g~Divid~~G~~--------------------~~~~~~~~l~~~G~iv~~G~~  246 (332)
                       ++|+.+++.|..                    .+..++.+++.+|+++.++..
T Consensus        84 -~iDiLVnNAg~~~~~~~~~~~~~~~n~~~~~~~~~~~~p~m~~gg~Ii~isS~  136 (248)
T PRK07806         84 -GLDALVLNASGGMESGMDPDYAMRLNRDAQRRLLTLALPLMPAGSRVVFVTSH  136 (248)
T ss_pred             -CCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             -99899989999877899722689999899999999999775049789998551


No 85 
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase. Members of this family occur as the BphD protein of biphenyl catabolism and as the TodD protein of toluene catabolism. Members catalyze the second step in each pathway and proved interchangeable when tested; the first and fourth enzymes in each pathway confer metabolic specificity. In the context of biphenyl degradation, the enzyme acts as cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC 1.3.1.56), while in toluene degradation it acts as cis-toluene dihydrodiol dehydrogenase.
Probab=96.30  E-value=0.00022  Score=48.08  Aligned_cols=77  Identities=25%  Similarity=0.263  Sum_probs=52.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC---CCCCCCCC----CCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112-23322---22222221----111222222222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK-LGAKH---AINYLKED----FLEILQKETQGRGID  216 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~-lGa~~---vi~~~~~~----~~~~i~~~t~g~g~D  216 (332)
                      .|+++||+||++|+|.+.++-....|++|+.+.+++++.+.+++ .|...   ..|-++.+    +.+++.+.. | ++|
T Consensus         4 ~gKvalITGgs~GIG~aia~~~a~~Ga~V~i~~r~~~~l~~~~~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~-G-~iD   81 (262)
T TIGR03325         4 KGEVVLVTGGASGLGRAIVDRFVAEGARVAVLDKSAAGLQELEAAHGDAVVGVEGDVRSLDDHKEAVARCVAAF-G-KID   81 (262)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH-C-CCC
T ss_conf             99889990678789999999999879999999899899999998679967999845799999999999999984-9-988


Q ss_pred             CCCCCCC
Q ss_conf             2222111
Q gi|254780290|r  217 IILDMVG  223 (332)
Q Consensus       217 ivid~~G  223 (332)
                      +.+++.|
T Consensus        82 iLVnNAG   88 (262)
T TIGR03325        82 CLIPNAG   88 (262)
T ss_pred             EEEECCC
T ss_conf             8997265


No 86 
>PRK06484 short chain dehydrogenase; Validated
Probab=96.30  E-value=0.00029  Score=47.28  Aligned_cols=181  Identities=18%  Similarity=0.208  Sum_probs=92.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC---CCCCCC----CCCCCCCCCCCCCC
Q ss_conf             22222221134444432222212222222211122322111-11122332222---222221----11122222222211
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL-ACLKLGAKHAI---NYLKED----FLEILQKETQGRGI  215 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~-~~~~lGa~~vi---~~~~~~----~~~~i~~~t~g~g~  215 (332)
                      .+|+.+||+||++|+|.+.+......|++|+..+++++..+ .++++|.+...   |-++++    +.+++.+.. | ++
T Consensus       272 ~kGKvalVTGaa~GIG~aiA~~la~~GA~Vvi~d~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~f-G-~i  349 (530)
T PRK06484        272 RAGRVVCVTGGASGIGAAIADRFAALGDRVAIIDSDGEEAVKLREILGGEHLSWQVDITDEASVESAFAGIQGRL-G-PL  349 (530)
T ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHC-C-CC
T ss_conf             789899992876789999999999887989999588899999999739973699953899999999999999982-9-98


Q ss_pred             CCCCCCCCC-C----CCC----------------------CCCCCC-CCCCCCEEEEECCCCCCCCCC------------
Q ss_conf             122221111-1----122----------------------222112-234530479833787543222------------
Q gi|254780290|r  216 DIILDMVGA-E----YLN----------------------QHLTLL-SKEGKLIIISFLGGNIATEIN------------  255 (332)
Q Consensus       216 Divid~~G~-~----~~~----------------------~~~~~l-~~~G~iv~~G~~~~~~~~~~~------------  255 (332)
                      |+++++.|. .    ..+                      .+++.| +.+|+++.++...+.....-.            
T Consensus       350 DiLVNNAGi~~~~~~~~e~t~e~w~~v~~vNl~g~f~~~~~~~~~m~~~gG~IVnisS~~~~~~~~~~~~Y~asKaav~~  429 (530)
T PRK06484        350 DVLVNNAGIAEPFAPSAEQSLEDFRRTIDVNLKGAFHCSREAARQMGAGGGVIVNLGSITSLLALPPRHAYGASKAAITM  429 (530)
T ss_pred             CEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             89998977898999800099999999999971999999999999731489769997164436588995799999999999


Q ss_pred             -----CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC---CCCCCE
Q ss_conf             -----433430532167775124000113789999999999999869831021247418999999999982---998132
Q gi|254780290|r  256 -----LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK---SEHIGK  327 (332)
Q Consensus       256 -----~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~---g~~~GK  327 (332)
                           ..++-..++++....-+...-.........- ..-.+.+.+.  .| +.+.-.-+|+..+.-.|.+   .-.+|-
T Consensus       430 lTr~lA~E~a~~gIrVN~I~PG~i~T~~~~~~~~~~-~~~~~~~~~~--~P-l~R~g~pediA~~v~fLaSd~a~~iTG~  505 (530)
T PRK06484        430 LTRCLAAELAPHGIRVNTVAPGYILTPAVQALLASG-RRDMNSIRRR--IP-LGRLGQPEEVAEAAYFLASPAASYINGA  505 (530)
T ss_pred             HHHHHHHHHHHHCEEEEEEEECCCCCHHHHHHHHCC-HHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             999999996043919998987778870454433135-7889999855--99-8997789999999999828500686688


Q ss_pred             EEE
Q ss_conf             898
Q gi|254780290|r  328 IIL  330 (332)
Q Consensus       328 vVi  330 (332)
                      ++.
T Consensus       506 ~i~  508 (530)
T PRK06484        506 TLQ  508 (530)
T ss_pred             EEE
T ss_conf             798


No 87 
>PRK06125 short chain dehydrogenase; Provisional
Probab=96.30  E-value=0.00027  Score=47.49  Aligned_cols=78  Identities=32%  Similarity=0.471  Sum_probs=54.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC----CCC---CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111-22----332---222222221111222222222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-KL----GAK---HAINYLKEDFLEILQKETQGRGID  216 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~l----Ga~---~vi~~~~~~~~~~i~~~t~g~g~D  216 (332)
                      .|+++||+||++|+|...++-+...|++|+.+.+++++.+.+. ++    +..   ...|-++.+..+++.+..+  ++|
T Consensus         6 ~gK~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~g--~iD   83 (259)
T PRK06125          6 AGKRVLITGASKGIGAAAAEAFAAEGCHLVLAARDADALAALAADLRAAHGVDVAVHALDLSSPEAREQLAAEAG--DID   83 (259)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHC--CCC
T ss_conf             999899968776899999999998799899997988999999999987009866999888999999999999858--998


Q ss_pred             CCCCCCCC
Q ss_conf             22221111
Q gi|254780290|r  217 IILDMVGA  224 (332)
Q Consensus       217 ivid~~G~  224 (332)
                      +.+++.|.
T Consensus        84 iLVnnAG~   91 (259)
T PRK06125         84 ILVNNAGA   91 (259)
T ss_pred             EEEECCCC
T ss_conf             99976877


No 88 
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=96.30  E-value=0.00031  Score=47.10  Aligned_cols=78  Identities=28%  Similarity=0.356  Sum_probs=53.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----12233222---2222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|++++|+||++|+|.+..+.+...|++|+.+.+++++.+.+    ++.|....   .|-++.+    +.+++.+..+  
T Consensus         5 ~gKvalITGas~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~i~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G--   82 (238)
T PRK07666          5 QGKNALITGAGRGIGRAVAIALAKEGVNVGLLARSEENLKAVAKEVEAEGVKAVIATADVSDYEEVTTAIETLKNGLG--   82 (238)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHC--
T ss_conf             999899916377899999999998799899998999999999999995599279999307999999999999999819--


Q ss_pred             CCCCCCCCCCC
Q ss_conf             11122221111
Q gi|254780290|r  214 GIDIILDMVGA  224 (332)
Q Consensus       214 g~Divid~~G~  224 (332)
                      ++|+.+++.|.
T Consensus        83 ~iDiLVNNAGi   93 (238)
T PRK07666         83 SIDILINNAGI   93 (238)
T ss_pred             CCCEEEECCCC
T ss_conf             98789984745


No 89 
>PRK07825 short chain dehydrogenase; Provisional
Probab=96.25  E-value=0.00024  Score=47.81  Aligned_cols=104  Identities=22%  Similarity=0.416  Sum_probs=65.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC--CCCCCCCC----CCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111-11223322--22222221----1112222222221112
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA-CLKLGAKH--AINYLKED----FLEILQKETQGRGIDI  217 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~-~~~lGa~~--vi~~~~~~----~~~~i~~~t~g~g~Di  217 (332)
                      .|++++|+||++|+|.+..+.+...|++|+.+++++++.+. +.++|...  .+|-++.+    +.+++.+..  .++|+
T Consensus         4 ~gKvvlITGassGIG~a~A~~la~~Ga~V~i~~r~~~~l~~~~~~~~~~~~~~~DVtd~~~v~~~~~~~~~~~--G~iDi   81 (273)
T PRK07825          4 RGKVIAITGGARGIGLATARALAALGAKVAIGDLDEALAKESAAELGLVVGGPLDVTDPASFAAFLDAVEADL--GPIDV   81 (273)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH--CCCCE
T ss_conf             9988999262339999999999987998999979999999999860785599914799999999999999970--99778


Q ss_pred             CCCCCCCC----CCC----------------------CCCCCC--CCCCCCEEEEECCCCC
Q ss_conf             22211111----122----------------------222112--2345304798337875
Q gi|254780290|r  218 ILDMVGAE----YLN----------------------QHLTLL--SKEGKLIIISFLGGNI  250 (332)
Q Consensus       218 vid~~G~~----~~~----------------------~~~~~l--~~~G~iv~~G~~~~~~  250 (332)
                      .+++.|..    ..+                      ..+..|  +..|+++.++...+..
T Consensus        82 LVNNAGi~~~~~~~e~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IVnisS~ag~~  142 (273)
T PRK07825         82 LVNNAGIMPVGPFLDEPDRATRRILDVNVYGVILGSKLAAPRMVPRGRGHIVNVASLAGKI  142 (273)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHC
T ss_conf             9987877899873439999999998860399999999999999973994799984767647


No 90 
>PRK06194 hypothetical protein; Provisional
Probab=96.24  E-value=0.0003  Score=47.18  Aligned_cols=78  Identities=14%  Similarity=0.298  Sum_probs=52.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCCCC----CCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----1223322---2222222111----1222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKEDFL----EILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~~~----~~i~~~t~g~  213 (332)
                      .|++++|+||++|+|.+..+.+...|++|+.+++++++++.+    ++.|.+.   ..|-++++-.    +.+.+.. | 
T Consensus         5 ~gKvavITGassGIG~a~A~~la~~Ga~Vvl~d~~~~~l~~~~~~l~~~g~~v~~~~~DVsd~~~v~~l~~~~~~~f-G-   82 (301)
T PRK06194          5 AGKVAVITGAASGFGREFARIGARLGMKLVLADVQQDALDRAVAELRAQGAEVLGVRTDVSDAAQVEALADAALERF-G-   82 (301)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH-C-
T ss_conf             99989992737799999999999879989999798899999999998459849999656899999999999999983-9-


Q ss_pred             CCCCCCCCCCC
Q ss_conf             11122221111
Q gi|254780290|r  214 GIDIILDMVGA  224 (332)
Q Consensus       214 g~Divid~~G~  224 (332)
                      .+|+++++.|.
T Consensus        83 ~iDiLVNNAGi   93 (301)
T PRK06194         83 AVHLLFNNAGV   93 (301)
T ss_pred             CEEEEEECCCC
T ss_conf             93799955766


No 91 
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional
Probab=96.22  E-value=0.00064  Score=45.07  Aligned_cols=114  Identities=21%  Similarity=0.265  Sum_probs=73.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCC----CCCCCCCCCCC
Q ss_conf             21222222333222111222222222222113444443222221222222--2211122322111----11122332222
Q gi|254780290|r  122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA--TVYTTAKSEEKCL----ACLKLGAKHAI  195 (332)
Q Consensus       122 ~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~--~vi~~~~~~~~~~----~~~~lGa~~vi  195 (332)
                      ..+++.-+++.|+.  .+..++++|++||=.|  +|.|..|.-+|+..|-  +|+.+.+.++=.+    .++++|.+++.
T Consensus        54 ~~sTISqP~iVA~M--lElL~l~pg~rVLEIG--TGSGYqAAlLA~Lvg~~G~V~TIE~~~~L~~~Ar~~L~~lG~~NV~  129 (317)
T PRK13943         54 EYSTSSQPSLMALF--MEWVGLDKGMRVLEIG--GGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVERLGIENVI  129 (317)
T ss_pred             CCEEECHHHHHHHH--HHHHCCCCCCEEEEEC--CCCCHHHHHHHHHHCCCCEEEEEEECHHHHHHHHHHHHHCCCCCEE
T ss_conf             46574168999999--9971789998689965--7743899999998487875999986799999999999977998649


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCEEE
Q ss_conf             22222111122222222211122221111112-2222112234530479
Q gi|254780290|r  196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYL-NQHLTLLSKEGKLIII  243 (332)
Q Consensus       196 ~~~~~~~~~~i~~~t~g~g~Divid~~G~~~~-~~~~~~l~~~G~iv~~  243 (332)
                      -. ..|-..-..   ...++|.|+-+.+.+.+ +..++-|++||+++.=
T Consensus       130 vv-~GDG~~G~p---e~APYD~IIVTAaa~~IP~aLldQLk~GGRLViP  174 (317)
T PRK13943        130 FV-CGDGYYGVP---EFSPYDVIFVTVGVDEVPETWFTQLKEGGRVIVP  174 (317)
T ss_pred             EE-ECCCCCCCC---CCCCCCEEEEEECCCCCCHHHHHHCCCCCEEEEE
T ss_conf             99-799888886---6799778999852764899999961859699998


No 92 
>PRK07578 short chain dehydrogenase; Provisional
Probab=96.18  E-value=0.0015  Score=42.57  Aligned_cols=88  Identities=18%  Similarity=0.260  Sum_probs=48.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--
Q ss_conf             222113444443222221222222221112232211111122332222222221111222222222111222211111--
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAE--  225 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~--  225 (332)
                      +|||+||++|+|.+.++.+. .+.+|+.+.++....          .+|-++++-.+.+.+.. | ++|+++++.|..  
T Consensus         2 rVlVTGas~GIG~aia~~la-~~~~vv~~~r~~~~~----------~~Dvtd~~~v~~~~~~~-G-~iD~lVnnAG~~~~   68 (199)
T PRK07578          2 KILVIGASGTIGRAVVAELS-ARHEVITAGRSSGDV----------QVDITDPASIRALFEKV-G-KVDAVVSAAGKVHF   68 (199)
T ss_pred             EEEEECCCCHHHHHHHHHHH-CCCCEEEEECCCCCE----------EEECCCHHHHHHHHHHH-C-CCCEEEECCCCCCC
T ss_conf             79999987489999999996-799989983686775----------68588999999999962-9-99899988722679


Q ss_pred             ------------------------CCCCCCCCCCCCCCCEEEEECCC
Q ss_conf             ------------------------12222211223453047983378
Q gi|254780290|r  226 ------------------------YLNQHLTLLSKEGKLIIISFLGG  248 (332)
Q Consensus       226 ------------------------~~~~~~~~l~~~G~iv~~G~~~~  248 (332)
                                              ......+.++.+|.++.++...+
T Consensus        69 ~~~~~~~~e~~~~~~~~nl~g~~~l~~~~~~~l~~gGsIv~isS~~~  115 (199)
T PRK07578         69 APLTEMTDEDFQLGLQSKLMGQINLVLIGQEYLNDGGSFTLTSGILS  115 (199)
T ss_pred             CCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEHHE
T ss_conf             89487999897778720013899999999998760898568831300


No 93 
>PRK06841 short chain dehydrogenase; Provisional
Probab=96.16  E-value=0.00034  Score=46.89  Aligned_cols=178  Identities=17%  Similarity=0.173  Sum_probs=91.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC---CCCCCCCCC----CCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111122-332---222222221----111222222222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKL-GAK---HAINYLKED----FLEILQKETQGRGID  216 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~l-Ga~---~vi~~~~~~----~~~~i~~~t~g~g~D  216 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.++++++..+.+.++ |..   ...|-++++    +.+++.+..+  ++|
T Consensus        14 ~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~d~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~g--~iD   91 (255)
T PRK06841         14 SGKVAVVTGGASGIGHAIAELFAAKGARVALLDRSEDVAEVAAQLLGGNAKGLVCDVSDSQSVEAAVAAAISAFG--RID   91 (255)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHC--CCC
T ss_conf             999999979677899999999998799999996987899999984599669999846999999999999999819--987


Q ss_pred             CCCCCCCCCC-----------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC-------------
Q ss_conf             2222111111-----------22---------------222112--234530479833787543222-------------
Q gi|254780290|r  217 IILDMVGAEY-----------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN-------------  255 (332)
Q Consensus       217 ivid~~G~~~-----------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~-------------  255 (332)
                      +.+++.|...           |+               .+++.+  +.+|+++.++...+....+-.             
T Consensus        92 iLVNNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~G~IInisS~~~~~~~~~~~~Y~asKaav~~l  171 (255)
T PRK06841         92 ILVNSAGVALLAPAEDVSEADWDKTIDINLKGSFLMAQAVGRHMIAAGGGKIVNLASQAGVVALERHVAYCASKAGVVGM  171 (255)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             99989978999980449999999999985599999999999999982996599994666566899858899999999999


Q ss_pred             ----CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CCCCEE
Q ss_conf             ----4334305321677751240001137899999999999998698310212474189999999999829---981328
Q gi|254780290|r  256 ----LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EHIGKI  328 (332)
Q Consensus       256 ----~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~~GKv  328 (332)
                          ..++-..++++....-+... .  +.....+..+..+.+.+.  .| ..+.-.-+|+..+.-.|.+-   -.+|-+
T Consensus       172 trslA~ela~~gIrVNaVaPG~i~-T--~~~~~~~~~~~~~~~~~~--~P-l~R~g~pediA~~v~fLaSd~ss~iTG~~  245 (255)
T PRK06841        172 TKVLALEWGPHGITVNAISPTVVL-T--ELGKKAWAGEKGERAKKL--IP-AGRFAYPEEIAAAALFLASDAAAMITGEN  245 (255)
T ss_pred             HHHHHHHHHHCCEEEEEEEECCCC-C--CHHHHCCCCHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCCCCE
T ss_conf             999999970309599998538897-7--034332474889999855--99-99977899999999999687323855870


Q ss_pred             EE
Q ss_conf             98
Q gi|254780290|r  329 IL  330 (332)
Q Consensus       329 Vi  330 (332)
                      +.
T Consensus       246 i~  247 (255)
T PRK06841        246 LV  247 (255)
T ss_pred             EE
T ss_conf             89


No 94 
>PRK06398 aldose dehydrogenase; Validated
Probab=96.15  E-value=0.00056  Score=45.41  Aligned_cols=99  Identities=22%  Similarity=0.363  Sum_probs=60.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111-1112233222222222----1111222222222111222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL-ACLKLGAKHAINYLKE----DFLEILQKETQGRGIDIIL  219 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~-~~~~lGa~~vi~~~~~----~~~~~i~~~t~g~g~Divi  219 (332)
                      .|++++|+||++|+|.+.++.....|++|+.+.+++++.. .+..+.+    |-+++    ++.+++.+..+  ++|+.+
T Consensus         5 ~gKvalVTGgs~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~i~~----Dvt~~~~v~~~v~~~~~~~G--~iDiLV   78 (256)
T PRK06398          5 RDKVVIVTGGSSGIGLAIVSRFVDEGSKVVSISRSEPEDINKSDHIKC----DVTNEDEVKNAINEISKKYG--RIDVLV   78 (256)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCEEEE----CCCCHHHHHHHHHHHHHHCC--CCCEEE
T ss_conf             989899968787899999999998699999994875125172238985----47999999999999999839--997999


Q ss_pred             CCCCCCC-----------CC---------------CCCCCC--CCCCCCEEEEECCCC
Q ss_conf             2111111-----------22---------------222112--234530479833787
Q gi|254780290|r  220 DMVGAEY-----------LN---------------QHLTLL--SKEGKLIIISFLGGN  249 (332)
Q Consensus       220 d~~G~~~-----------~~---------------~~~~~l--~~~G~iv~~G~~~~~  249 (332)
                      ++.|...           |+               .+++.|  ..+|+++.++...+.
T Consensus        79 NNAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~  136 (256)
T PRK06398         79 NNAGIEKYGSLHKTDSGTWRRIIDVNVNGVYYMSKEVIPHMLRSGTGSIVNISSVQAD  136 (256)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             8999999999044999999999999736289999999999998399579998040207


No 95 
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclo
Probab=96.15  E-value=0.0043  Score=39.58  Aligned_cols=90  Identities=20%  Similarity=0.283  Sum_probs=54.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111-----223322-2222222111122222222211122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-----KLGAKH-AINYLKEDFLEILQKETQGRGIDII  218 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-----~lGa~~-vi~~~~~~~~~~i~~~t~g~g~Div  218 (332)
                      +|.+++|+||+|+||..+..++...|++|+-+.|+.+|.+.+.     ++|.+. .++..+.   +...+..  ...|+|
T Consensus        27 ~g~~~~V~G~tG~vG~~~A~~lA~~Ga~v~lv~R~~ek~~~~a~~i~~r~g~~~~~~~~~~~---~~~~~~l--~~adiV  101 (194)
T cd01078          27 KGKTAVVLGGTGPVGQRAAVLLAREGARVVLVGRDLERAQKAADSLRARFGEGVGAVETSDD---AARAAAI--KGADVV  101 (194)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCH---HHHHHHH--CCCCEE
T ss_conf             79889998588578999999999839979999587888999999999970987311357887---7899774--669899


Q ss_pred             CCCCCC--CCCCCCCCCCCCCCCC
Q ss_conf             221111--1122222112234530
Q gi|254780290|r  219 LDMVGA--EYLNQHLTLLSKEGKL  240 (332)
Q Consensus       219 id~~G~--~~~~~~~~~l~~~G~i  240 (332)
                      |.+...  ..+.......++ +++
T Consensus       102 ~~a~aAGv~~~~~~~~~~k~-l~V  124 (194)
T cd01078         102 FAAGAAGVELLEKLAWAPKP-LAV  124 (194)
T ss_pred             EECCHHHHHHHHHHHHCCCC-CEE
T ss_conf             96427778887888850888-659


No 96 
>PRK06179 short chain dehydrogenase; Provisional
Probab=96.13  E-value=0.00043  Score=46.20  Aligned_cols=103  Identities=19%  Similarity=0.330  Sum_probs=62.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111122332222222221----1112222222221112222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKED----FLEILQKETQGRGIDIILD  220 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~----~~~~i~~~t~g~g~Divid  220 (332)
                      .++.++|+||++|+|.+..+.+...|++|+.++++.++.+.+...-. ..+|-++++    +.+++.+.. | .+|+.++
T Consensus         3 ~~KvalITGassGIG~a~A~~la~~G~~V~~~~r~~~~~~~~~~~~~-~~~Dvtd~~~v~~~~~~~~~~~-g-~iDiLVN   79 (270)
T PRK06179          3 NKKVALVTGASSGIGRATAEALARAGYRVFGTSRNPARATPIPGVEL-LELDVTDDASVQAAVQEVIARA-G-RIDVLVN   79 (270)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCCCEE-EEEECCCHHHHHHHHHHHHHHH-C-CCCEEEE
T ss_conf             99589990724699999999999879999999689777305489789-9910799999999999999983-9-9888998


Q ss_pred             CCCCCC-----------CC---------------CCCCCCC--CCCCCEEEEECCCCC
Q ss_conf             111111-----------22---------------2221122--345304798337875
Q gi|254780290|r  221 MVGAEY-----------LN---------------QHLTLLS--KEGKLIIISFLGGNI  250 (332)
Q Consensus       221 ~~G~~~-----------~~---------------~~~~~l~--~~G~iv~~G~~~~~~  250 (332)
                      +.|...           ++               ..+..|+  .+|+++.++...+..
T Consensus        80 NAGi~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~~g~~  137 (270)
T PRK06179         80 NAGVGLLGAAEETSIAQAQALFDTNVFGILRMTNAVLPHMRAQGSGRIINISSVLGFL  137 (270)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHC
T ss_conf             9866678875759899999998874489999998742022017995899986856627


No 97 
>PRK06720 hypothetical protein; Provisional
Probab=96.12  E-value=0.00047  Score=45.94  Aligned_cols=48  Identities=31%  Similarity=0.479  Sum_probs=38.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC
Q ss_conf             22222211344444322222122222222111223221111----1122332
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA----CLKLGAK  192 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~----~~~lGa~  192 (332)
                      .|++++|+||++|+|...+......|++|+.+++++++.+.    ++..|.+
T Consensus        15 ~gKvalITGa~~GIG~a~A~~la~~Ga~Vvi~d~~~~~~~~~~~~i~~~g~~   66 (169)
T PRK06720         15 AGKVAIVTGGGIGIGRNTALLLAKQGAKVIVTDIDQESGQATVEEITNLGGE   66 (169)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCC
T ss_conf             9999999897548999999999986998999527636599999999974995


No 98 
>PRK07060 short chain dehydrogenase; Provisional
Probab=96.12  E-value=0.00047  Score=45.95  Aligned_cols=179  Identities=13%  Similarity=0.125  Sum_probs=93.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-1223322-22222221111222222222111222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKH-AINYLKEDFLEILQKETQGRGIDIILDMV  222 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~-vi~~~~~~~~~~i~~~t~g~g~Divid~~  222 (332)
                      .|++++|+||++|+|.+.++.....|++|+.+.++++..+.+ .+++.+. ..|-.++...+...+..  ..+|+.+++.
T Consensus         8 ~gK~~lVTG~~~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~--g~iDilVnnA   85 (245)
T PRK07060          8 SGKSVLVTGASSGIGRACAVALAARGARVVAAARNQADLDRLAGETGCEPLRLDVGDDAAIRAALAGA--GAFDGLVNCA   85 (245)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCEEEEEECCCHHHHHHHHHHC--CCCCEEEECC
T ss_conf             99989994777689999999999879999999799899999998639879998079999999999965--9998999898


Q ss_pred             CCCC----CC----------------------CCCCCC---CCCCCCEEEEECCCCCCCCCC-----------------C
Q ss_conf             1111----22----------------------222112---234530479833787543222-----------------4
Q gi|254780290|r  223 GAEY----LN----------------------QHLTLL---SKEGKLIIISFLGGNIATEIN-----------------L  256 (332)
Q Consensus       223 G~~~----~~----------------------~~~~~l---~~~G~iv~~G~~~~~~~~~~~-----------------~  256 (332)
                      |...    ++                      ..++.+   +.+|.++.++...+....+-.                 .
T Consensus        86 G~~~~~~~~~~~~e~~~~~~~vNl~~~~~~~k~~~~~m~~~~~~G~IInisS~~~~~~~~~~~~Y~asKaav~~ltkslA  165 (245)
T PRK07060         86 GIASLESAIDMTAAGFDRVMAVNARGALLVARHVARAMIRAGRGGSIVNVSSQAALVGLPDHLAYCASKAALDAATRVLC  165 (245)
T ss_pred             CCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             87999990139999999999997099999999999999980898079998664325789974789999999999999999


Q ss_pred             CHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---CCCEEEE
Q ss_conf             3343053216777512400011378999999999999986983102124741899999999998299---8132898
Q gi|254780290|r  257 NPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---HIGKIIL  330 (332)
Q Consensus       257 ~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~~GKvVi  330 (332)
                      .++-..++++....-+...  .+......-..+..+.+.+.  .|+ .+.-.-+|+.++...|.+..   .+|-++.
T Consensus       166 ~el~~~gIRVN~I~PG~i~--T~~~~~~~~~~~~~~~~~~~--~pl-~R~g~peeiA~~v~fL~S~~ss~iTG~~i~  237 (245)
T PRK07060        166 VELGPHGIRVNSVNPTVTL--TPMAEFAWSDPQKSEPMLAA--IPL-GRFAEVDDVAAPILFLLSDAASMVSGVSLP  237 (245)
T ss_pred             HHHHHCCEEEEEEEECCCC--CHHHHHHCCCHHHHHHHHHC--CCC-CCCCCHHHHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             9961019299999769898--76676424899999999955--999-997889999999999958642581484288


No 99 
>PRK06484 short chain dehydrogenase; Validated
Probab=96.12  E-value=0.00033  Score=46.97  Aligned_cols=56  Identities=16%  Similarity=0.186  Sum_probs=30.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCEE
Q ss_conf             1223322222222211112222222221112222111111222221-1223453047
Q gi|254780290|r  187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLT-LLSKEGKLII  242 (332)
Q Consensus       187 ~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~~~~~~~~-~l~~~G~iv~  242 (332)
                      -+.||+.++..++++-.+.+.+..+++...+..|..-.+..+..+. .+...|++-.
T Consensus       295 a~~GA~Vvi~d~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~fG~iDi  351 (530)
T PRK06484        295 AALGDRVAIIDSDGEEAVKLREILGGEHLSWQVDITDEASVESAFAGIQGRLGPLDV  351 (530)
T ss_pred             HHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             988798999958889999999973997369995389999999999999998299889


No 100
>PRK05855 short chain dehydrogenase; Validated
Probab=96.10  E-value=0.00041  Score=46.33  Aligned_cols=78  Identities=24%  Similarity=0.306  Sum_probs=52.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCCCCC----CCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111----11223322---2222222111----1222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA----CLKLGAKH---AINYLKEDFL----EILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~----~~~lGa~~---vi~~~~~~~~----~~i~~~t~g~  213 (332)
                      .|+.++|+||++|+|.+.....-..|++|+.++++++..+.    +++.|.+.   .+|-++++-.    +.+.+..  .
T Consensus       314 sGKvAvVTGA~sGIGrA~A~~fA~~GA~Vvl~Dr~~~~l~eta~ei~~~G~~a~~~~~DVtd~~av~al~~~v~~~~--G  391 (582)
T PRK05855        314 GGKLVVVTGAGSGIGRATALAFAREGAEVVASDIDEAAAERTAALIRAAGAVAHAYRVDVSDADAMEALAEWVGAEH--G  391 (582)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHC--C
T ss_conf             99589995875789999999999779999996079999999999999519848999755899999999999999976--9


Q ss_pred             CCCCCCCCCCC
Q ss_conf             11122221111
Q gi|254780290|r  214 GIDIILDMVGA  224 (332)
Q Consensus       214 g~Divid~~G~  224 (332)
                      ++|+.+++.|.
T Consensus       392 ~iDILVNNAGI  402 (582)
T PRK05855        392 VPDIVVNNAGI  402 (582)
T ss_pred             CCCEEEECCCC
T ss_conf             99999989875


No 101
>PRK07067 sorbitol dehydrogenase; Provisional
Probab=96.09  E-value=0.00038  Score=46.58  Aligned_cols=104  Identities=22%  Similarity=0.344  Sum_probs=65.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC---CCCCCCC----CCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111-1112233222---2222221----111222222222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL-ACLKLGAKHA---INYLKED----FLEILQKETQGRGID  216 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~-~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g~g~D  216 (332)
                      .|+++||+||++|+|.+.++.....|++|+.+++++++.+ .++++|.+..   .|-++++    +.+++.+..+  ++|
T Consensus         4 ~gKvalVTGas~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G--~iD   81 (256)
T PRK07067          4 QGKVALLTGAASGIGEAVAQRYLREGARVVLADIKPARAALAALEIGPAAVAVSLDVTRQDSIDRIVAAAVERFG--GID   81 (256)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCC--CCC
T ss_conf             998899937677899999999998799999997988999999998199759999848999999999999999819--998


Q ss_pred             CCCCCCCCC----C-------CC---------------CCCCCC-C--CCCCCEEEEECCCCC
Q ss_conf             222211111----1-------22---------------222112-2--345304798337875
Q gi|254780290|r  217 IILDMVGAE----Y-------LN---------------QHLTLL-S--KEGKLIIISFLGGNI  250 (332)
Q Consensus       217 ivid~~G~~----~-------~~---------------~~~~~l-~--~~G~iv~~G~~~~~~  250 (332)
                      +.+++.|..    .       |+               ..++.+ +  .+|+++.++...+..
T Consensus        82 iLVNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~~~m~~~~~~G~IVnisS~~g~~  144 (256)
T PRK07067         82 ILVNNAALFDMAPILEISRDVYDRLFAVNVKGLFFLMQAVAQHMVEQGRGGKIINMASQAGRR  144 (256)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEHHHCC
T ss_conf             999899889998813499999999999851778999999999999808995599984164366


No 102
>PRK07985 oxidoreductase; Provisional
Probab=96.08  E-value=0.00056  Score=45.45  Aligned_cols=186  Identities=18%  Similarity=0.197  Sum_probs=90.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--C----CCCCCCCCCCCC---CCCCCCCCCCCCCC
Q ss_conf             22222222222211344444322222122222222111223221--1----111122332222---22222111122222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK--C----LACLKLGAKHAI---NYLKEDFLEILQKE  209 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~--~----~~~~~lGa~~vi---~~~~~~~~~~i~~~  209 (332)
                      -.++| .|+++||+||++++|.+..+.+...|++|+...++.++  .    +.+++.|....+   |-++++..+.+.+.
T Consensus        43 ~~GrL-~gKvalVTGas~GIG~aiA~~lA~~GA~Vvi~~~~~~~~~a~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~lv~~  121 (294)
T PRK07985         43 GSGRL-KDRKALVTGGDSGIGRAAAIAYAREGADVAISYLPVEEEDAQDVKKIIEECGRKAVLLPGDLSDEKFARSLVHE  121 (294)
T ss_pred             CCCCC-CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             77778-99979991726699999999999879999994299666789999999997299589997678999999999999


Q ss_pred             CCC--CCCCCCCCCCCCC---------------------------CCCCCCCCCCCCCCCEEEEECCCCCCCCCC-----
Q ss_conf             222--2111222211111---------------------------122222112234530479833787543222-----
Q gi|254780290|r  210 TQG--RGIDIILDMVGAE---------------------------YLNQHLTLLSKEGKLIIISFLGGNIATEIN-----  255 (332)
Q Consensus       210 t~g--~g~Divid~~G~~---------------------------~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~-----  255 (332)
                      +..  .++|+.+++.|..                           ..+.++..++++|+++.++...+....+-.     
T Consensus       122 ~~~~fG~iDiLVnnAG~~~~~~~~~~~s~e~~~~~~~vNl~g~~~~~qaa~p~m~~gGsIInisS~~~~~~~p~~~~Y~a  201 (294)
T PRK07985        122 AHKALGGLDIMALVAGKQVAIPDIADLTSEQFQKTFAINVFALFWLTQEAIPLLPKGASIITTSSIQAYQPSPHLLDYAA  201 (294)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHCCHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
T ss_conf             99985998889980666668888365899999999998653478888876776424877999666465278887307799


Q ss_pred             ------------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC-
Q ss_conf             ------------4334305321677751240001137899999999999998698310212474189999999999829-
Q gi|254780290|r  256 ------------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS-  322 (332)
Q Consensus       256 ------------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g-  322 (332)
                                  ..++-.+++++....-+.....  .........+..+.+.+.  .| ..+.=.-+|+.++.-.|.+. 
T Consensus       202 sKaav~~lTrslA~Ela~~gIRVN~IaPG~i~T~--~~~~~~~~~~~~~~~~~~--~P-l~R~g~peDIA~av~fLaS~~  276 (294)
T PRK07985        202 TKAAILNYSRGLAKQVAEKGIRVNIVAPGPIWTA--LQISGGQTQDKIPQFGQQ--TP-MKRAGQPAELAPVYVYLASQE  276 (294)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCC--CHHCCCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCH
T ss_conf             9999999999999996533929999963878771--020279999999999856--99-889939999999999995824


Q ss_pred             --CCCCEEEE
Q ss_conf             --98132898
Q gi|254780290|r  323 --EHIGKIIL  330 (332)
Q Consensus       323 --~~~GKvVi  330 (332)
                        -.+|-++.
T Consensus       277 a~~ITGq~i~  286 (294)
T PRK07985        277 SSYVTAEVHG  286 (294)
T ss_pred             HCCCCCCEEE
T ss_conf             3672672279


No 103
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR011294   This entry represents a subfamily of the short chain dehydrogenases. Characterised members so far as 3-hydroxybutyrate dehydrogenases and are found in species that accumulate ester polymers called polyhydroxyalkanoic acids (PHAs) under certain conditions. Several members of the family are from species not known to accumulate PHAs, including Oceanobacillus iheyensis and Bacillus subtilis. However, polymer formation is not required for there be a role for 3-hydroxybutyrate dehydrogenase; it may be members of this family have the same function in those species.; GO: 0003858 3-hydroxybutyrate dehydrogenase activity.
Probab=96.07  E-value=0.00076  Score=44.56  Aligned_cols=176  Identities=20%  Similarity=0.291  Sum_probs=93.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCC----CCCCC---CCCCCCCCC----CCCCCCCCCCC
Q ss_conf             2222211344444322222122222222111223--22111111----22332---222222221----11122222222
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKS--EEKCLACL----KLGAK---HAINYLKED----FLEILQKETQG  212 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~--~~~~~~~~----~lGa~---~vi~~~~~~----~~~~i~~~t~g  212 (332)
                      ++++||+|++||||+....-+-+.|++|+..+.+  ++.++.+.    +.|.+   +..|-++++    ..+.+.+..+ 
T Consensus         1 ~ktalVTGaaSGIG~~iA~~LA~aGa~v~~~d~~~~~~~~~~~~~~~~~~G~~v~~~~~D~T~~~e~~~~~~~~~~~fG-   79 (258)
T TIGR01963         1 GKTALVTGAASGIGLAIAKALAAAGANVVVNDLGEADEGAEAAAKVATDAGGSVIYLVADVTKEEEIADMIQAVAAEFG-   79 (258)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC-
T ss_conf             9489996587167899999998729889984678878999999999996188357751478888999999999999856-


Q ss_pred             CCCCCCCCCCCC---C-----------------------CCCCCCCCCCC--CC-CCEEEEECCCCCCCCCC--------
Q ss_conf             211122221111---1-----------------------12222211223--45-30479833787543222--------
Q gi|254780290|r  213 RGIDIILDMVGA---E-----------------------YLNQHLTLLSK--EG-KLIIISFLGGNIATEIN--------  255 (332)
Q Consensus       213 ~g~Divid~~G~---~-----------------------~~~~~~~~l~~--~G-~iv~~G~~~~~~~~~~~--------  255 (332)
                       +.|+-+|+-|-   .                       +++.+++.|+.  .| |++.+++..|-...++=        
T Consensus        80 -~~DiLVNNAG~QhVaPiEeFP~~~w~~iiav~LtsaF~t~raAlP~Mk~~gwGGRIiNIAS~HGLvASp~KSAYVAAKH  158 (258)
T TIGR01963        80 -GLDILVNNAGIQHVAPIEEFPPEKWDRIIAVMLTSAFHTIRAALPHMKKQGWGGRIINIASVHGLVASPFKSAYVAAKH  158 (258)
T ss_pred             -CCCEEEECCCEEECCCCCCCCHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHH
T ss_conf             -8874884464014176547786678737302168889999750643213785537997101000003532134567743


Q ss_pred             ----CCH-----HHCCCCEEEEEEECCCHHCCHH---HHHHHHHH------HHHHHHHCCCCCCCCEEEE-EHHHHHHHH
Q ss_conf             ----433-----4305321677751240001137---89999999------9999998698310212474-189999999
Q gi|254780290|r  256 ----LNP-----IISKRITITGSTLRRRTDIAKQ---SIRDSLQL------KIWPLLNSHVIAPVIHTVL-PLGKVAMAH  316 (332)
Q Consensus       256 ----~~~-----~~~~~~~i~g~~~~~~~~~~~~---~~~~~~~~------~~~~~i~~g~l~p~i~~~~-~l~~i~~A~  316 (332)
                          +..     .=..+++....+  +-+-..|.   ++.+..+.      .+.+   +=.|++.+++.| ..||+.+.-
T Consensus       159 G~~GLTKv~ALE~A~~giT~NaiC--PGYV~TPLV~~Qi~DqAk~rGi~eE~V~~---~VmL~~~P~k~F~~~~e~A~~a  233 (258)
T TIGR01963       159 GLIGLTKVLALEVAAHGITANAIC--PGYVRTPLVEKQIADQAKTRGIPEEQVIR---EVMLKKQPTKRFVTVDEVAETA  233 (258)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEEC--CCCCCCHHHHHHHHHHHHHCCCCHHHHHH---HHCCCCCCCCCCCCHHHHHHHH
T ss_conf             021211555542047887586672--87567554676589998651889988889---8607888984113799999999


Q ss_pred             HHHHC---CCCCCEE
Q ss_conf             99982---9981328
Q gi|254780290|r  317 DIMEK---SEHIGKI  328 (332)
Q Consensus       317 ~~l~~---g~~~GKv  328 (332)
                      .+|.+   +..+|-.
T Consensus       234 ~fLaS~~A~~~TG~~  248 (258)
T TIGR01963       234 LFLASDAAAGITGQA  248 (258)
T ss_pred             HHHCCHHHHCCCCEE
T ss_conf             984173442366207


No 104
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=96.06  E-value=0.00076  Score=44.56  Aligned_cols=96  Identities=19%  Similarity=0.249  Sum_probs=57.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112233222222222111122222222211122221111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA  224 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~  224 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.++++++..+...-..    .|-++.+-.+.+.+... ..+|+++++.|.
T Consensus         4 ~gK~alVTG~s~GIG~aia~~la~~GA~V~~~d~~~~~~~~~~~~~----~D~~~~~~v~~~v~~~~-g~id~lvn~Ag~   78 (261)
T PRK12428          4 DGKTIVVTGVASGIGAEVARLLRFLGARVIGLDRRPPGMTLDGFHQ----ADLGDPASIDAAVAALP-GRIDALFNVAGV   78 (261)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCEEE----CCCCCHHHHHHHHHHHC-CCCCEEEECCCC
T ss_conf             9988999785779999999999986999999968855456131767----37899999999999837-988789986777


Q ss_pred             CC------------------CCCCCCCCCCCCCCEEEEE
Q ss_conf             11------------------2222211223453047983
Q gi|254780290|r  225 EY------------------LNQHLTLLSKEGKLIIISF  245 (332)
Q Consensus       225 ~~------------------~~~~~~~l~~~G~iv~~G~  245 (332)
                      ..                  .+..+..+..+|.++.+..
T Consensus        79 ~~~~~~~~~~~vn~~g~~~~~~~~~~~~~~~~~ivn~~s  117 (261)
T PRK12428         79 PGTGPPELVARVNFLGLRHLTEALLPRLAPGGAIVNVSS  117 (261)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             875428899989889999999999998652875999601


No 105
>pfam05368 NmrA NmrA-like family. NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families.
Probab=96.05  E-value=0.00076  Score=44.55  Aligned_cols=71  Identities=14%  Similarity=0.278  Sum_probs=50.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2211344444322222122222222111223221--1111122332222-22222111122222222211122221111
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK--CLACLKLGAKHAI-NYLKEDFLEILQKETQGRGIDIILDMVGA  224 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~--~~~~~~lGa~~vi-~~~~~~~~~~i~~~t~g~g~Divid~~G~  224 (332)
                      |||+||+|.+|...++-+...|.+|.+++|++++  .+.+...|++.+. |+.+++.   +.+...  |+|.||.+++.
T Consensus         1 IlV~GatG~iG~~vv~~L~~~g~~Vr~l~R~~~~~~~~~l~~~gve~v~gD~~d~~s---l~~al~--gvd~v~~~~~~   74 (232)
T pfam05368         1 ILVFGATGYQGGSVVRASLKAGHPVRALVRDPKSELAKSLKAAGVELVEGDLDDHES---LVEALK--GVDVVFSVTGF   74 (232)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHCCCEEEEECCCCHHH---HHHHHC--CCCEEEEECCC
T ss_conf             099896828999999999858993899971873665666641798899906888789---999967--99889991588


No 106
>PRK08251 short chain dehydrogenase; Provisional
Probab=96.04  E-value=0.00028  Score=47.39  Aligned_cols=75  Identities=25%  Similarity=0.353  Sum_probs=49.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC-----CCC---CCCCCCCCCCC----CCCCCCCCCC
Q ss_conf             22221134444432222212222222211122322111111-22-----332---22222222111----1222222222
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-KL-----GAK---HAINYLKEDFL----EILQKETQGR  213 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~l-----Ga~---~vi~~~~~~~~----~~i~~~t~g~  213 (332)
                      ++|||+||++|+|...++.....|++|+.++++.++.+.+. ++     |..   ..+|-++.+-.    +++.+..  .
T Consensus         3 K~vlITGAssGIG~alA~~la~~G~~v~l~~r~~~~l~~~~~el~~~~~~~~v~~~~~Dvsd~~~v~~~~~~~~~~~--g   80 (248)
T PRK08251          3 QKILITGASSGLGAGMAREFAAKGRDLALCARRTDRLEELKAELLARYPGIKVAVAALDVNDHDQVFEVFAEFSDEL--G   80 (248)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHH--C
T ss_conf             98999478639999999999987998999989888999999999873799739999786786899999999999980--9


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      ++|+++++.|
T Consensus        81 ~iD~lvnNAG   90 (248)
T PRK08251         81 GLDRVIVNAG   90 (248)
T ss_pred             CCCEEEECCC
T ss_conf             9989998576


No 107
>PRK07062 short chain dehydrogenase; Provisional
Probab=96.03  E-value=0.00039  Score=46.48  Aligned_cols=103  Identities=24%  Similarity=0.396  Sum_probs=64.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC----CCCCC----CCCCCCC----CCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-122----33222----2222221----1112222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKL----GAKHA----INYLKED----FLEILQKETQ  211 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~l----Ga~~v----i~~~~~~----~~~~i~~~t~  211 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.+.+++++.+.+ +++    +-..+    .|-++++    +.+++.+..+
T Consensus         7 ~gK~alITG~s~GIG~a~a~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G   86 (265)
T PRK07062          7 EGRVAVVTGGSSGIGLATVELLLEAGASVAICGRDEERLASAEARLREKFPGARLLAARCDVLDEADVAAFAAAVEARFG   86 (265)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             99989995757799999999999879999999798899999999998736996599997579999999999999999839


Q ss_pred             CCCCCCCCCCCCCCC-----------CC---------------CCCCCCC--CCCCCEEEEECCCC
Q ss_conf             221112222111111-----------22---------------2221122--34530479833787
Q gi|254780290|r  212 GRGIDIILDMVGAEY-----------LN---------------QHLTLLS--KEGKLIIISFLGGN  249 (332)
Q Consensus       212 g~g~Divid~~G~~~-----------~~---------------~~~~~l~--~~G~iv~~G~~~~~  249 (332)
                        ++|+.+++.|...           |+               .+++.++  .+|+++.++...+.
T Consensus        87 --~iDiLVnNAg~~~~~~~~~~~~e~w~~~~~~nl~~~~~~~~~~~p~m~~~~~G~IInisS~~~~  150 (265)
T PRK07062         87 --GVDMLVNNAGQGRVSTFADTTDDAWRDELELKYFSVIRPTRAFLPLLRASAAPSITCVNSLLAL  150 (265)
T ss_pred             --CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC
T ss_conf             --9888997788889888487999999999987214589999999999996299629999344235


No 108
>PRK08862 short chain dehydrogenase; Provisional
Probab=96.03  E-value=0.00041  Score=46.31  Aligned_cols=79  Identities=15%  Similarity=0.261  Sum_probs=51.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCCCCC----CCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111----11223322---2222222111----1222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA----CLKLGAKH---AINYLKEDFL----EILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~----~~~lGa~~---vi~~~~~~~~----~~i~~~t~g~  213 (332)
                      +|+.+||+||++|+|.+...-....|++|+.+.+++++.+.    ++++|.+.   .+|.++++-.    +.+.+. .|+
T Consensus         4 k~Kv~lITGas~GIG~aiA~~~A~~Ga~Vii~~r~~~~l~~~~~~i~~~g~~~~~~~~d~~~~~~v~~~~~~i~~~-~g~   82 (227)
T PRK08862          4 KNSIILITSAGSVLGRTISCHFARLGATLILCDQDQSALNDTYEQCSALTDNVYSYQLKDFSQESIRHLFDAIEQQ-FNR   82 (227)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHH-HCC
T ss_conf             9999999798879999999999987999999969999999999999975897489995166199999999999999-589


Q ss_pred             CCCCCCCCCCC
Q ss_conf             11122221111
Q gi|254780290|r  214 GIDIILDMVGA  224 (332)
Q Consensus       214 g~Divid~~G~  224 (332)
                      +.|+.+++.++
T Consensus        83 ~iDvLVNNa~~   93 (227)
T PRK08862         83 APDVLVNNWTS   93 (227)
T ss_pred             CCEEEEECCCC
T ss_conf             97499856645


No 109
>PRK09291 short chain dehydrogenase; Provisional
Probab=96.01  E-value=0.00062  Score=45.16  Aligned_cols=102  Identities=18%  Similarity=0.312  Sum_probs=60.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222221134444432222212222222211122322111111----2233222---222222111122222222211122
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL----KLGAKHA---INYLKEDFLEILQKETQGRGIDII  218 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~----~lGa~~v---i~~~~~~~~~~i~~~t~g~g~Div  218 (332)
                      |+++||+||++|+|......+...|++|++++++.++.+.++    +.|.+..   +|-++  ..+.....  ...+|+.
T Consensus         2 gK~vLITGAssGIGraiA~~la~~G~~Vi~~~r~~~~l~~l~~~~~~~g~~~~~~~lDv~~--~~~~~~~~--~~~iDvL   77 (257)
T PRK09291          2 SKTILITGAGSGFGREVALRLARKGHRVIAGVQIAPQVTELRAEAARRGLALRVEKLDLTD--AIDRARAA--EWDVDVL   77 (257)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCC--HHHHHHHC--CCCCCEE
T ss_conf             9989996898589999999999879989999687899999999998529955999898899--99999980--8999999


Q ss_pred             CCCCCCC----CCC----------------------CCCCCC--CCCCCCEEEEECCCCCC
Q ss_conf             2211111----122----------------------222112--23453047983378754
Q gi|254780290|r  219 LDMVGAE----YLN----------------------QHLTLL--SKEGKLIIISFLGGNIA  251 (332)
Q Consensus       219 id~~G~~----~~~----------------------~~~~~l--~~~G~iv~~G~~~~~~~  251 (332)
                      +++.|-.    ..+                      ..++.+  +..|+++.++...+...
T Consensus        78 VNNAGi~~~g~i~e~~~~~~~~~~~vNv~g~~~ltq~~lp~M~~~~~G~IV~isS~ag~~~  138 (257)
T PRK09291         78 LNNAGIGEAGALVDIPVELVRELFETNVFGPLELTQGVVRKMVARGKGKIVFVSSIAGLIT  138 (257)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC
T ss_conf             9898568997734499999999999997999999999789998769968999878776689


No 110
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed
Probab=95.99  E-value=0.00041  Score=46.31  Aligned_cols=179  Identities=15%  Similarity=0.143  Sum_probs=91.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCCC----CCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111----1122332---222222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA----CLKLGAK---HAINYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~----~~~lGa~---~vi~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++++|...++.+...|++|+.+++++++.+.    +++.|..   ...|-++++    +.+++.+..+  
T Consensus         5 ~gK~alITGgs~GIG~aia~~la~~G~~V~~~~r~~~~~~~~~~~l~~~g~~~~~~~~Dl~~~~~~~~~~~~~~~~~g--   82 (253)
T PRK12826          5 MGRVALVTGAARGIGRAIAVRFAADGADVIVVDICGQAAAATAELVAAAGGKARAYQVDVRDRAALKALVAAGVERFG--   82 (253)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHC--
T ss_conf             998899948977899999999998799899998988999999999985099589999517999999999999999839--


Q ss_pred             CCCCCCCCCCCC-----------CCC---------------CCCCCCC--CCCCCEEEEECCCCC-CCCCC---------
Q ss_conf             111222211111-----------122---------------2221122--345304798337875-43222---------
Q gi|254780290|r  214 GIDIILDMVGAE-----------YLN---------------QHLTLLS--KEGKLIIISFLGGNI-ATEIN---------  255 (332)
Q Consensus       214 g~Divid~~G~~-----------~~~---------------~~~~~l~--~~G~iv~~G~~~~~~-~~~~~---------  255 (332)
                      ++|+++++.|..           .|+               .+++.|+  .+|+++.++...+.. +.+-.         
T Consensus        83 ~iD~lvnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~g~~~~~~~~~~Y~asKaa  162 (253)
T PRK12826         83 RLDILVANAGIFPLTPFAELDDEDWDRVIDVNLTGTFLLTQAALPALKRAGGGRIVLTSSVAGPRVGYPGLAHYAASKAG  162 (253)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHCCCCCCCHHHHHHHHH
T ss_conf             98789989988999981559999999999987566643378746999976997699995256415689973889999999


Q ss_pred             --------CCHHHCCCCEEEEEEECCCH-HCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---C
Q ss_conf             --------43343053216777512400-01137899999999999998698310212474189999999999829---9
Q gi|254780290|r  256 --------LNPIISKRITITGSTLRRRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---E  323 (332)
Q Consensus       256 --------~~~~~~~~~~i~g~~~~~~~-~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~  323 (332)
                              ..++-.+++++....-+... +.... ..... .+..+.+.+.  .| ..+.-..+|+.++...|.+.   .
T Consensus       163 l~~ltk~lA~e~~~~gIrvN~I~PG~i~T~~~~~-~~~~~-~~~~~~~~~~--~p-l~R~~~p~eiA~~v~fL~S~~s~~  237 (253)
T PRK12826        163 VVGFTRALALELARRNITVNSVHPGMVDTPMAGN-VFLGD-ASVAEAAAAA--IP-LGRLGEPEDIAAAVLFLASDAARY  237 (253)
T ss_pred             HHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHC-CCCCC-HHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             9999999999853209599999628796721214-46687-8999999837--99-999859999999999996863229


Q ss_pred             CCCEEEE
Q ss_conf             8132898
Q gi|254780290|r  324 HIGKIIL  330 (332)
Q Consensus       324 ~~GKvVi  330 (332)
                      .+|-++.
T Consensus       238 itG~~i~  244 (253)
T PRK12826        238 ITGQTLP  244 (253)
T ss_pred             CCCCEEE
T ss_conf             5687388


No 111
>PRK06483 short chain dehydrogenase; Provisional
Probab=95.98  E-value=0.00044  Score=46.11  Aligned_cols=76  Identities=20%  Similarity=0.284  Sum_probs=49.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC-CCCCCCC----CCCCCCCCCCCCCCCCCC
Q ss_conf             2222211344444322222122222222111223221-111112233222-2222221----111222222222111222
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK-CLACLKLGAKHA-INYLKED----FLEILQKETQGRGIDIIL  219 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~-~~~~~~lGa~~v-i~~~~~~----~~~~i~~~t~g~g~Divi  219 (332)
                      .++|||+||++|+|.+.++-+...|++|+.+.++++. .+.+++.|+..+ .|-++++    +.+.+.+..  .++|+++
T Consensus         2 ~ktVlVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~~l~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~--g~id~lV   79 (236)
T PRK06483          2 SAPILITGAGQRIGLALAKHLLAQGQPVIVSYRSHYPAIDELRQAGATCIQADFSTNAGIMAFIDELKQHT--DGLRAII   79 (236)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHH--CCCCEEE
T ss_conf             98799978998899999999998899899995984799999985699899922799999999999999983--9975999


Q ss_pred             CCCC
Q ss_conf             2111
Q gi|254780290|r  220 DMVG  223 (332)
Q Consensus       220 d~~G  223 (332)
                      ++.|
T Consensus        80 nNAg   83 (236)
T PRK06483         80 HNAS   83 (236)
T ss_pred             ECCC
T ss_conf             7774


No 112
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional
Probab=95.98  E-value=0.00084  Score=44.27  Aligned_cols=111  Identities=22%  Similarity=0.228  Sum_probs=68.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCC----CCCCCCCCCCC
Q ss_conf             22222333222111222222222222113444443222221222222--2211122322111111----22332222222
Q gi|254780290|r  125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA--TVYTTAKSEEKCLACL----KLGAKHAINYL  198 (332)
Q Consensus       125 ~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~--~vi~~~~~~~~~~~~~----~lGa~~vi~~~  198 (332)
                      ++.-+.+.|.  +.+..+++++++||..|  +|.|..+.-+|+..|-  +|+++...++-.+.++    ++|.+++.- .
T Consensus        58 tis~P~~~a~--ml~~L~l~~~~~VLeIG--tGsGY~tAlla~lvg~~g~V~siE~~~~l~~~A~~~l~~~~~~nv~~-~  132 (214)
T PRK13942         58 TISAIHMVAI--MCELLDLDEGQKVLEIG--TGSGYHAAVVAEIVGKSGKVTTIERIPELAEKAKKNLKKLGYENVEV-I  132 (214)
T ss_pred             EECHHHHHHH--HHHHHCCCCCCEEEEEC--CCCCHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCEEE-E
T ss_conf             8874999999--99972799999799967--99529999999974767857999717999999999998637687589-8


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCEEE
Q ss_conf             22111122222222211122221111112-2222112234530479
Q gi|254780290|r  199 KEDFLEILQKETQGRGIDIILDMVGAEYL-NQHLTLLSKEGKLIII  243 (332)
Q Consensus       199 ~~~~~~~i~~~t~g~g~Divid~~G~~~~-~~~~~~l~~~G~iv~~  243 (332)
                      ..|...-..   ...+||.|+-+.+.+.. +..++.|++||+++.-
T Consensus       133 ~gdg~~G~~---~~apfD~Iiv~aa~~~iP~~l~~qL~~gGrLV~P  175 (214)
T PRK13942        133 LGDGTKGYE---ENAPYDRIYVTAAGPDIPKPLLEQLKDGGIMVIP  175 (214)
T ss_pred             ECCCCCCCC---CCCCCCEEEEEECCCCCCHHHHHHCCCCCEEEEE
T ss_conf             567566784---4598127999851765789999962889589999


No 113
>PRK07523 gluconate 5-dehydrogenase; Provisional
Probab=95.97  E-value=0.00047  Score=45.95  Aligned_cols=179  Identities=17%  Similarity=0.166  Sum_probs=91.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC---CCCCCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-122332---2222222211----11222222222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAK---HAINYLKEDF----LEILQKETQGRGID  216 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~---~vi~~~~~~~----~~~i~~~t~g~g~D  216 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.+.+++++.+.+ ++++..   ..+|-++++-    .+++.+..  .++|
T Consensus         8 ~gK~alVTG~s~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~~~~~~~Dvtd~~~v~~~v~~~~~~~--G~iD   85 (251)
T PRK07523          8 TGRRALITGSSQGIGYALAKGLAQAGAEVILNGRDAAKLAAAAESLKGSAHTLAFDVTDHDAVRAAIDAFEAEI--GPID   85 (251)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHC--CCCC
T ss_conf             99989995836699999999999879999999699899999999818872799995799999999999999975--9986


Q ss_pred             CCCCCCCCC---C--------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC-------------
Q ss_conf             222211111---1--------22---------------222112--234530479833787543222-------------
Q gi|254780290|r  217 IILDMVGAE---Y--------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN-------------  255 (332)
Q Consensus       217 ivid~~G~~---~--------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~-------------  255 (332)
                      +.+++.|..   .        |+               ..++.|  +.+|+++.++...+....+-.             
T Consensus        86 iLVNNAG~~~~~~~~~~~~e~~~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IInisS~~~~~~~~~~~~Y~asKaav~~l  165 (251)
T PRK07523         86 ILVNNAGMQHRTPLEDFPADAFERLLQTNISSVFYVGQAVARHMIARGAGKIINIASVQSALARPGIAPYTATKGAVGNL  165 (251)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             99989887999990559999999999997399999999998998863996799994157607689947899999999999


Q ss_pred             ----CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CCCCEE
Q ss_conf             ----4334305321677751240001137899999999999998698310212474189999999999829---981328
Q gi|254780290|r  256 ----LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EHIGKI  328 (332)
Q Consensus       256 ----~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~~GKv  328 (332)
                          ..++-.+++++....-+... .. .........+..+.+.+.  .| ..+.=.-+|+..+.-.|.+.   -.+|-+
T Consensus       166 Tr~lA~e~a~~gIrVNaVaPG~i~-T~-~~~~~~~~~~~~~~~~~~--~P-lgR~g~peeia~~v~fLaSd~s~~iTG~~  240 (251)
T PRK07523        166 TKGMATDWAKHGLQCNAIAPGYFD-TP-LNAALVADPEFSAWLEKR--TP-AGRWGKVEELVGACIFLASDASSFVNGHV  240 (251)
T ss_pred             HHHHHHHHCCCCEEEEEEEECCCC-CH-HHHHHCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCCCCE
T ss_conf             999999970209499999737898-73-243213899999999857--99-99978999999999999487424826874


Q ss_pred             EE
Q ss_conf             98
Q gi|254780290|r  329 IL  330 (332)
Q Consensus       329 Vi  330 (332)
                      +.
T Consensus       241 i~  242 (251)
T PRK07523        241 LY  242 (251)
T ss_pred             EE
T ss_conf             88


No 114
>PRK07041 short chain dehydrogenase; Provisional
Probab=95.96  E-value=0.00052  Score=45.63  Aligned_cols=77  Identities=30%  Similarity=0.385  Sum_probs=52.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-12233-----222222222111122222222211122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGA-----KHAINYLKEDFLEILQKETQGRGIDII  218 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa-----~~vi~~~~~~~~~~i~~~t~g~g~Div  218 (332)
                      .|+++||+||++++|.+.++.+...|++|+.+.+++++.+.+ ++++.     ...+|-++++-.+.+.+..  .++|++
T Consensus         6 ~gK~~lITGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~--g~~d~l   83 (240)
T PRK07041          6 NDQKVLVVGGSSGIGLAAARAFAARGADVTIASRSRERLAAAARALGGPRPVRTAALDITDEAAVDAFFAEA--GPFDHV   83 (240)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHH--CCCCEE
T ss_conf             999899957788899999999998799999995988999999998478886699984799999999999970--987889


Q ss_pred             CCCCC
Q ss_conf             22111
Q gi|254780290|r  219 LDMVG  223 (332)
Q Consensus       219 id~~G  223 (332)
                      +++.|
T Consensus        84 v~nag   88 (240)
T PRK07041         84 VITAA   88 (240)
T ss_pred             EECCC
T ss_conf             98234


No 115
>KOG1205 consensus
Probab=95.95  E-value=0.0026  Score=41.04  Aligned_cols=108  Identities=25%  Similarity=0.418  Sum_probs=62.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC-CC----CCCCCC----CCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111----11223322-22----222221----1112222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA----CLKLGAKH-AI----NYLKED----FLEILQKETQ  211 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~----~~~lGa~~-vi----~~~~~~----~~~~i~~~t~  211 (332)
                      .|+.|+|+||++|+|...+.-.-..|++++-+++..++++.    +++.+... ++    |-++.+    +.+.+.+.. 
T Consensus        11 ~~kvVvITGASsGIG~~lA~~la~~G~~l~lvar~~rrl~~v~~~l~~~~~~~~v~~~~~Dvs~~~~~~~~~~~~~~~f-   89 (282)
T KOG1205          11 AGKVVLITGASSGIGEALAYELAKRGAKLVLVARRARRLERVAEELRKLGSLEKVLVLQLDVSDEESVKKFVEWAIRHF-   89 (282)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHC-
T ss_conf             8988999578717889999999867773477424320289999999974786764799676588788999999999865-


Q ss_pred             CCCCCCCCCCCCCCC--------------------------CCCCCCCCCC-C-CCCEEEEECCCCCCCCC
Q ss_conf             221112222111111--------------------------2222211223-4-53047983378754322
Q gi|254780290|r  212 GRGIDIILDMVGAEY--------------------------LNQHLTLLSK-E-GKLIIISFLGGNIATEI  254 (332)
Q Consensus       212 g~g~Divid~~G~~~--------------------------~~~~~~~l~~-~-G~iv~~G~~~~~~~~~~  254 (332)
                       .++|+.+++.|-..                          ...+++.|+. + |+++.++...|....++
T Consensus        90 -g~vDvLVNNAG~~~~~~~~~~~~~~~~~~mdtN~~G~V~~Tk~alp~m~~r~~GhIVvisSiaG~~~~P~  159 (282)
T KOG1205          90 -GRVDVLVNNAGISLVGFLEDTDIEDVRNVMDTNVFGTVYLTKAALPSMKKRNDGHIVVISSIAGKMPLPF  159 (282)
T ss_pred             -CCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC
T ss_conf             -8888898468656555334476898887710004024899999988766328974999806101557886


No 116
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.94  E-value=0.00043  Score=46.20  Aligned_cols=77  Identities=19%  Similarity=0.343  Sum_probs=52.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----1223322---22222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++++|.+.++.+...|++|+.+++++++.+.+    ++.|...   ..|-++++    +.+.+.+..  .
T Consensus         4 ~gK~~lITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~--g   81 (253)
T PRK08217          4 KDKVIVITGGAQGLGRAMAEYLAQKGAKLALIDLNQEKLEEAVAQCAALGGEAEVYAANVTDEEDVEATFAQIAEDF--G   81 (253)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH--C
T ss_conf             99889994887789999999999879989999799999999999999659948999824799999999999999983--9


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      ++|+++++.|
T Consensus        82 ~iD~lVnNAG   91 (253)
T PRK08217         82 QLNGLINNAG   91 (253)
T ss_pred             CCCEEEECCC
T ss_conf             9859998574


No 117
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional
Probab=95.93  E-value=0.00092  Score=44.00  Aligned_cols=95  Identities=22%  Similarity=0.245  Sum_probs=62.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC--
Q ss_conf             2222222113444443222221222222221112232211111122332--222222221111222222222111222--
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK--HAINYLKEDFLEILQKETQGRGIDIIL--  219 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~--~vi~~~~~~~~~~i~~~t~g~g~Divi--  219 (332)
                      -.|.+||=.| || -|.++-.+|+ +|++|++++-|++..+.++.....  .-++|...+..+-...  ....||+|+  
T Consensus        47 l~G~~ILDVG-CG-gG~lse~LAr-~Ga~VtGID~S~~~I~~Ar~ha~~~~l~i~y~~~~~e~l~~~--~~~~FDvV~~~  121 (233)
T PRK05134         47 LFGKRVLDVG-CG-GGILSESMAR-LGATVTGIDASEENIEVARLHALESGLKIDYRQITAEELAAE--HPGQFDVVTCM  121 (233)
T ss_pred             CCCCEEEEEC-CC-CCHHHHHHHH-CCCEEEEECCCHHHHHHHHHHHHHCCCCCEEEECCHHHHHHH--CCCCEEEEEEE
T ss_conf             6899899975-58-9711289996-799799987998999999998564434511675147665430--57863477442


Q ss_pred             ---CCCC--CCCCCCCCCCCCCCCCCEEE
Q ss_conf             ---2111--11122222112234530479
Q gi|254780290|r  220 ---DMVG--AEYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       220 ---d~~G--~~~~~~~~~~l~~~G~iv~~  243 (332)
                         +.+.  ...++.+.++|+|||+++.-
T Consensus       122 EVlEHV~d~~~~l~~~~rlLKPGG~l~ls  150 (233)
T PRK05134        122 EMLEHVPDPASFIRACAKLVKPGGLVFFS  150 (233)
T ss_pred             HHHHHCCCHHHHHHHHHHHHCCCCEEEEE
T ss_conf             14775389999999999973899149997


No 118
>PRK05650 short chain dehydrogenase; Provisional
Probab=95.93  E-value=0.00053  Score=45.59  Aligned_cols=102  Identities=20%  Similarity=0.289  Sum_probs=62.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCC----CCCCCCCCCCCCCCC
Q ss_conf             222113444443222221222222221112232211111----1223322---22222221----111222222222111
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKED----FLEILQKETQGRGID  216 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~----~~~~i~~~t~g~g~D  216 (332)
                      +|||+||++|+|.+....+...|++|+.+++++++.+.+    ++.|.+.   ..|-++++    +.+.+.+..  .++|
T Consensus         2 rVlITGassGIG~alA~~la~~G~~V~l~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~~~~~~~~v~~~~--g~iD   79 (270)
T PRK05650          2 RVMITGAASGLGRAIALRWAREGWRLALADVNEEGGEETLKELREAGGDGFYQRCDVRDYSQLTALAQACEEKW--GGID   79 (270)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH--CCCC
T ss_conf             79998876499999999999889989999798899999999998449928999845899999999999999983--9977


Q ss_pred             CCCCCCCC----CCCC----------------------CCCCCCC--CCCCCEEEEECCCCCC
Q ss_conf             22221111----1122----------------------2221122--3453047983378754
Q gi|254780290|r  217 IILDMVGA----EYLN----------------------QHLTLLS--KEGKLIIISFLGGNIA  251 (332)
Q Consensus       217 ivid~~G~----~~~~----------------------~~~~~l~--~~G~iv~~G~~~~~~~  251 (332)
                      +++++.|-    ...+                      ..+..|+  .+|+++.++...+..+
T Consensus        80 iLVNNAGi~~~g~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~m~~~~~G~IvnisS~ag~~~  142 (270)
T PRK05650         80 VIVNNAGVASGGFFEELSLEDWDWQIAINLMGVVKGCKAFLPLFKEQGKGRIVNIASMAGLMQ  142 (270)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC
T ss_conf             896247667998620199999999999965999999999997675569958999858555289


No 119
>PRK08277 D-mannonate oxidoreductase; Provisional
Probab=95.91  E-value=0.00048  Score=45.87  Aligned_cols=77  Identities=23%  Similarity=0.352  Sum_probs=51.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCCC----CCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----1223322---222222211----11222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKEDF----LEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~~----~~~i~~~t~g~  213 (332)
                      .|+++||+||++++|.+.++-....|++|+.+.+++++.+.+    ++.|.+.   ..|-++++-    .+++.+.. | 
T Consensus         9 ~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~~~~~~~~~-G-   86 (278)
T PRK08277          9 KGKVAVITGGGGVLGGAMAKELARAGAKVAILDRNQEKAEAVVEEIKANGGEAIALKADVLDKESLEQARQQILKDF-G-   86 (278)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH-C-
T ss_conf             99989995867489999999999879989999798899999999998459909999824899999999999999984-9-


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      ++|+.+++.|
T Consensus        87 ~iDiLVNnAG   96 (278)
T PRK08277         87 RCDILINGAG   96 (278)
T ss_pred             CCCEEEECCC
T ss_conf             9888998898


No 120
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. Members of this protein family are the enzyme 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. The enzymatic properties were confirmed experimentally in Rhodopseudomonas palustris; the enzyme is homotetrameric, and not sensitive to oxygen. This enzyme is part of proposed pathway for degradation of benzoyl-CoA to 3-hydroxypimeloyl-CoA that differs from the analogous in Thauera aromatica. It also may occur in degradation of the non-aromatic compound cyclohexane-1-carboxylate.
Probab=95.90  E-value=0.00053  Score=45.57  Aligned_cols=181  Identities=14%  Similarity=0.147  Sum_probs=92.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----1223322---22222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++|+|.+.++-....|++|+.+.+++++.+.+    ++.|.+.   ..|-++++    +.+++.+..+  
T Consensus         2 ~gKvalITG~s~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~~~~~~Dv~d~~~v~~~v~~~~~~~G--   79 (250)
T TIGR03206         2 KDKTAIVTGGGGGIGGATCRRFAEEGAKVAVFDLNREAAEKVAADIRAKGGNAQAFACDITDRDSVDTAVAAAEQALG--   79 (250)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCC--
T ss_conf             519999968576899999999998799999997988999999999995399289999448999999999999999759--


Q ss_pred             CCCCCCCCCCCCC-----------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC----------
Q ss_conf             1112222111111-----------22---------------222112--234530479833787543222----------
Q gi|254780290|r  214 GIDIILDMVGAEY-----------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN----------  255 (332)
Q Consensus       214 g~Divid~~G~~~-----------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~----------  255 (332)
                      ++|+.+++.|...           |+               .+++.|  +.+|+++.++...+....+..          
T Consensus        80 ~iDilvnnAg~~~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaav  159 (250)
T TIGR03206        80 PVDVLVNNAGWDKFGPFTKTEPPLWERLIAINLTGALHMHHAVLPGMVERGAGRIVNIASDAARVGSSGEAVYAACKGGL  159 (250)
T ss_pred             CCCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
T ss_conf             99799989888999890349999999999998299999999999999974991799965577576899858899999999


Q ss_pred             -------CCHHHCCCCEEEEEEECCCHHCCHHHHHH--HHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC---CC
Q ss_conf             -------43343053216777512400011378999--9999999999869831021247418999999999982---99
Q gi|254780290|r  256 -------LNPIISKRITITGSTLRRRTDIAKQSIRD--SLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK---SE  323 (332)
Q Consensus       256 -------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~--~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~---g~  323 (332)
                             ..++-.+++++....-+...-........  ....+..+.+.+.  .|. .+.-..+|+.++...|.+   +-
T Consensus       160 ~~ltk~lA~ela~~gIrVNaV~PG~i~T~~~~~~~~~~~~~e~~~~~~~~~--~Pl-~R~g~pediA~~v~fL~Sd~s~~  236 (250)
T TIGR03206       160 VAFSKTMAREHARHGITVNVVCPGPTDTALLDDICGGAENPEKLREAFTRA--IPL-GRLGQPDDLPGAILFFSSDDASF  236 (250)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHCCCCHHHHHHHHHHC--CCC-CCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             999999999965329189999768888677898764438869999999847--998-99839999999999995834338


Q ss_pred             CCCEEEE
Q ss_conf             8132898
Q gi|254780290|r  324 HIGKIIL  330 (332)
Q Consensus       324 ~~GKvVi  330 (332)
                      .+|-++.
T Consensus       237 itG~~i~  243 (250)
T TIGR03206       237 ITGQVLS  243 (250)
T ss_pred             CCCCEEE
T ss_conf             4588388


No 121
>PRK08317 hypothetical protein; Provisional
Probab=95.90  E-value=0.00074  Score=44.62  Aligned_cols=103  Identities=18%  Similarity=0.227  Sum_probs=67.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCC
Q ss_conf             112222222222221134444432222212222--222211122322111111223322--2222222111122222222
Q gi|254780290|r  137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYF--GATVYTTAKSEEKCLACLKLGAKH--AINYLKEDFLEILQKETQG  212 (332)
Q Consensus       137 l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~--G~~vi~~~~~~~~~~~~~~lGa~~--vi~~~~~~~~~~i~~~t~g  212 (332)
                      +.+..+++||++||=.|  .|.|..+..+|+..  +.+|++++.|+..++.+++.-.+.  -+.+...|..+ + .. ..
T Consensus        11 ~l~~L~l~pG~~vLDiG--cG~G~~~~~la~~~g~~~~v~gvD~s~~~l~~a~~~~~~~~~~v~~~~~d~~~-l-p~-~d   85 (241)
T PRK08317         11 TFELLAVQPGERVLDVG--CGPGNDLRELADRVGPEGRVVGIDRSEAMLALARERAAGLLSNVEFVRGDADG-L-PF-PD   85 (241)
T ss_pred             HHHHCCCCCCCEEEEEC--CCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCHHH-C-CC-CC
T ss_conf             99736999979999966--41749999999974999789999698899999999986228964999554643-5-89-88


Q ss_pred             CCCCCCCCCCC-------CCCCCCCCCCCCCCCCCEEEE
Q ss_conf             21112222111-------111222221122345304798
Q gi|254780290|r  213 RGIDIILDMVG-------AEYLNQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       213 ~g~Divid~~G-------~~~~~~~~~~l~~~G~iv~~G  244 (332)
                      ..||+|+-...       ...+..+.+.|+|||+++.+-
T Consensus        86 ~sfD~v~~~~~l~h~~d~~~~l~e~~RvLkPGG~~vi~d  124 (241)
T PRK08317         86 ESFDAVRSDRVLQHLEDPRRALAEMARVLRPGGRAVVLD  124 (241)
T ss_pred             CCCCEEEHHHHHHHCCCHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             870456221157622589999999999818883899996


No 122
>PRK07775 short chain dehydrogenase; Provisional
Probab=95.89  E-value=0.00039  Score=46.46  Aligned_cols=104  Identities=20%  Similarity=0.328  Sum_probs=63.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC---CCCC---CCCCCCCCCCCCCCCCCCC--CCC
Q ss_conf             2222221134444432222212222222211122322111111-22---3322---2222222111122222222--211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-KL---GAKH---AINYLKEDFLEILQKETQG--RGI  215 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~l---Ga~~---vi~~~~~~~~~~i~~~t~g--~g~  215 (332)
                      .++++||+||++|+|.+..+.+...|++|+.++++.++++.+. ++   |.+.   ..|-++.+-.+.+.+.+..  ..+
T Consensus         9 ~~KtAlVTGAssGIG~aiA~~la~~G~~V~l~~R~~e~l~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~i   88 (275)
T PRK07775          9 ARRPAIVAGASSGIGAATAIELAAHGFPVALGARRVEKCEEIVDKIRADGGEAVAFPLDVTDPDSVKSFVAQATEALGDI   88 (275)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCC
T ss_conf             99979994623599999999999879989999898999999999999649948999912899999999999999985996


Q ss_pred             CCCCCCCCCC----CCC----------------------CCCCCC--CCCCCCEEEEECCC
Q ss_conf             1222211111----122----------------------222112--23453047983378
Q gi|254780290|r  216 DIILDMVGAE----YLN----------------------QHLTLL--SKEGKLIIISFLGG  248 (332)
Q Consensus       216 Divid~~G~~----~~~----------------------~~~~~l--~~~G~iv~~G~~~~  248 (332)
                      |+++++.|..    ..+                      ..+..|  +..|+++.++...+
T Consensus        89 DiLVnNAG~~~~~~~~e~~~e~~~~~~~vNl~g~~~~~~a~lP~M~~~~~G~IV~isS~a~  149 (275)
T PRK07775         89 EVLVSGAGDTYFGKLHEISTEQFESQVQIHLVGANRLATAVLPGMVERRRGDLIFVGSDVA  149 (275)
T ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHH
T ss_conf             5999767568888601099999999998852799999999999999759957999844765


No 123
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=95.89  E-value=0.00047  Score=45.95  Aligned_cols=177  Identities=20%  Similarity=0.263  Sum_probs=93.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCC---CCCCCCCC----CCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111----223322---22222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL----KLGAKH---AINYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~----~lGa~~---vi~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|++++|+||++++|...++.+...|++|+.+.+++++.+.+.    +.|...   ..|-++++    +.+.+.+..  .
T Consensus         4 ~~Kv~lITGgs~GIG~a~a~~la~~G~~V~~~~r~~~~l~~~~~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~--g   81 (246)
T PRK05653          4 QGKTALVTGASRGIGRAIALRLAADGARVVIYDSNEEAAEALAEELRAAGGEAALLVFDVTDEAAVRALIEAAVERF--G   81 (246)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHC--C
T ss_conf             99889993897589999999999879999999799999999999999659948999972899999999999999974--9


Q ss_pred             CCCCCCCCCCCC----C-------CC---------------CCCCCCC--CCCCCEEEEECCCCCCCCCC----------
Q ss_conf             111222211111----1-------22---------------2221122--34530479833787543222----------
Q gi|254780290|r  214 GIDIILDMVGAE----Y-------LN---------------QHLTLLS--KEGKLIIISFLGGNIATEIN----------  255 (332)
Q Consensus       214 g~Divid~~G~~----~-------~~---------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~----------  255 (332)
                      ++|+++++.|..    .       |+               ..++.|+  .+|+++.++...+....+-.          
T Consensus        82 ~iDilvnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~~~~~~~Y~asKaal  161 (246)
T PRK05653         82 GLDVLVNNAGITRDALLPRMSEEDWDRVIDTNLTGTFNVCRAALPPMRKARYGRIVNISSVSGVAGNPGQTNYAAAKAGV  161 (246)
T ss_pred             CCCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHCCCCCCCHHHHHHHHHH
T ss_conf             98699989999999880139999999999986088999999999999984699789983655467899966689999999


Q ss_pred             --C-----CHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---CC
Q ss_conf             --4-----3343053216777512400011378999999999999986983102124741899999999998299---81
Q gi|254780290|r  256 --L-----NPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---HI  325 (332)
Q Consensus       256 --~-----~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~~  325 (332)
                        +     .++-..++++....-+...-.......    .+..+.+.+.  .| ..+.-.-+|+.++...+.+..   .+
T Consensus       162 ~~lt~~la~e~~~~~IrvN~I~PG~i~T~~~~~~~----~~~~~~~~~~--~P-l~R~~~p~dia~~v~fL~S~~s~~it  234 (246)
T PRK05653        162 IGLTKALALELASRGITVNAVAPGFIDTDMTRALP----EEVKEALLKQ--IP-LGRLGTPEEVANAVAFLASDAASYIT  234 (246)
T ss_pred             HHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCC----HHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999995043939999963888772311168----9999999847--99-89983999999999999687112835


Q ss_pred             CEEEE
Q ss_conf             32898
Q gi|254780290|r  326 GKIIL  330 (332)
Q Consensus       326 GKvVi  330 (332)
                      |-++.
T Consensus       235 G~~i~  239 (246)
T PRK05653        235 GQVIP  239 (246)
T ss_pred             CCEEE
T ss_conf             87488


No 124
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated
Probab=95.88  E-value=0.00063  Score=45.10  Aligned_cols=179  Identities=13%  Similarity=0.104  Sum_probs=90.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC----CCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111122332-22222222111----1222222222111222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK-HAINYLKEDFL----EILQKETQGRGIDIIL  219 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~-~vi~~~~~~~~----~~i~~~t~g~g~Divi  219 (332)
                      .|+++||+||++++|...++-+...|++|++++++.++...  ...+. ...|-++++-.    +++.+..  .++|+.+
T Consensus         7 ~gK~alITG~s~GIG~aia~~la~~Ga~V~~~~r~~~~l~~--~~~~~~~~~Dv~~~~~v~~~~~~~~~~~--g~iDilV   82 (253)
T PRK08220          7 SGKTVWVTGAAQGIGYAVALAFVEAGAKVIGFDQAFEQLNE--QYPFATFVLDVADAAAVAQVCQRLLAET--GPLDVLV   82 (253)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHC--CCCEEEEEEECCCHHHHHHHHHHHHHHC--CCCCEEE
T ss_conf             99989995885689999999999879999999788778748--9977999973799999999999999973--9988899


Q ss_pred             CCCCCC----C-------CC---------------CCCCCCC--CCCCCEEEEECCCCCCCCCC----------------
Q ss_conf             211111----1-------22---------------2221122--34530479833787543222----------------
Q gi|254780290|r  220 DMVGAE----Y-------LN---------------QHLTLLS--KEGKLIIISFLGGNIATEIN----------------  255 (332)
Q Consensus       220 d~~G~~----~-------~~---------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~----------------  255 (332)
                      ++.|..    .       |+               .+++.++  .+|+++.++...+..+.+-.                
T Consensus        83 nnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IV~isS~~~~~~~~~~~~Y~asKaal~~lt~~  162 (253)
T PRK08220         83 NVAGVLRMGATDSLSDEDWQQTFAVNAGGVFNLSRAVMPQFRRQRGGAIVTVGSNAAHTPRIGMAAYGASKAALTSLTKC  162 (253)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHHCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             89987899980449999999999997463899999999877773896599997478718689838899999999999999


Q ss_pred             -CCHHHCCCCEEEEEEECCCH-HCC-----HHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---CC
Q ss_conf             -43343053216777512400-011-----378999999999999986983102124741899999999998299---81
Q gi|254780290|r  256 -LNPIISKRITITGSTLRRRT-DIA-----KQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---HI  325 (332)
Q Consensus       256 -~~~~~~~~~~i~g~~~~~~~-~~~-----~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~~  325 (332)
                       ..++-.+++++....-+... +..     .............+....+  .| ..+.-..+|+..+...+.+.+   .+
T Consensus       163 lA~el~~~gIrVN~V~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~--iP-l~R~~~p~diA~~v~fL~S~~s~~it  239 (253)
T PRK08220        163 VGLELAPYGVRCNVVSPGSTDTDMQRTLWVDEDGEQQRIAGFPEQFKLG--IP-LGKIARPQEIANAVLFLASDLASHIT  239 (253)
T ss_pred             HHHHHHHHCEEEEEEECCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHCC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             9999543095999996088987445543248147899998659988558--99-88981999999999999585433924


Q ss_pred             CEEEE
Q ss_conf             32898
Q gi|254780290|r  326 GKIIL  330 (332)
Q Consensus       326 GKvVi  330 (332)
                      |-.+.
T Consensus       240 Gq~i~  244 (253)
T PRK08220        240 MQDIV  244 (253)
T ss_pred             CCEEE
T ss_conf             83288


No 125
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional
Probab=95.85  E-value=0.0027  Score=40.93  Aligned_cols=105  Identities=19%  Similarity=0.314  Sum_probs=66.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11222222222222113444443222221222222221112232211111122332-22222222111122222222211
Q gi|254780290|r  137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK-HAINYLKEDFLEILQKETQGRGI  215 (332)
Q Consensus       137 l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~-~vi~~~~~~~~~~i~~~t~g~g~  215 (332)
                      +....+++|+++||=.|  .|+|-.+..+|+..||+|++++-++...+.+++.-.+ .-+.....|..   ..-....-|
T Consensus        44 ~l~~l~L~~~~kVLDvG--CG~GG~a~~LA~~yg~~V~GiDls~~~~~~A~er~~~~~~v~f~~~d~~---~~~f~d~sF  118 (263)
T PTZ00098         44 ILSDIELDANSKVLDIG--SGLGGGCKYINEKYGAHTHGIDICEKIVNIAKERNQDKAKIEFEAKDIL---KKDFPENNF  118 (263)
T ss_pred             HHHCCCCCCCCEEEEEC--CCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCEEEEECCCC---CCCCCCCCE
T ss_conf             98504889998688868--8878899999997498799985889999999985512585489967853---677886745


Q ss_pred             CCCCC-----CCC----CCCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             12222-----111----11122222112234530479833
Q gi|254780290|r  216 DIILD-----MVG----AEYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       216 Divid-----~~G----~~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      |+|+-     .+.    ...++...+.|+|||+++..-..
T Consensus       119 DvV~S~dailHip~~DK~~l~~e~~RvLKPGG~llitDw~  158 (263)
T PTZ00098        119 DLIYSRDAILHLSLADKKKLFEKCYKWLKPNGILLITDYC  158 (263)
T ss_pred             EEEEEEHHHHCCCHHHHHHHHHHHHHHCCCCCEEEEEEEC
T ss_conf             5898750223088243999999999984688789997501


No 126
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated
Probab=95.84  E-value=0.0016  Score=42.48  Aligned_cols=41  Identities=24%  Similarity=0.352  Sum_probs=37.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA  185 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~  185 (332)
                      +|++|.|+||+|+.|++.++..+..|++||+.++++++...
T Consensus       179 KGKTV~VTGASG~LG~aL~k~l~~~GAKVIalTs~~~~i~~  219 (410)
T PRK07424        179 KGKTVAVTGASGTLGQALLKELHQQGAKVIALTSNSDKIPL  219 (410)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCC
T ss_conf             68679995477377899999999779989999358986553


No 127
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]
Probab=95.84  E-value=0.00083  Score=44.29  Aligned_cols=77  Identities=27%  Similarity=0.452  Sum_probs=52.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--C-CCCCCCCCCCC----CCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111122--3-32222222221----1112222222221112
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKL--G-AKHAINYLKED----FLEILQKETQGRGIDI  217 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~l--G-a~~vi~~~~~~----~~~~i~~~t~g~g~Di  217 (332)
                      -|.+|||+||++|+|+...+=....|-+||.+.|++++++.++..  + ...+.|-.|.+    +.+.+++....  .++
T Consensus         4 tgnTiLITGG~sGIGl~lak~f~elgN~VIi~gR~e~~L~e~~~~~p~~~t~v~Dv~d~~~~~~lvewLkk~~P~--lNv   81 (245)
T COG3967           4 TGNTILITGGASGIGLALAKRFLELGNTVIICGRNEERLAEAKAENPEIHTEVCDVADRDSRRELVEWLKKEYPN--LNV   81 (245)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHCCCCHHEEEECCCCHHHHHHHHHHHHHHCCC--HHE
T ss_conf             476799937964365999999998389799965749999999860941315651320356699999999862986--113


Q ss_pred             CCCCCC
Q ss_conf             222111
Q gi|254780290|r  218 ILDMVG  223 (332)
Q Consensus       218 vid~~G  223 (332)
                      ++++.|
T Consensus        82 liNNAG   87 (245)
T COG3967          82 LINNAG   87 (245)
T ss_pred             EEECCC
T ss_conf             430300


No 128
>PRK08324 short chain dehydrogenase; Validated
Probab=95.84  E-value=0.00057  Score=45.37  Aligned_cols=250  Identities=17%  Similarity=0.197  Sum_probs=118.5

Q ss_pred             CCCCCEECCCCCCCCCCCCCCCCCCCC-CCCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             668730033000232222221222222-33332-----211223333322111111122222223222122222233322
Q gi|254780290|r   61 KNANPILGLEVAGKIVDLGENTTHWNI-GDEVC-----ALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVW  134 (332)
Q Consensus        61 ~~~p~v~G~e~~G~V~~vG~~v~~~~~-GdrV~-----~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~  134 (332)
                      ++.|.+.=..+.|.|. +|.+.+.-++ +| ++     .+...-.+..|..+++..++.+ +.|++|||=          
T Consensus       343 dp~Prv~lvpg~G~~~-~G~~~k~a~i~aD-i~~~~i~vi~~ae~~g~~~~l~e~e~F~~-EYW~LEqaK----------  409 (676)
T PRK08324        343 DPLPRVVLVPGLGMFG-FGKDAKEARIAAD-IYENAINVMRGAEAVGRYEPLSEQEAFDI-EYWSLEQAK----------  409 (676)
T ss_pred             CCCCEEEEECCCCEEE-ECCCHHHHHHHHH-HHHHHHHHHHHHHHCCCCCCCCHHHHHCC-CCCHHHHHH----------
T ss_conf             9998399987972699-7599899999999-99999999998883488611688885365-655177888----------


Q ss_pred             CCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC-CC----CCCCCCCCC----
Q ss_conf             211122--2222222222113444443222221222222221112232211111-12233-22----222222211----
Q gi|254780290|r  135 ANLFQT--ANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGA-KH----AINYLKEDF----  202 (332)
Q Consensus       135 ~~l~~~--~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa-~~----vi~~~~~~~----  202 (332)
                        |.+.  ...-.|+.+||+||+|++|.+.++-....|++|+.+++++++.+.+ .++.. ..    ..|-++++-    
T Consensus       410 --L~~~~~~~~L~GKVALVTGga~GIG~A~A~~fa~eGA~Vvl~D~~~~~l~~~a~el~~~~~~~~~~~DVtd~~~v~~~  487 (676)
T PRK08324        410 --LQKMPKPKPLAGKVALVTGAAGGIGLATAKRLAAEGACVVLADIDEEAAEAAAAELGGRDRALGVACDVTDEAAVQAA  487 (676)
T ss_pred             --HHCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHH
T ss_conf             --626899988899879994798816299999999879989999588899999999970799479998068999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC---C--------CC---------------CCCCCCCC---CCCCEEEEECCCCCCCC
Q ss_conf             11222222222111222211111---1--------22---------------22211223---45304798337875432
Q gi|254780290|r  203 LEILQKETQGRGIDIILDMVGAE---Y--------LN---------------QHLTLLSK---EGKLIIISFLGGNIATE  253 (332)
Q Consensus       203 ~~~i~~~t~g~g~Divid~~G~~---~--------~~---------------~~~~~l~~---~G~iv~~G~~~~~~~~~  253 (332)
                      .+++.+..+  ++|+++++.|..   .        |+               .+++.|+.   +|.++.++...+..+.+
T Consensus       488 v~~~~~~fG--gIDiLVnNAGi~~~~~~~e~s~e~w~~~~~vNl~g~f~~~r~a~p~M~~qg~GG~IV~isS~~a~~~~~  565 (676)
T PRK08324        488 FEEAALAFG--GVDIVVSNAGIALSGPIGETSDELWRRSFEVNFTGHFLVAREAVRIMKAQGTGGNLVFIASKNAVNPGP  565 (676)
T ss_pred             HHHHHHHHC--CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHCCCC
T ss_conf             999999859--988899767778998826599999999998860999999999999999769991999982577526799


Q ss_pred             C------------CC-----CHHHCCCCEEEEEEECCCHH---CCHHHHHHHHHH--HH-HHHHHCCCCCCCCEEEEEHH
Q ss_conf             2------------24-----33430532167775124000---113789999999--99-99998698310212474189
Q gi|254780290|r  254 I------------NL-----NPIISKRITITGSTLRRRTD---IAKQSIRDSLQL--KI-WPLLNSHVIAPVIHTVLPLG  310 (332)
Q Consensus       254 ~------------~~-----~~~~~~~~~i~g~~~~~~~~---~~~~~~~~~~~~--~~-~~~i~~g~l~p~i~~~~~l~  310 (332)
                      -            .+     .++-..++++....-+....   ............  .+ .+.+.++.+   ..+.-.-+
T Consensus       566 ~~~aY~asKAAl~~Ltr~lA~Ela~~GIRVNaV~Pg~V~t~~~~~~~~~~~~ra~a~g~~~e~y~~~~~---L~R~~~pe  642 (676)
T PRK08324        566 NFGAYSAAKAAELHLVRQYALELGPDGIRVNGVNPDAVRSGSGIWTGEWIEARAAAYGLSEEEYMARNL---LKREVTPE  642 (676)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHCCCC---CCCCCCHH
T ss_conf             968999999999999999999971229699998579647787557733468888755999899960598---89967899


Q ss_pred             HHHHHHHHHH---CCCCCCEEEE
Q ss_conf             9999999998---2998132898
Q gi|254780290|r  311 KVAMAHDIME---KSEHIGKIIL  330 (332)
Q Consensus       311 ~i~~A~~~l~---~g~~~GKvVi  330 (332)
                      |+.+|.-.+.   ++.++|-++.
T Consensus       643 DVA~av~fLASd~ss~iTG~~l~  665 (676)
T PRK08324        643 DVAEAFVFLASDLLAKTTGAIIT  665 (676)
T ss_pred             HHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             99999999848074292688778


No 129
>PRK06172 short chain dehydrogenase; Provisional
Probab=95.83  E-value=0.00068  Score=44.89  Aligned_cols=178  Identities=17%  Similarity=0.207  Sum_probs=90.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCC---CCCCCC----CCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111----11122332222---222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL----ACLKLGAKHAI---NYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~----~~~~lGa~~vi---~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.+.+++++.+    .+++.|.+..+   |-++++    +.+++.+.. | 
T Consensus         6 ~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~-G-   83 (253)
T PRK06172          6 SGQVALVTGGAAGIGRATAIAFAREGAKVVVADRDAAGGEETVALIREAGGEALFIACDVTRDAEVKALVEKTIAAY-G-   83 (253)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC-C-
T ss_conf             99989993757689999999999879989999798899999999999649937999818999999999999999982-9-


Q ss_pred             CCCCCCCCCCCC----CC-C----------------------CCCCCC--CCCCCCEEEEECCCCCCCCCC---------
Q ss_conf             111222211111----12-2----------------------222112--234530479833787543222---------
Q gi|254780290|r  214 GIDIILDMVGAE----YL-N----------------------QHLTLL--SKEGKLIIISFLGGNIATEIN---------  255 (332)
Q Consensus       214 g~Divid~~G~~----~~-~----------------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~---------  255 (332)
                      ++|+.+++.|..    .+ +                      .+++.+  +.+|+++.++...+....+-.         
T Consensus        84 ~iDiLVNNAGi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVnisS~~g~~~~~~~~~Y~asKaa  163 (253)
T PRK06172         84 RLDYAFNNAGIEIEQGRLAEGSEAEFDAIMGVNVKGVWLCMKYQIPLMLAQGGGAIVNTASVAGLGAAPKMSIYAASKHA  163 (253)
T ss_pred             CCCEEEECCCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCCCHHHHHHHHH
T ss_conf             99999989888999999013999999999999739999999999999998599589997666647689997789999999


Q ss_pred             --------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHH--HHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---
Q ss_conf             --------4334305321677751240001137899999--999999998698310212474189999999999829---
Q gi|254780290|r  256 --------LNPIISKRITITGSTLRRRTDIAKQSIRDSL--QLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---  322 (332)
Q Consensus       256 --------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~--~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---  322 (332)
                              ..++-.+++++....-+...   .+......  ..+..+.+.+.  .|+ .+.=..+|+..+.-.|.+-   
T Consensus       164 l~~ltr~lA~e~a~~gIrVNaV~PG~i~---T~~~~~~~~~~~~~~~~~~~~--~Pl-~R~g~pediA~~v~FLaSd~a~  237 (253)
T PRK06172        164 VIGLTKSAAIEYAKKGIRVNAVCPAVID---TDMFRRAYEADPRKAEFAAAM--HPV-GRIGKVEEIANAVLYLCSDGAS  237 (253)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEECCCC---CHHHHHHCCCCHHHHHHHHHC--CCC-CCCCCHHHHHHHHHHHHCCHHC
T ss_conf             9999999999863318789999779798---757764421899999999737--998-9985999999999999385326


Q ss_pred             CCCCEEEE
Q ss_conf             98132898
Q gi|254780290|r  323 EHIGKIIL  330 (332)
Q Consensus       323 ~~~GKvVi  330 (332)
                      -.+|-++.
T Consensus       238 ~iTG~~i~  245 (253)
T PRK06172        238 FTTGHSLM  245 (253)
T ss_pred             CCCCCEEE
T ss_conf             82598287


No 130
>PRK07576 short chain dehydrogenase; Provisional
Probab=95.81  E-value=0.00058  Score=45.32  Aligned_cols=179  Identities=17%  Similarity=0.209  Sum_probs=93.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----1223322---22222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++++|.+.++-....|++|+.+.+++++.+.+    ++.|.+.   ..|-++.+    +.+.+.+.. | 
T Consensus         7 ~gK~alVTGgs~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~-G-   84 (260)
T PRK07576          7 AGKNVFVVGGTSGINLGIAQAFARAGANVAVASRSQEKVDAAVAQLQQAGPEALGVSADVRDYAAVEAAFAAIADEF-G-   84 (260)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHH-C-
T ss_conf             89989995896199999999999879999999798899999999999539948999931899999999999999984-9-


Q ss_pred             CCCCCCCCCCCCC-----------C---------------CCCCCCCC-CCCCCEEEEECCCCCCCCCC-----------
Q ss_conf             1112222111111-----------2---------------22221122-34530479833787543222-----------
Q gi|254780290|r  214 GIDIILDMVGAEY-----------L---------------NQHLTLLS-KEGKLIIISFLGGNIATEIN-----------  255 (332)
Q Consensus       214 g~Divid~~G~~~-----------~---------------~~~~~~l~-~~G~iv~~G~~~~~~~~~~~-----------  255 (332)
                      ++|+++++.|...           |               +.+++.|+ .+|+++.++...+..+.+-.           
T Consensus        85 ~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vnl~~~~~~~~~~~p~m~~~~G~IInisS~~~~~~~~~~~~y~asKaav~  164 (260)
T PRK07576         85 PIDVLVSGAAGNFPAPAAGMSANGFKTVVDIDLLGTFNVLKAAYPLLRRPGASIIQISAPQAVVAMPMQAHVCAAKAGVD  164 (260)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHCCCCCCHHHHHHHHHHHH
T ss_conf             99899989867899891559999999999986463899999999998717977999988211367887189999999999


Q ss_pred             ------CCHHHCCCCEEEEEEECCCHHCCHHHHHHH-HHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC---CCCC
Q ss_conf             ------433430532167775124000113789999-999999999869831021247418999999999982---9981
Q gi|254780290|r  256 ------LNPIISKRITITGSTLRRRTDIAKQSIRDS-LQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK---SEHI  325 (332)
Q Consensus       256 ------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~-~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~---g~~~  325 (332)
                            ..++-.+++++....-+...+.  ...... ...+..+.+.+.  .| ..+.-.-+|+.++.-.|.+   +-.+
T Consensus       165 ~ltk~lA~e~a~~gIrVN~IaPG~i~~t--~~~~~~~~~~~~~~~~~~~--~P-l~R~g~pedia~~v~FL~Sd~s~~iT  239 (260)
T PRK07576        165 MLTRTLALEWGPEGVRVNSISPGPIAGT--EGMARLAPTPELQAAVAQS--VP-LKRNGTGQDIANAALFLASDMASYIT  239 (260)
T ss_pred             HHHHHHHHHHHHCCEEEEEEEECCCCCC--HHHHHCCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             9999999997133929999834775783--6666327999999999847--99-99986999999999999587424825


Q ss_pred             CEEEE
Q ss_conf             32898
Q gi|254780290|r  326 GKIIL  330 (332)
Q Consensus       326 GKvVi  330 (332)
                      |-++.
T Consensus       240 G~~i~  244 (260)
T PRK07576        240 GVVLP  244 (260)
T ss_pred             CCEEE
T ss_conf             86188


No 131
>PRK12829 short chain dehydrogenase; Provisional
Probab=95.80  E-value=0.00056  Score=45.41  Aligned_cols=77  Identities=25%  Similarity=0.371  Sum_probs=51.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC---CCCC-CCCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-122---3322-22222221----11122222222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKL---GAKH-AINYLKED----FLEILQKETQGRGI  215 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~l---Ga~~-vi~~~~~~----~~~~i~~~t~g~g~  215 (332)
                      .|+++||+||++|+|.+.++.....|++|+.+.+++++.+.+ +++   ++.. ..|-++++    +.+++.+..+  ++
T Consensus        10 ~GKvalVTGgs~GIG~aiA~~la~~Ga~V~i~~r~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G--~i   87 (264)
T PRK12829         10 DGLRVLVTGGASGIGRAIAEAFAEAGARVHVCDVSEAALAATAARLPGAKVTATVADVADPAQVERVFDTAVERFG--GL   87 (264)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHCC--CC
T ss_conf             9997999473768999999999987998999979989999999974799759999628999999999999999739--99


Q ss_pred             CCCCCCCC
Q ss_conf             12222111
Q gi|254780290|r  216 DIILDMVG  223 (332)
Q Consensus       216 Divid~~G  223 (332)
                      |+.+++.|
T Consensus        88 DiLVNNAG   95 (264)
T PRK12829         88 DVLVNNAG   95 (264)
T ss_pred             CEEEECCC
T ss_conf             89998998


No 132
>PRK06124 gluconate 5-dehydrogenase; Provisional
Probab=95.78  E-value=0.00061  Score=45.21  Aligned_cols=183  Identities=17%  Similarity=0.243  Sum_probs=94.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C---CCCCCC---CCCCCCCCCC----CCCC
Q ss_conf             222222222222113444443222221222222221112232211111-1---223322---2222222111----1222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-L---KLGAKH---AINYLKEDFL----EILQ  207 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~---~lGa~~---vi~~~~~~~~----~~i~  207 (332)
                      +...+ .|+++||+||++|+|...++.....|++|+.+.+++++.+.+ +   +.|...   ..|-++++-.    +++.
T Consensus         8 ~~~~L-~gK~alITGgs~GIG~~ia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~~~~~~   86 (259)
T PRK06124          8 QRFSL-AGQVALVTGSARGLGLEIARALAEAGAHVLVNGRNAARVEAAVAALRAAGGAAEALVFDISDEEAVAAAFARID   86 (259)
T ss_pred             HHCCC-CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             64099-99989992867489999999999879999999698899999999999659958999951799999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCC----C-------CC---------------CCCCCCCC--CCCCEEEEECCCCCCCCCC----
Q ss_conf             222222111222211111----1-------22---------------22211223--4530479833787543222----
Q gi|254780290|r  208 KETQGRGIDIILDMVGAE----Y-------LN---------------QHLTLLSK--EGKLIIISFLGGNIATEIN----  255 (332)
Q Consensus       208 ~~t~g~g~Divid~~G~~----~-------~~---------------~~~~~l~~--~G~iv~~G~~~~~~~~~~~----  255 (332)
                      +..  ..+|+.+++.|..    .       |+               ..++.|+.  +|+++.++...+....+-.    
T Consensus        87 ~~~--g~iDiLVnnAG~~~~~~~~~~~~e~~~~~~~~Nl~g~~~~~q~~~~~M~~~~~G~IInisS~~~~~~~~~~~~Y~  164 (259)
T PRK06124         87 AEH--GRLDILVNNVGARNRRPLAELDDAEIRALLETDLVAPILLSRLAAQRMVRQGYGRIIAITSIAGEVARAGDAVYP  164 (259)
T ss_pred             HHC--CCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHH
T ss_conf             975--999799989888999990669999999999998499999999999998776993699972330046799837899


Q ss_pred             -------------CCHHHCCCCEEEEEEECCCH-HCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC
Q ss_conf             -------------43343053216777512400-0113789999999999999869831021247418999999999982
Q gi|254780290|r  256 -------------LNPIISKRITITGSTLRRRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK  321 (332)
Q Consensus       256 -------------~~~~~~~~~~i~g~~~~~~~-~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~  321 (332)
                                   ..++-..++++....-+... +.......   ..+..+.+.+.  .| ..+.=.-+|+..+.-.+.+
T Consensus       165 asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~---~~~~~~~~~~~--~P-l~R~g~pedia~~v~fL~S  238 (259)
T PRK06124        165 AAKQGLTGLMRALAAEFGPHGITSNAIAPGYFATETNAAMAA---DPEVGEWLRAR--TP-LGRWGRPEEIAGAAVFLAS  238 (259)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHHCC---CHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHC
T ss_conf             999999999999999965139799999758897732211127---99999999857--99-8998599999999999958


Q ss_pred             C---CCCCEEEE
Q ss_conf             9---98132898
Q gi|254780290|r  322 S---EHIGKIIL  330 (332)
Q Consensus       322 g---~~~GKvVi  330 (332)
                      .   -.+|-++.
T Consensus       239 d~ssyiTG~~i~  250 (259)
T PRK06124        239 PAASYVNGHVLA  250 (259)
T ss_pred             CHHCCCCCCEEE
T ss_conf             443586385388


No 133
>PRK07890 short chain dehydrogenase; Provisional
Probab=95.77  E-value=0.00069  Score=44.84  Aligned_cols=181  Identities=15%  Similarity=0.159  Sum_probs=94.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----12233222---2222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++|+|.+.++-+...|++|+...+++++.+.+    ++.|.+..   .|-++++    +.+++.+..+  
T Consensus         4 ~gK~alVTG~s~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~fG--   81 (258)
T PRK07890          4 KDKVVVVSGVGPGLGTTLAVRAAREGADVVLAARTAERLDEVAKQIDDLGRRALAVVTDITDEAQVANLVDAALERFG--   81 (258)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC--
T ss_conf             998899968565899999999998799899997989999999999996499589998169999999999999999849--


Q ss_pred             CCCCCCCCCCC-CC---C--------C---------------CCCCCCC-CCCCCEEEEECCCCCCCCCC----------
Q ss_conf             11122221111-11---2--------2---------------2221122-34530479833787543222----------
Q gi|254780290|r  214 GIDIILDMVGA-EY---L--------N---------------QHLTLLS-KEGKLIIISFLGGNIATEIN----------  255 (332)
Q Consensus       214 g~Divid~~G~-~~---~--------~---------------~~~~~l~-~~G~iv~~G~~~~~~~~~~~----------  255 (332)
                      ++|+++++.|. ..   +        +               .+++.|+ .+|+++.++......+.+-.          
T Consensus        82 ~iDiLVnnAg~~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~k~~~p~m~~~~G~IVnisS~~~~~~~~~~~~Y~~sKaal  161 (258)
T PRK07890         82 RVDVLVNNAFRVPSMKPLAGADFDHWRDVIETNVLGTLRLTQAFTPALAESGGSVVMINSMVLRHSQPKYGAYKMAKGAL  161 (258)
T ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCCCCCCCHHHHHHHHHH
T ss_conf             99899986866789998002999999999998759999999988999997698599982565488899977899999999


Q ss_pred             -------CCHHHCCCCEEEEEEECCCH-HCCHHHHHHH------HHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC
Q ss_conf             -------43343053216777512400-0113789999------999999999869831021247418999999999982
Q gi|254780290|r  256 -------LNPIISKRITITGSTLRRRT-DIAKQSIRDS------LQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK  321 (332)
Q Consensus       256 -------~~~~~~~~~~i~g~~~~~~~-~~~~~~~~~~------~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~  321 (332)
                             ..++-.+++++....-+... +.........      ...++.+.+.+.  .| ..+.-..+|+.++...|.+
T Consensus       162 ~~ltk~lA~ela~~gIrVN~V~PG~i~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~p-l~R~g~p~diA~~v~fL~S  238 (258)
T PRK07890        162 LAASQSLATELGPQGIRVNSVAPGYIWGDPLQGYFDHQAGKYGTTVEEIYAATAAN--SD-LKRLPTDDEVASAVLFLAS  238 (258)
T ss_pred             HHHHHHHHHHHHHHCEEEEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHC
T ss_conf             99999999997140959999951878875256688766654299989999999707--99-9999799999999999958


Q ss_pred             ---CCCCCEEEE
Q ss_conf             ---998132898
Q gi|254780290|r  322 ---SEHIGKIIL  330 (332)
Q Consensus       322 ---g~~~GKvVi  330 (332)
                         +..+|-++.
T Consensus       239 d~a~~iTG~~i~  250 (258)
T PRK07890        239 DLASAITGQTLD  250 (258)
T ss_pred             CHHCCCCCCEEE
T ss_conf             532394387478


No 134
>PRK07102 short chain dehydrogenase; Provisional
Probab=95.76  E-value=0.0005  Score=45.78  Aligned_cols=76  Identities=24%  Similarity=0.291  Sum_probs=46.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC---CCCC----CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22221134444432222212222222211122322111111-22---3322----2222222111122222222211122
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-KL---GAKH----AINYLKEDFLEILQKETQGRGIDII  218 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~l---Ga~~----vi~~~~~~~~~~i~~~t~g~g~Div  218 (332)
                      ++|||+||++|+|.+.++-+...|++|+.+++++++.+.+. ++   +...    ..|-++.+-.+.+.+...+ .+|++
T Consensus         2 K~vlITGassGIG~a~A~~la~~G~~v~l~~R~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~-~~d~~   80 (243)
T PRK07102          2 KKILIIGATSDIARACARRYAAAGARLYLAARDTERLERIAADLEARGAVAVATHELDILDTARHAAFLDNLPA-LPDTV   80 (243)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHH-HCCEE
T ss_conf             97999157459999999999987998999989889999999999853586289984340369999999999875-37979


Q ss_pred             CCCCC
Q ss_conf             22111
Q gi|254780290|r  219 LDMVG  223 (332)
Q Consensus       219 id~~G  223 (332)
                      +.+.|
T Consensus        81 v~~aG   85 (243)
T PRK07102         81 LIAVG   85 (243)
T ss_pred             EEEEE
T ss_conf             99730


No 135
>PRK10538 3-hydroxy acid dehydrogenase; Provisional
Probab=95.73  E-value=0.00066  Score=44.98  Aligned_cols=101  Identities=24%  Similarity=0.332  Sum_probs=62.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC---CCCCCCCC----CCCCCCCCCCCCCCCCCC
Q ss_conf             222113444443222221222222221112232211111-1223322---22222221----111222222222111222
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKH---AINYLKED----FLEILQKETQGRGIDIIL  219 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~---vi~~~~~~----~~~~i~~~t~g~g~Divi  219 (332)
                      -+||+||++|+|.+.++.+...|++|+.+++++++.+.+ +++|...   .+|-++.+    +.+.+.+..  ..+|+++
T Consensus         2 VvlVTGassGIG~a~A~~la~~Ga~Vv~~~r~~~~l~~l~~~lg~~~~~~~~Dvsd~~~v~~~~~~~~~~~--g~iDiLV   79 (248)
T PRK10538          2 IVLVTGATAGFGECITRRFIQNGHKVIATGRRQERLQELKDELGDNLYIAQLDVRNRAAIEEMLASLPAEW--RNIDILV   79 (248)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHC--CCCCEEE
T ss_conf             99998886699999999999879999999899999999999848867999973488899999999999970--9975999


Q ss_pred             CCCCCC----C--------CC---------------CCCCCC--CCCCCCEEEEECCCCC
Q ss_conf             211111----1--------22---------------222112--2345304798337875
Q gi|254780290|r  220 DMVGAE----Y--------LN---------------QHLTLL--SKEGKLIIISFLGGNI  250 (332)
Q Consensus       220 d~~G~~----~--------~~---------------~~~~~l--~~~G~iv~~G~~~~~~  250 (332)
                      ++.|..    .        |+               ..++.|  +.+|+++.++...+..
T Consensus        80 nNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~ag~~  139 (248)
T PRK10538         80 NNAGLALGLEPAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTAGSW  139 (248)
T ss_pred             ECCCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             778546788863768999998777524131999999986766635995899993600078


No 136
>PRK05854 short chain dehydrogenase; Provisional
Probab=95.73  E-value=0.00093  Score=43.98  Aligned_cols=78  Identities=27%  Similarity=0.394  Sum_probs=50.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C-----CCCCC---CCCCC----CCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112-2-----33222---22222----211112222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK-L-----GAKHA---INYLK----EDFLEILQKETQ  211 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~-l-----Ga~~v---i~~~~----~~~~~~i~~~t~  211 (332)
                      .|++++|+||++|+|..+++-+...|++|+.++|+++|.+.+.+ +     ++...   +|-.+    ..+.+++.+.  
T Consensus        13 ~GK~~vITGa~sGIG~~~a~~La~~Ga~Vil~~R~~~k~~~a~~~i~~~~~~~~v~~~~lDLs~l~sVr~~a~~~~~~--   90 (314)
T PRK05854         13 SGKLAVVTGASSGLGFGLARRLAAAGADVILPVRNRAKGEAAVAAIRTAVPDAKLTIRALDLSSLASVAALGEQLLAE--   90 (314)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHC--
T ss_conf             999899906882999999999997849899997999999999999998689985699964631689999999987530--


Q ss_pred             CCCCCCCCCCCCC
Q ss_conf             2211122221111
Q gi|254780290|r  212 GRGIDIILDMVGA  224 (332)
Q Consensus       212 g~g~Divid~~G~  224 (332)
                      ....|+.+++.|.
T Consensus        91 ~~~lDiLInNAGv  103 (314)
T PRK05854         91 GRPIHLLINNAGV  103 (314)
T ss_pred             CCCCCEEEECCCC
T ss_conf             6875278726766


No 137
>PRK08265 short chain dehydrogenase; Provisional
Probab=95.72  E-value=0.0006  Score=45.21  Aligned_cols=181  Identities=13%  Similarity=0.132  Sum_probs=91.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCC---CCCCCCC----CCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111-112233222---2222221----111222222222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA-CLKLGAKHA---INYLKED----FLEILQKETQGRGID  216 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~-~~~lGa~~v---i~~~~~~----~~~~i~~~t~g~g~D  216 (332)
                      .|+++||+||++|+|...++-+...|++|+.+.+++++.+. ++++|....   .|-++++    +.+.+.+.. | ..|
T Consensus         5 ~gKvalVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~i~~~~~~~~~~f-G-~iD   82 (261)
T PRK08265          5 AGKVAIVTGGATLIGAAVARALVAAGACVAILDIDADNGAAVAASLGERARFIATDITDDAAIERAVATAVARF-G-GLD   82 (261)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHH-C-CCC
T ss_conf             99989994877689999999999879989999798899999999819972899813899999999999999981-9-987


Q ss_pred             CCCCCCCC---CC-------CC---------------CCCCCC-CCCCCCEEEEECCCCCCCCCC---------------
Q ss_conf             22221111---11-------22---------------222112-234530479833787543222---------------
Q gi|254780290|r  217 IILDMVGA---EY-------LN---------------QHLTLL-SKEGKLIIISFLGGNIATEIN---------------  255 (332)
Q Consensus       217 ivid~~G~---~~-------~~---------------~~~~~l-~~~G~iv~~G~~~~~~~~~~~---------------  255 (332)
                      +++++.|.   ..       |.               .+++.| +.+|+++.++...+....+-.               
T Consensus        83 iLVNNAg~~~~~~~~~~~e~w~~~~~vNl~~~~~~~q~~~~~m~~~~G~IInisS~~~~~~~~~~~~Y~asKaal~~ltk  162 (261)
T PRK08265         83 ILVNLACTYVDDGLASSRADWLAALDVNLVSAAMLAQAAHPHLKRGGGAIVNFTSISAKVAQTGRWLYPASKAAIRQLTR  162 (261)
T ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             89985755788734399999999999983999999999999998769779999653304578885067999999999999


Q ss_pred             --CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CCCCEEEE
Q ss_conf             --4334305321677751240001137899999999999998698310212474189999999999829---98132898
Q gi|254780290|r  256 --LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EHIGKIIL  330 (332)
Q Consensus       256 --~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~~GKvVi  330 (332)
                        ..++-.+++++....-+................+......  ...| ..+.-.-+|+.++.-.+.+-   -.+|-++.
T Consensus       163 ~lA~e~a~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~--~~~P-l~R~g~p~dIa~~v~fL~Sd~a~~iTGq~i~  239 (261)
T PRK08265        163 SMAMDLAPDGIRVNSVSPGWTWSRVMDELSGGDRAKADRVAA--PFHL-LGRVGDPEEVAQVVAFLCSDAASFVTGADYA  239 (261)
T ss_pred             HHHHHHHHHCEEEEEEEECCCCCHHHHHHCCCCHHHHHHHHH--CCCC-CCCCCCHHHHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             999997410929988855877867787643588999999861--3788-8997589999999999967742383597087


No 138
>PRK08264 short chain dehydrogenase; Validated
Probab=95.72  E-value=0.0013  Score=43.12  Aligned_cols=75  Identities=20%  Similarity=0.334  Sum_probs=46.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222-211122322111111223322222222211112222222221112222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G  223 (332)
                      .|+++||+||++|+|...+.-+...|++ |++..++++..+..+-.  ...+|-++++-.+.+.+...  .+|+++++.|
T Consensus         4 ~gK~alITGassGIG~aiA~~la~~Ga~~V~~~~r~~~~~~~~~~~--~~~~Dv~d~~~v~~~~~~~~--~idvlVnNAG   79 (235)
T PRK08264          4 KGKVVLVTGANRGIGRAFVEELLARGAAKVYAAARDPESVDLPRVV--PLQLDVTDPASVAAAAEQAS--DVTILINNAG   79 (235)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCHHHCCCCCEE--EEEECCCCHHHHHHHHHHCC--CCCEEEECCC
T ss_conf             9988999267549999999999986997799972784035559879--99806899999999999739--9869998885


No 139
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.71  E-value=0.0006  Score=45.21  Aligned_cols=180  Identities=13%  Similarity=0.149  Sum_probs=89.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC----CCCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-1223322----22222221----11122222222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKH----AINYLKED----FLEILQKETQGRGI  215 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~----vi~~~~~~----~~~~i~~~t~g~g~  215 (332)
                      +|+++||+||++++|.+.++.+...|++|+.+.+++++.+.+ +++.-..    ..|-++.+    +.+++.+..  .++
T Consensus         5 ~gK~alITGgs~GIG~aia~~la~~G~~V~i~~r~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~--g~i   82 (250)
T PRK07231          5 EGKVAIVTGAGSGFGEGIARRFAAEGARVVVTDRNQEAAERVAAEIRGGRAIAVAADVSDEADVRAAVEAALERF--GSV   82 (250)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHH--CCC
T ss_conf             998899938886899999999998799999997988999999998449967999930799999999999999981--997


Q ss_pred             CCCCCCCCCC----CC--------C---------------CCCCCCC--CCCCCEEEEECCCCCCCCCC-----------
Q ss_conf             1222211111----12--------2---------------2221122--34530479833787543222-----------
Q gi|254780290|r  216 DIILDMVGAE----YL--------N---------------QHLTLLS--KEGKLIIISFLGGNIATEIN-----------  255 (332)
Q Consensus       216 Divid~~G~~----~~--------~---------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~-----------  255 (332)
                      |+.+++.|..    .+        +               ..++.|+  .+|+++.++...+..+.+-.           
T Consensus        83 D~lInnAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IinisS~~~~~~~~~~~~Y~asKaal~  162 (250)
T PRK07231         83 DILVNNAGTTHRNGPLLDVDEAEFDRVYAVNVKSIYLWAQAAVPAWRGEGGGAIVNVASTAGIRPRPGLGWYNASKGAVI  162 (250)
T ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHHHHHHH
T ss_conf             19998883378998927699999999999998999999999999999839964999944776588999627999999999


Q ss_pred             -C-----CHHHCCCCEEEEEEECCCHHCCH-HHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CCC
Q ss_conf             -4-----33430532167775124000113-7899999999999998698310212474189999999999829---981
Q gi|254780290|r  256 -L-----NPIISKRITITGSTLRRRTDIAK-QSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EHI  325 (332)
Q Consensus       256 -~-----~~~~~~~~~i~g~~~~~~~~~~~-~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~~  325 (332)
                       +     .++-..++++....-+.. +..- .........+..+.+.+.  .| ..+.-..+|+.++...|.+.   -.+
T Consensus       163 ~lt~~lA~el~~~gIrVN~I~PG~v-~T~~~~~~~~~~~~~~~~~~~~~--~P-l~R~~~p~dia~~v~fL~S~~s~~it  238 (250)
T PRK07231        163 TATKSLAVELAPDNIRVNAVNPVVG-ETGLLEAFMGEPTPENRAKFLAT--IP-LGRLGTPEDIANAAAFLASDEASFIT  238 (250)
T ss_pred             HHHHHHHHHHHHCCEEEEEEEECCC-CCHHHHHHHCCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             9999999995340959999963879-86377775238989999999837--99-99981999999999999685332946


Q ss_pred             CEEEE
Q ss_conf             32898
Q gi|254780290|r  326 GKIIL  330 (332)
Q Consensus       326 GKvVi  330 (332)
                      |-++.
T Consensus       239 G~~i~  243 (250)
T PRK07231        239 GVALE  243 (250)
T ss_pred             CCEEE
T ss_conf             87188


No 140
>PRK06196 oxidoreductase; Provisional
Probab=95.70  E-value=0.0011  Score=43.55  Aligned_cols=91  Identities=26%  Similarity=0.384  Sum_probs=57.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC-CCC-CCCCCC----CCC
Q ss_conf             3332221112222222222221134444432222212222222211122322111111-223-322-222222----211
Q gi|254780290|r  130 FFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-KLG-AKH-AINYLK----EDF  202 (332)
Q Consensus       130 ~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~lG-a~~-vi~~~~----~~~  202 (332)
                      ..||.+.+... ++ .|++++|+||++|+|..++.-+...|++|+..+|+++|.+.+. ++. ++. .+|-.+    ..+
T Consensus        12 ~sta~~v~~~~-dL-~GK~~vITGa~sGIG~~tA~~La~~Ga~Vil~~R~~~k~~~a~~~i~~~~~~~lDLs~~~sVr~~   89 (316)
T PRK06196         12 ASTASDVLAGL-DL-SGKTAIVTGGYSGLGLETTRALAQAGAHVVVPARRPDAAREALAGIDGVEVVALDLADLASVRAF   89 (316)
T ss_pred             CCCHHHHHCCC-CC-CCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEECCCCCHHHHHHH
T ss_conf             89899995287-99-99989991799679999999999789989999499999999998741785798368899999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1122222222211122221111
Q gi|254780290|r  203 LEILQKETQGRGIDIILDMVGA  224 (332)
Q Consensus       203 ~~~i~~~t~g~g~Divid~~G~  224 (332)
                      .+++.+..  ..+|+.+++.|.
T Consensus        90 a~~~~~~~--~~lDvLInNAGi  109 (316)
T PRK06196         90 AERFLDSG--RRIDILINNAGV  109 (316)
T ss_pred             HHHHHHHC--CCCEEEEECCCC
T ss_conf             99999757--983299957876


No 141
>PRK08339 short chain dehydrogenase; Provisional
Probab=95.70  E-value=0.00072  Score=44.70  Aligned_cols=80  Identities=20%  Similarity=0.234  Sum_probs=50.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCC---CCCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112-----23322---2222222-111122222222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK-----LGAKH---AINYLKE-DFLEILQKETQGRGI  215 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~-----lGa~~---vi~~~~~-~~~~~i~~~t~g~g~  215 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.+.+++++.+.+.+     .+.+.   ..|-+++ +..+.+.+...-.+.
T Consensus         7 ~gK~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~v~~~~~~~~~~g~~   86 (263)
T PRK08339          7 SGKLAFTTASSKGIGFGVARVLARAGADVIILSRNEENLKRAKEKIKSESDVEVHYIVADLTKREDLERTVKELKNIGDP   86 (263)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             99989991626099999999999869999999798899999999998504985799984899999999999999956999


Q ss_pred             CCCCCCCCC
Q ss_conf             122221111
Q gi|254780290|r  216 DIILDMVGA  224 (332)
Q Consensus       216 Divid~~G~  224 (332)
                      |+++++.|.
T Consensus        87 dilv~nag~   95 (263)
T PRK08339         87 DIFFFSTGG   95 (263)
T ss_pred             CEEEECCCC
T ss_conf             899989999


No 142
>TIGR01777 yfcH conserved hypothetical protein TIGR01777; InterPro: IPR010099   This entry represents proteins of unknown function including the Escherichia coli YfcH protein..
Probab=95.69  E-value=0.0034  Score=40.25  Aligned_cols=85  Identities=20%  Similarity=0.227  Sum_probs=54.0

Q ss_pred             CCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCC
Q ss_conf             221134-44443222221222222221112232211111122332222222221111222222--222111222211111
Q gi|254780290|r  149 VLIHGG-SSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKET--QGRGIDIILDMVGAE  225 (332)
Q Consensus       149 vlV~ga-~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t--~g~g~Divid~~G~~  225 (332)
                      |||+|| +|=||...++-++..|.+|+..+|++.+....+........+..  .+.-.+.+..  .-+++|+||+-.|..
T Consensus         1 ~litGgnTGfiG~~L~~~L~~~g~~V~~l~R~~~~~~~~~~~~~~~~~~~~--~~g~~~~~~~W~~l~~~DaviNLAG~~   78 (307)
T TIGR01777         1 ILITGGNTGFIGRALTQRLTKSGHEVTILTRSPQAESNTKKVGYKNWLAEG--KLGIVIAESGWSALEGADAVINLAGEP   78 (307)
T ss_pred             CEECCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHCCCCCCCCCCC--CCCCCCCHHCCCCCCCCCEEEECCCCC
T ss_conf             964153302378999999984799899996168643200025544555522--124520722056678862798556888


Q ss_pred             CCC-CCCCCCC
Q ss_conf             122-2221122
Q gi|254780290|r  226 YLN-QHLTLLS  235 (332)
Q Consensus       226 ~~~-~~~~~l~  235 (332)
                      .++ .=|+--.
T Consensus        79 i~~P~RWt~~~   89 (307)
T TIGR01777        79 IADPKRWTEER   89 (307)
T ss_pred             CCCCCCCCHHH
T ss_conf             57788878777


No 143
>PRK06197 short chain dehydrogenase; Provisional
Probab=95.67  E-value=0.001  Score=43.67  Aligned_cols=84  Identities=18%  Similarity=0.288  Sum_probs=53.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C----CC-CC-CC--CCCCC----CCCCC
Q ss_conf             12222222222221134444432222212222222211122322111111-2----23-32-22--22222----21111
Q gi|254780290|r  138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-K----LG-AK-HA--INYLK----EDFLE  204 (332)
Q Consensus       138 ~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~----lG-a~-~v--i~~~~----~~~~~  204 (332)
                      .+.-++ .|++++|+||++|+|..+++.+...|++|+..+|+.+|.+.+. +    .+ +. .+  +|-.+    ..+.+
T Consensus         9 ~~ipDL-~GK~~lITGa~sGIG~~~A~~La~~ga~Vil~~R~~~k~~~a~~~i~~~~~~~~i~~~~lDLssl~sV~~~a~   87 (306)
T PRK06197          9 ADIPDQ-SGRVAVVTGANTGLGYETAAALAAKGAHVVLAVRNLDKGNAAAARITAAHPGADVTLQELDLASLASVRAAAD   87 (306)
T ss_pred             HHCCCC-CCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHH
T ss_conf             568898-9999999168959999999999978498999979899999999999976899857999766430778999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222211122221111
Q gi|254780290|r  205 ILQKETQGRGIDIILDMVGA  224 (332)
Q Consensus       205 ~i~~~t~g~g~Divid~~G~  224 (332)
                      ++.+..  ..+|+.+++.|.
T Consensus        88 ~~~~~~--~~lDvLinNAGi  105 (306)
T PRK06197         88 ALRAAY--PRIDLLINNAGV  105 (306)
T ss_pred             HHHHCC--CCCCEEEECCCC
T ss_conf             999618--987689977844


No 144
>PRK01683 trans-aconitate 2-methyltransferase; Provisional
Probab=95.67  E-value=0.0016  Score=42.44  Aligned_cols=97  Identities=16%  Similarity=0.243  Sum_probs=64.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             122222222222211344444322222122-2222221112232211111122332222222221111222222222111
Q gi|254780290|r  138 FQTANLRSGQTVLIHGGSSGIGTTAIQLAS-YFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGID  216 (332)
Q Consensus       138 ~~~~~~~~g~~vlV~ga~g~vG~~a~qla~-~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~D  216 (332)
                      ....+++++++||=.| | |.|..+-.|+. +-+++|++++.|++-++.+++.....  .....|    +.+......+|
T Consensus        24 l~~l~~~~~~~vlDlG-C-G~G~~t~~l~~r~p~a~v~GiD~S~~Ml~~Ar~~~~~~--~f~~~D----~~~~~~~~~~D   95 (252)
T PRK01683         24 LARVPLENVEYVADLG-C-GPGNSTALLHQRWPAARITGIDSSPAMLAEARQALPDC--QFVEAD----IRNWQPEQALD   95 (252)
T ss_pred             HHCCCCCCCCEEEEEC-C-CCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCC--EEEECC----HHCCCCCCCCC
T ss_conf             8418888999899937-7-49899999999779987999989899999999758998--387250----42078767878


Q ss_pred             CCCCCCC----C---CCCCCCCCCCCCCCCCEE
Q ss_conf             2222111----1---112222211223453047
Q gi|254780290|r  217 IILDMVG----A---EYLNQHLTLLSKEGKLII  242 (332)
Q Consensus       217 ivid~~G----~---~~~~~~~~~l~~~G~iv~  242 (332)
                      +||.+..    .   ..+....++|++||+++.
T Consensus        96 ~ifSNaalhW~~d~~~~~~~~~~~L~PGG~la~  128 (252)
T PRK01683         96 LIYANASLQWLPDHYELFPHLVSLLAPQGVLAV  128 (252)
T ss_pred             EEEEEEEHHHCCCHHHHHHHHHHHCCCCCEEEE
T ss_conf             895610045078779999999982487879999


No 145
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=95.65  E-value=0.00079  Score=44.46  Aligned_cols=177  Identities=18%  Similarity=0.215  Sum_probs=90.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C----CCCCCCCCCC---CCCCCCC----CCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211-1----1112233222---2222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC-L----ACLKLGAKHA---INYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~-~----~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g  212 (332)
                      .|+++||+||++++|.+.++-+...|++|+.++++.++. +    .+++.|.+..   .|-++++    +.+.+.+..  
T Consensus         4 ~gK~~lITGgs~GIG~aia~~la~~G~~Vii~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dlt~~~~v~~~~~~~~~~~--   81 (248)
T PRK05557          4 EGKVALVTGASRGIGRAIAERLAAQGANVVLNYASSEAGAEALVAEIGALGGKALAVQGDVADAESIERAVDEAKAEF--   81 (248)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHC--
T ss_conf             998899948976899999999998799899996985658999999999639958999903899999999999999982--


Q ss_pred             CCCCCCCCCCCCC-----------CCC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC---------
Q ss_conf             2111222211111-----------122---------------222112--234530479833787543222---------
Q gi|254780290|r  213 RGIDIILDMVGAE-----------YLN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN---------  255 (332)
Q Consensus       213 ~g~Divid~~G~~-----------~~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~---------  255 (332)
                      .++|+++++.|..           .|+               ..++.|  ...|+++.++...+..+.+-.         
T Consensus        82 g~iD~linnAg~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaa  161 (248)
T PRK05557         82 GGVDILVNNAGITRDNLLMRMKEEDWDRVIDTNLTGVFNLTKAVARPMMKQRSGRIINISSVVGLMGNPGQANYAASKAG  161 (248)
T ss_pred             CCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
T ss_conf             99719998997799999155999999999987830499999999999997069718998046656789995556999999


Q ss_pred             --------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC---CCC
Q ss_conf             --------433430532167775124000113789999999999999869831021247418999999999982---998
Q gi|254780290|r  256 --------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK---SEH  324 (332)
Q Consensus       256 --------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~---g~~  324 (332)
                              ..++-.+++++....-+...-......    ..+..+.+.+.  .| ..+.-..+|+.++...+.+   +-.
T Consensus       162 l~~lt~~lA~e~~~~gIrvN~V~PG~i~T~~~~~~----~~~~~~~~~~~--~p-l~R~~~p~dva~~v~fL~S~~s~~i  234 (248)
T PRK05557        162 VIGFTKSLARELASRGITVNAVAPGFIETDMTDAL----PEDVKEAILAQ--IP-LGRLGQPEEIASAVAFLASDEAAYI  234 (248)
T ss_pred             HHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCC----CHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             99999999998533194999997488877542117----99999999857--99-9998099999999999968722283


Q ss_pred             CCEEEE
Q ss_conf             132898
Q gi|254780290|r  325 IGKIIL  330 (332)
Q Consensus       325 ~GKvVi  330 (332)
                      +|-.+.
T Consensus       235 TG~~i~  240 (248)
T PRK05557        235 TGQTLH  240 (248)
T ss_pred             CCCEEE
T ss_conf             587288


No 146
>PRK07677 short chain dehydrogenase; Provisional
Probab=95.64  E-value=0.00071  Score=44.74  Aligned_cols=78  Identities=23%  Similarity=0.364  Sum_probs=51.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111----2233222---2222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL----KLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~----~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++++|.+..+-+...|++|+.+.+++++.+.+.    +.|....   .|-++++    +.+++.+..+  
T Consensus         2 ~gK~alVTGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~g--   79 (254)
T PRK07677          2 KEKVVIITGGSSGMGKAMAKRFAEEGANVVITGRTKEKLEEAKLEIEQFPGQVLTVQMDVRNPDDVQKMIEQIDEKFG--   79 (254)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC--
T ss_conf             529899958767899999999998799999996999999999999985699099998038999999999999999839--


Q ss_pred             CCCCCCCCCCC
Q ss_conf             11122221111
Q gi|254780290|r  214 GIDIILDMVGA  224 (332)
Q Consensus       214 g~Divid~~G~  224 (332)
                      ++|+.+++.|.
T Consensus        80 ~iDiLVnNAg~   90 (254)
T PRK07677         80 RIDALINNAAG   90 (254)
T ss_pred             CCCEEEECCCC
T ss_conf             98889975755


No 147
>PRK06227 consensus
Probab=95.63  E-value=0.00091  Score=44.03  Aligned_cols=180  Identities=18%  Similarity=0.158  Sum_probs=89.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211----11112233222---2222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC----LACLKLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~----~~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++|+|.+.++.+...|++|+...++++..    +.+++.|.+..   .|-++++    +.+++.+.. | 
T Consensus         4 ~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~-G-   81 (256)
T PRK06227          4 SGKVAIVTGGGQGIGAAIAQTFAENGAKVVIADIDEEAGLEREEMLRSNGLDALFVKTDVSDEEDVKNMVRKTVERY-G-   81 (256)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC-C-
T ss_conf             99889995866889999999999879999999698889999999999559918999816899999999999999982-9-


Q ss_pred             CCCCCCCCCCCC----C-------CC---------------CCCCCCC--CCCCCEEEEECCCCCCCCCC----------
Q ss_conf             111222211111----1-------22---------------2221122--34530479833787543222----------
Q gi|254780290|r  214 GIDIILDMVGAE----Y-------LN---------------QHLTLLS--KEGKLIIISFLGGNIATEIN----------  255 (332)
Q Consensus       214 g~Divid~~G~~----~-------~~---------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~----------  255 (332)
                      ++|+.+++.|..    .       |+               .+++.|+  .+|+++.++...+....+-.          
T Consensus        82 ~iDiLVNNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaav  161 (256)
T PRK06227         82 GIDILINNAGIFSGKSIFERTLEEWERVIRVNLTGPYLCSKYAAEEMIKNGGGVIINIASTRAFQSEPNTEPYSASKGGI  161 (256)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
T ss_conf             99799989989999890349899999999998299999999999999984997799962255456899868899999999


Q ss_pred             -------CCHHHCCCCEEEEEEECCCHHCCH-HHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CC
Q ss_conf             -------433430532167775124000113-7899999999999998698310212474189999999999829---98
Q gi|254780290|r  256 -------LNPIISKRITITGSTLRRRTDIAK-QSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EH  324 (332)
Q Consensus       256 -------~~~~~~~~~~i~g~~~~~~~~~~~-~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~  324 (332)
                             ..++-..++++....-+.. +... ..........+.+.....  .| ..+.=..+|+..+.-.|.+-   -.
T Consensus       162 ~~lTr~lA~ela~~gIrVNaVaPG~i-~T~~~~~~~~~~~~~~~~~~~~~--~P-~gR~g~peeiA~~v~FL~Sd~as~i  237 (256)
T PRK06227        162 IALTHSLAVSLSKYKIRVVSISPGWI-ETSEWKKPPLRKKPQLTPLDHLQ--HP-AGRVGKPEDVANLCLFLASDEASFI  237 (256)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEECCCC-CCCCCCCCCCCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             99999999996202949999961869-66500057510257778878626--88-7798599999999999967632492


Q ss_pred             CCEEEE
Q ss_conf             132898
Q gi|254780290|r  325 IGKIIL  330 (332)
Q Consensus       325 ~GKvVi  330 (332)
                      +|-++.
T Consensus       238 TG~~i~  243 (256)
T PRK06227        238 TGVNFI  243 (256)
T ss_pred             CCCEEE
T ss_conf             586389


No 148
>PRK07063 short chain dehydrogenase; Provisional
Probab=95.63  E-value=0.001  Score=43.65  Aligned_cols=78  Identities=18%  Similarity=0.279  Sum_probs=51.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCC---CCCCCCCC----CCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-----12233222---22222211----1122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-----LKLGAKHA---INYLKEDF----LEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-----~~lGa~~v---i~~~~~~~----~~~i~~~t~g  212 (332)
                      .|+++||+||++|+|.+.++.....|++|+.+.+++++.+.+     ++.|.+..   .|-++++-    .+++.+.. |
T Consensus         6 ~gKvalVTGa~~GIG~aiA~~~a~~Ga~V~i~~~~~~~~~~~~~~l~~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~-G   84 (259)
T PRK07063          6 AGKVALVTGAAQGIGAAIARAFVREGAAVALADLDAALAERAAAAIARQTGARVLALPADVTRAASVRAAVARAEAAF-G   84 (259)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH-C
T ss_conf             998899958787899999999998799899997987899999999988509918999836899999999999999981-9


Q ss_pred             CCCCCCCCCCCC
Q ss_conf             211122221111
Q gi|254780290|r  213 RGIDIILDMVGA  224 (332)
Q Consensus       213 ~g~Divid~~G~  224 (332)
                       ++|+.+++.|.
T Consensus        85 -~iDiLVNNAG~   95 (259)
T PRK07063         85 -PLDVLVNNAGI   95 (259)
T ss_pred             -CCCEEEECCCC
T ss_conf             -98899989977


No 149
>PRK07577 short chain dehydrogenase; Provisional
Probab=95.63  E-value=0.0013  Score=43.07  Aligned_cols=176  Identities=18%  Similarity=0.164  Sum_probs=86.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111122332222222221-1112222222221112222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKED-FLEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~-~~~~i~~~t~g~g~Divid~~G  223 (332)
                      .|+++||+||++|+|.+..+.+...|++|+.+.++..+. +..++   ...|-++.+ ..+.+.+.....++|+.+++.|
T Consensus         2 ~~K~alITGas~GIG~aia~~la~~G~~Vv~~~r~~~~~-~~~~~---~~~D~~d~~~~~~~~~~~~~~~~id~LVnnAG   77 (234)
T PRK07577          2 SSRTVLVTGATKGIGLALSLRLANLGHQVIGIARSAIDD-FPGEL---FACDLADIEQTAATLAQINEIHPVDAIVNNVG   77 (234)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCC-CCCEE---EEEECCCHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             419899937788899999999998799999963475447-89769---99957999999999999997699989998998


Q ss_pred             CCC-----------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC-----------------CCH
Q ss_conf             111-----------22---------------222112--234530479833787543222-----------------433
Q gi|254780290|r  224 AEY-----------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN-----------------LNP  258 (332)
Q Consensus       224 ~~~-----------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~-----------------~~~  258 (332)
                      ...           |+               ..++.|  +..|+++.++..+. ...+-.                 ..+
T Consensus        78 ~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IInisS~~~-~~~~~~~~Y~asKaal~~ltkslA~e  156 (234)
T PRK07577         78 IALPQPLGKIDLAALQDVYDLNVRAAVQVTQAFLEGMKLREQGRIVNICSRAI-FGALDRTSYSAAKSALVGCTRTWALE  156 (234)
T ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECHHC-CCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             89998805599999999999997999999999999988748986799960110-27887477899999999999999999


Q ss_pred             HHCCCCEEEEEEECCCHHCCHHHHHHHH-HHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---CCCEEEE
Q ss_conf             4305321677751240001137899999-9999999986983102124741899999999998299---8132898
Q gi|254780290|r  259 IISKRITITGSTLRRRTDIAKQSIRDSL-QLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---HIGKIIL  330 (332)
Q Consensus       259 ~~~~~~~i~g~~~~~~~~~~~~~~~~~~-~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~~GKvVi  330 (332)
                      +-..++++....-+... ..-....... .....+.++.   .| ..+.-..+|+.++...|.+..   .+|.++.
T Consensus       157 la~~gIrVNaV~PG~i~-T~~~~~~~~~~~~~~~~~~~~---~P-~~R~g~p~eia~~v~fL~s~~s~~itGq~i~  227 (234)
T PRK07577        157 LAEYGITVNAVAPGPIE-TELFRQTRPVGSEEEKRVLAS---IP-MRRLGTPEEVAAAIAFLLSDDAGFITGQVLG  227 (234)
T ss_pred             HHHHCEEEEEEEECCCC-CHHHHHCCCCCHHHHHHHHHC---CC-CCCCCCHHHHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             86559699999548897-735542275888999999857---99-9998889999999999958521581282478


No 150
>PRK09242 tropinone reductase; Provisional
Probab=95.62  E-value=0.00061  Score=45.20  Aligned_cols=181  Identities=18%  Similarity=0.194  Sum_probs=90.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC-----CCC-C--CCCCCCCCCCCCCCCCCCC--C
Q ss_conf             2222221134444432222212222222211122322111111-22-----332-2--2222222111122222222--2
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-KL-----GAK-H--AINYLKEDFLEILQKETQG--R  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~l-----Ga~-~--vi~~~~~~~~~~i~~~t~g--~  213 (332)
                      .|+++||+||++|+|...++-+...|++|+.+.++.++.+.+. ++     |.. +  ..|-++++-.+.+.+....  .
T Consensus         9 ~gK~alITGgs~GIG~a~a~~la~~Ga~V~~~~r~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g   88 (258)
T PRK09242          9 DGQTALITGASKGIGLAIARELLGLGADVLIVARDADALAQARDELAEEFPERELHGLAADVSDDEDRRAILDWVEDHWD   88 (258)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEEECCCHHHHHHHHHHHHHHCC
T ss_conf             99999994848689999999999879989999698899999999998644797299999307999999999999999749


Q ss_pred             CCCCCCCCCCCCC-----------CC---------------CCCCCCC--CCCCCEEEEECCCCCCCCCC----------
Q ss_conf             1112222111111-----------22---------------2221122--34530479833787543222----------
Q gi|254780290|r  214 GIDIILDMVGAEY-----------LN---------------QHLTLLS--KEGKLIIISFLGGNIATEIN----------  255 (332)
Q Consensus       214 g~Divid~~G~~~-----------~~---------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~----------  255 (332)
                      ++|+.+++.|...           |+               ...+.++  .+|+++.++...+.....-.          
T Consensus        89 ~iDiLVnnAG~~~~~~~~~~s~~~w~~~~~vNl~~~~~l~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y~asKaal  168 (258)
T PRK09242         89 GLHILVNNAGGNITKAAIDYTEDEWRGIFETNLFSAFELSRYAYPLLKRHAASSIVNIGSVSGLTHVRSGAPYGMTKAAL  168 (258)
T ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCHHHHHHHHHH
T ss_conf             99799989988999980019999999999998199999999999999975992799993042116898755679999999


Q ss_pred             -------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC---CCCC
Q ss_conf             -------433430532167775124000113789999999999999869831021247418999999999982---9981
Q gi|254780290|r  256 -------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK---SEHI  325 (332)
Q Consensus       256 -------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~---g~~~  325 (332)
                             ..++-.+++++....-+............  ..+..+.+.+.  .|+ .+.=..+|+.++...|.+   .-.+
T Consensus       169 ~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~--~~~~~~~~~~~--~Pl-~R~g~pediA~~v~fLaSd~s~~iT  243 (258)
T PRK09242        169 QQMTRNLAVEWAEDGIRVNAVAPWYIRTRRTSGPLS--DPDYYEQVIER--TPM-RRIGEPEEVAAAVAFLCLPAASYIT  243 (258)
T ss_pred             HHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHCCCC--CHHHHHHHHHC--CCC-CCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             999999999980279899998358898721202237--99999999857--998-9987999999999999585324754


Q ss_pred             CEEEE
Q ss_conf             32898
Q gi|254780290|r  326 GKIIL  330 (332)
Q Consensus       326 GKvVi  330 (332)
                      |-++.
T Consensus       244 Gq~i~  248 (258)
T PRK09242        244 GECIA  248 (258)
T ss_pred             CCEEE
T ss_conf             85389


No 151
>PRK08085 gluconate 5-dehydrogenase; Provisional
Probab=95.61  E-value=0.00086  Score=44.18  Aligned_cols=179  Identities=17%  Similarity=0.251  Sum_probs=92.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCCCCC----CCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----1223322---22222221111----222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKEDFLE----ILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~~~~----~i~~~t~g~  213 (332)
                      .|+++||+||++|+|...++-....|++|+.+.+++++.+.+    ++.|.+.   ..|-++.+-.+    ++.+..  .
T Consensus         8 ~gK~alVTG~~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~--G   85 (254)
T PRK08085          8 AGKNILITGSAQGIGFLLATGLAEYGAEIIINDITAERAEKAVAKLRQEGIKAHAAAFNVTHKQEIEAAIEHIEKDI--G   85 (254)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH--C
T ss_conf             99989996856789999999999869999999698899999999998449818999826899999999999999983--9


Q ss_pred             CCCCCCCCCCCC----C-------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC----------
Q ss_conf             111222211111----1-------22---------------222112--234530479833787543222----------
Q gi|254780290|r  214 GIDIILDMVGAE----Y-------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN----------  255 (332)
Q Consensus       214 g~Divid~~G~~----~-------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~----------  255 (332)
                      ++|+.+++.|..    .       |+               ..++.+  +..|+++.++...+....+..          
T Consensus        86 ~iDilVnNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~q~~~~~m~~~~~G~IInisS~~~~~~~~~~~~Y~asKaai  165 (254)
T PRK08085         86 PIDVLINNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVARYMVKRQAGKIINICSMQSELGRDTITPYAASKGAV  165 (254)
T ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCHHHHHHHHHH
T ss_conf             98699989867888770109899999999998499999999985998873997299997730144789856789999999


Q ss_pred             -------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CCC
Q ss_conf             -------4334305321677751240001137899999999999998698310212474189999999999829---981
Q gi|254780290|r  256 -------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EHI  325 (332)
Q Consensus       256 -------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~~  325 (332)
                             ..++-.+++++....-+...........+  .....+.+.+.  .| ..+.=.-+|+..+.-.|.+.   -.+
T Consensus       166 ~~ltr~lA~e~a~~~IrvN~IaPG~i~T~~~~~~~~--~~~~~~~~~~~--~P-l~R~g~pedia~~~~fLaS~~ss~iT  240 (254)
T PRK08085        166 KMLTRGMCVELARHNIQVNGIAPGYFKTEMTKALVE--DEAFTAWLCKR--TP-AARWGDPQELIGAAVFLSSKASDFVN  240 (254)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHCC--CHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             999999999967279699999768898710210037--99999999857--99-88988999999999999575224865


Q ss_pred             CEEEE
Q ss_conf             32898
Q gi|254780290|r  326 GKIIL  330 (332)
Q Consensus       326 GKvVi  330 (332)
                      |-++.
T Consensus       241 G~~i~  245 (254)
T PRK08085        241 GHLLF  245 (254)
T ss_pred             CCEEE
T ss_conf             87499


No 152
>PRK08226 short chain dehydrogenase; Provisional
Probab=95.61  E-value=0.00065  Score=45.01  Aligned_cols=78  Identities=23%  Similarity=0.319  Sum_probs=50.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCC---CCCCCCCC----CCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112---23322---22222221----1112222222221
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK---LGAKH---AINYLKED----FLEILQKETQGRG  214 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~---lGa~~---vi~~~~~~----~~~~i~~~t~g~g  214 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.+.++++..+.+++   .|.+.   ..|-++++    +.+++.+.. | +
T Consensus         5 ~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~d~~~~~~~~~~~~~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~-G-~   82 (263)
T PRK08226          5 TGKTALITGALQGIGEGIARVFARHGANLILLDISPEIEKLADELCGRGHRCTAVVADVRDPASVAAAIKRAKEKE-G-R   82 (263)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHH-C-C
T ss_conf             9988999473779999999999987998999969879999999998369917999941799999999999999983-9-9


Q ss_pred             CCCCCCCCCC
Q ss_conf             1122221111
Q gi|254780290|r  215 IDIILDMVGA  224 (332)
Q Consensus       215 ~Divid~~G~  224 (332)
                      +|+.+++.|.
T Consensus        83 iDiLVNNAGi   92 (263)
T PRK08226         83 IDILVNNAGV   92 (263)
T ss_pred             CCEEEECCCC
T ss_conf             8699989977


No 153
>PRK12937 short chain dehydrogenase; Provisional
Probab=95.61  E-value=0.0011  Score=43.45  Aligned_cols=177  Identities=16%  Similarity=0.152  Sum_probs=90.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC----CCCCCCCC---CCCCCCCCC----CCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322-111----11122332---222222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE-KCL----ACLKLGAK---HAINYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~-~~~----~~~~lGa~---~vi~~~~~~----~~~~i~~~t~g  212 (332)
                      .|+++||+||++|+|.+.++-+...|++|+.+.++.+ ..+    .+++.|..   ...|-++++    +.+.+.+..+ 
T Consensus         4 sgK~alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~v~~~~~~~g-   82 (245)
T PRK12937          4 SNKVAIVTGASRGIGAAIARRLAADGFAVAVNYAGSAAMADELVEEIEAAGGRAIAVQADVADAAAVDRLFEAAETAFG-   82 (245)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC-
T ss_conf             9988999485778999999999987999999769986899999999996599589998378999999999999999819-


Q ss_pred             CCCCCCCCCCCCCC--------------------------CCCCCCCCCCCCCCEEEEECCCCCCCCCC-----------
Q ss_conf             21112222111111--------------------------22222112234530479833787543222-----------
Q gi|254780290|r  213 RGIDIILDMVGAEY--------------------------LNQHLTLLSKEGKLIIISFLGGNIATEIN-----------  255 (332)
Q Consensus       213 ~g~Divid~~G~~~--------------------------~~~~~~~l~~~G~iv~~G~~~~~~~~~~~-----------  255 (332)
                       +.|+.+++.|...                          ++.+.+.|+.+|+++.++...+..+.+-.           
T Consensus        83 -~iDilVnNAg~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~~G~IInisS~~~~~~~~~~~~Y~asKaav~  161 (245)
T PRK12937         83 -RIDVLVNSAGIMPLAPIADGDLEGFDRTIAVNLRGAFNVLGEAARHLRRGGRIINLSTSVIARALPGYGPYAASKAAVE  161 (245)
T ss_pred             -CCCEEEEECCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHCCCCCCCHHHHHHHHHHH
T ss_conf             -9889998054899988134999999999999859999999999999972882999973000578999488999999999


Q ss_pred             ------CCHHHCCCCEEEEEEECCCH-HCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CCC
Q ss_conf             ------43343053216777512400-01137899999999999998698310212474189999999999829---981
Q gi|254780290|r  256 ------LNPIISKRITITGSTLRRRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EHI  325 (332)
Q Consensus       256 ------~~~~~~~~~~i~g~~~~~~~-~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~~  325 (332)
                            ..++-.+++++....-+... +....    ....+..+.+.+.  .|. .+.-..+|+..+...|.+.   -.+
T Consensus       162 ~ltk~lA~el~~~gIrVN~I~PG~i~T~~~~~----~~~~e~~~~~~~~--~Pl-~R~g~pedia~~v~fL~S~~a~~iT  234 (245)
T PRK12937        162 GLVHVLANELRGRGITVNAVAPGPTATELFFN----GKSPEQIDQLARL--APL-ERLGEPDEIAAAVAFLAGPDGAWVN  234 (245)
T ss_pred             HHHHHHHHHHHHHCEEEEEEEECCCCCCCCCC----CCCHHHHHHHHHC--CCC-CCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999960519299999764588755436----7999999999856--999-9983999999999999687024913


Q ss_pred             CEEEE
Q ss_conf             32898
Q gi|254780290|r  326 GKIIL  330 (332)
Q Consensus       326 GKvVi  330 (332)
                      |-++.
T Consensus       235 G~~i~  239 (245)
T PRK12937        235 GQVLR  239 (245)
T ss_pred             CCEEE
T ss_conf             87368


No 154
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional
Probab=95.59  E-value=0.00069  Score=44.82  Aligned_cols=78  Identities=21%  Similarity=0.278  Sum_probs=49.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCC---CCCCCCC----CCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111---2233222---2222221----1112222222221
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL---KLGAKHA---INYLKED----FLEILQKETQGRG  214 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~---~lGa~~v---i~~~~~~----~~~~i~~~t~g~g  214 (332)
                      .|+++||+||++++|.+.++.+...|++|+.+.+++...+.+.   ..|.+..   .|-++.+    +.+.+.+..  .+
T Consensus         7 ~gKvalITGas~GIG~aiA~~la~~Ga~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~--G~   84 (260)
T PRK12823          7 AGKVAVVTGAAQGIGRGVALRAAAEGARVVLVDRSELVHEVAAELVAAGGEALALTADLETYAGAQAVMAAAVEAF--GR   84 (260)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH--CC
T ss_conf             9998999488678999999999987999999969468999999998549948999812688589999999999983--99


Q ss_pred             CCCCCCCCCC
Q ss_conf             1122221111
Q gi|254780290|r  215 IDIILDMVGA  224 (332)
Q Consensus       215 ~Divid~~G~  224 (332)
                      +|+++++.|+
T Consensus        85 iDiLVnnag~   94 (260)
T PRK12823         85 IDVLINNVGG   94 (260)
T ss_pred             CCEEEECCCC
T ss_conf             8799977522


No 155
>PRK08213 gluconate 5-dehydrogenase; Provisional
Probab=95.59  E-value=0.00072  Score=44.70  Aligned_cols=83  Identities=29%  Similarity=0.383  Sum_probs=53.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCCC----CCCCC
Q ss_conf             222222222222113444443222221222222221112232211111----12233222---22222211----11222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKEDF----LEILQ  207 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~~----~~~i~  207 (332)
                      +..++ .|+++||+||++|+|...++.+...|++|+.+.+++++.+.+    ++.|.+..   .|-++++-    .+++.
T Consensus         6 ~lf~L-~gKvalVTG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~v~~~~   84 (259)
T PRK08213          6 ELFDL-TGKTALVTGGSRGLGLQIAEALGEAGARVVLSARKAEELEEAAAHLEALGIDALWLAADVADEADIERLAEETL   84 (259)
T ss_pred             HHHCC-CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             87399-99989994877689999999999869999999798899999999999549958999826899999999999999


Q ss_pred             CCCCCCCCCCCCCCCCC
Q ss_conf             22222211122221111
Q gi|254780290|r  208 KETQGRGIDIILDMVGA  224 (332)
Q Consensus       208 ~~t~g~g~Divid~~G~  224 (332)
                      +.. | ++|+.+++.|.
T Consensus        85 ~~~-G-~iDiLVNNAG~   99 (259)
T PRK08213         85 ERF-G-HIDILVNNAGA   99 (259)
T ss_pred             HHH-C-CCCEEEECCCC
T ss_conf             983-9-99899989977


No 156
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional
Probab=95.55  E-value=0.00094  Score=43.95  Aligned_cols=103  Identities=25%  Similarity=0.375  Sum_probs=63.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----1223322---22222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|++++|+||++++|.+.++.+...|++|+.+.+++++.+.+    ++.|.+.   ..|-++++    +.+++.+..+  
T Consensus         3 ~gK~alITGas~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g~~~~~~~~D~~~~~~v~~~~~~~~~~~g--   80 (258)
T PRK12429          3 KGKTALVTGAASGIGLEIALALAKEGAKVVIADLNDEAAAKAAEAIKKAGGKAIGVAMDVTDEEAINAGIDKVVETFG--   80 (258)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC--
T ss_conf             959899948875899999999998799999997988999999999984499189998358999999999999999829--


Q ss_pred             CCCCCCCCCCCCC-----------C---------------CCCCCCC--CCCCCCEEEEECCCC
Q ss_conf             1112222111111-----------2---------------2222112--234530479833787
Q gi|254780290|r  214 GIDIILDMVGAEY-----------L---------------NQHLTLL--SKEGKLIIISFLGGN  249 (332)
Q Consensus       214 g~Divid~~G~~~-----------~---------------~~~~~~l--~~~G~iv~~G~~~~~  249 (332)
                      ++|+.+++.|...           |               +.+++.|  +.+|+++.++...+.
T Consensus        81 ~iDiLVnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~Iv~isS~~~~  144 (258)
T PRK12429         81 GVDILVNNAGIQHVAPIEDFPTEKWKKMIAIMLDGAFLTTKAALPHMKAQKWGRIINMASVHGL  144 (258)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHEEEHHHHHHHHHHCCCCEEEEECCHHHC
T ss_conf             9709998998889988155999999999997623212200677776643599289998775546


No 157
>PRK07776 consensus
Probab=95.54  E-value=0.00075  Score=44.59  Aligned_cols=177  Identities=19%  Similarity=0.279  Sum_probs=91.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC----CCCCCC----CCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111-11122332222----222221----11122222222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL-ACLKLGAKHAI----NYLKED----FLEILQKETQGRGI  215 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~-~~~~lGa~~vi----~~~~~~----~~~~i~~~t~g~g~  215 (332)
                      .|+++||+||++|+|...++-....||+|+.+.+++++.+ .+++++.+..+    |-++++    +.+++.+..  .+.
T Consensus         7 ~gKv~lITG~~~GIG~aiA~~la~~Ga~V~i~~~~~~~l~~~~~~l~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~--g~i   84 (252)
T PRK07776          7 TGRTAIVTGASRGIGLAIAQALAAAGANVVITARKQEALDEAAAQLGAERALGVAGHAVDEEHAREAVDLTLERF--GSV   84 (252)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHH--CCC
T ss_conf             999899947787999999999998799899997988999999998479957999974289999999999999984--998


Q ss_pred             CCCCCCCCCC-C---C-C----------------------CCCCCC--CCCCCCEEEEECCCCCCCCC------------
Q ss_conf             1222211111-1---2-2----------------------222112--23453047983378754322------------
Q gi|254780290|r  216 DIILDMVGAE-Y---L-N----------------------QHLTLL--SKEGKLIIISFLGGNIATEI------------  254 (332)
Q Consensus       216 Divid~~G~~-~---~-~----------------------~~~~~l--~~~G~iv~~G~~~~~~~~~~------------  254 (332)
                      |+.++..|.. .   + +                      ..++.+  ..+|+++.++...+....+-            
T Consensus        85 DilVnNAg~~~~~~~~~e~~~e~w~~~~~~Nl~~~~~~~~~~~~~m~~~~~G~IInisS~~~~~~~~~~~~Y~asKaav~  164 (252)
T PRK07776         85 DILVNNAGTNPAYGPLIDQDLARFRKIFEVNVWAALGWTQLAWKAWMGEHGGAVVNVASIGGLHPSPGIGAYGASKAALI  164 (252)
T ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             69998786688899813499999999999980789999999999986627964998077441157998479999999999


Q ss_pred             ----CCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---CCCE
Q ss_conf             ----243343053216777512400011378999999999999986983102124741899999999998299---8132
Q gi|254780290|r  255 ----NLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---HIGK  327 (332)
Q Consensus       255 ----~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~~GK  327 (332)
                          .+..-+.+++++....-+.............    -.+.+.+.  .| ..+.-..+|+.++...+.+.+   .+|-
T Consensus       165 ~ltk~lA~e~a~~IrVN~V~PG~i~T~~~~~~~~~----~~~~~~~~--iP-l~R~g~p~dia~~v~fL~S~~ss~iTGq  237 (252)
T PRK07776        165 HLTKQLALELAPRVRVNAVAPGVVRTKFAEALWEG----REDEVAAS--YP-LGRLGEPEDIASAVAFLVSDAASWITGE  237 (252)
T ss_pred             HHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHH----HHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999986998899996457988541122055----89999857--99-9998099999999999958742480587


Q ss_pred             EEE
Q ss_conf             898
Q gi|254780290|r  328 IIL  330 (332)
Q Consensus       328 vVi  330 (332)
                      ++.
T Consensus       238 ~i~  240 (252)
T PRK07776        238 TLV  240 (252)
T ss_pred             EEE
T ss_conf             299


No 158
>PRK07856 short chain dehydrogenase; Provisional
Probab=95.53  E-value=0.0013  Score=42.91  Aligned_cols=177  Identities=13%  Similarity=0.194  Sum_probs=88.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111122332222222221----1112222222221112222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKED----FLEILQKETQGRGIDIILD  220 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~----~~~~i~~~t~g~g~Divid  220 (332)
                      .|+++||+||++++|...++-+...|++|+.+.+++.+..-.+..-  ...|-++++    +.+++.+..+  ++|++++
T Consensus         7 ~~K~alITGgs~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~~--~~~Dv~~~~~v~~~~~~~~~~~g--~iDilVn   82 (254)
T PRK07856          7 TGRVVLVTGGTRGVGAGISEAFLAAGATVVVCGRRAPEVDGRPAEF--HACDIRDPDQVAALVDAIAERHG--RLDVLVN   82 (254)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCEEE--EECCCCCHHHHHHHHHHHHHHHC--CCCEEEE
T ss_conf             9998999476768999999999987999999979855748984399--98469999999999999999809--9888998


Q ss_pred             CCCCC-----------CCC---------------CCCCCCC---CCCCCEEEEECCCCCCCCC----------------C
Q ss_conf             11111-----------122---------------2221122---3453047983378754322----------------2
Q gi|254780290|r  221 MVGAE-----------YLN---------------QHLTLLS---KEGKLIIISFLGGNIATEI----------------N  255 (332)
Q Consensus       221 ~~G~~-----------~~~---------------~~~~~l~---~~G~iv~~G~~~~~~~~~~----------------~  255 (332)
                      +.|..           .|+               .+++.+.   .+|+++.++...+....+-                .
T Consensus        83 NAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~l~q~~~~~m~~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaal~~ltk~  162 (254)
T PRK07856         83 NAGGSPYALAAEASPRFHEKIVELNLLAPLLVAQAANAVMQQQPGGGSIVNIGSVSGRRPSPGTAAYGAAKAGLLNLTTS  162 (254)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             89889998813499999999999982899999999999999727997899945424327889728799999999999999


Q ss_pred             CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CCCCEEEE
Q ss_conf             4334305321677751240001137899999999999998698310212474189999999999829---98132898
Q gi|254780290|r  256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EHIGKIIL  330 (332)
Q Consensus       256 ~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~~GKvVi  330 (332)
                      +..-+.+++++....-+...-....... . ..+..+.+.+.  .| ..+.-..+|+.++...|.+.   -.+|-++.
T Consensus       163 lA~e~a~~IrVN~VaPG~i~T~~~~~~~-~-~~e~~~~~~~~--iP-lgR~g~pedvA~~v~fL~S~~s~~iTG~~i~  235 (254)
T PRK07856        163 LAVEWAPKVRVNAVVVGLVETEQSELHY-G-DAEGIAAVAAT--VP-LGRLATPADIGWACLFLASDAASYVSGANLE  235 (254)
T ss_pred             HHHHHCCCCEEEEEEECCCCCHHHHHHC-C-CHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCEECCEEE
T ss_conf             9999779988999975989771143315-9-99999999837--99-9997699999999999958721681085578


No 159
>PRK07478 short chain dehydrogenase; Provisional
Probab=95.52  E-value=0.00079  Score=44.44  Aligned_cols=77  Identities=27%  Similarity=0.390  Sum_probs=51.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCCCCCC----CCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----12233222---22222211112----22222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKEDFLEI----LQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~~~~~----i~~~t~g~  213 (332)
                      .|+.+||+||++|+|...++.+...|++|+.+.+++++.+.+    ++.|.+..   .|-++++-.+.    +.+.. | 
T Consensus         5 ~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~ei~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~-G-   82 (254)
T PRK07478          5 NGKVAIITGASSGIGRAAAKLFAREGAKVVVGARRQAELDQLVAEIRAEGGEAVALAGDVRDEAYAKALVALAVERF-G-   82 (254)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH-C-
T ss_conf             99879995887689999999999879999999798899999999999649908999768999999999999999984-9-


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      ++|+.+++.|
T Consensus        83 ~iDiLVNNAG   92 (254)
T PRK07478         83 GLDIAFNNAG   92 (254)
T ss_pred             CCCEEEECCC
T ss_conf             9989998874


No 160
>TIGR03466 HpnA hopanoid-associated sugar epimerase. The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene.
Probab=95.52  E-value=0.0017  Score=42.29  Aligned_cols=11  Identities=9%  Similarity=0.063  Sum_probs=4.7

Q ss_pred             HHHHHHHHHCC
Q ss_conf             99999999829
Q gi|254780290|r  312 VAMAHDIMEKS  322 (332)
Q Consensus       312 i~~A~~~l~~g  322 (332)
                      +.+..+.+++.
T Consensus       315 l~~tv~W~~~n  325 (328)
T TIGR03466       315 LRDAVEWFRAN  325 (328)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999999986


No 161
>PRK12939 short chain dehydrogenase; Provisional
Probab=95.51  E-value=0.00095  Score=43.93  Aligned_cols=178  Identities=14%  Similarity=0.142  Sum_probs=92.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----1223322---22222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|++++|+||++|+|...++-+...|++|+...+++++.+.+    ++.|.+.   ..|-++++    +.+.+.+.. | 
T Consensus         6 ~~KvalVTGgs~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~-g-   83 (250)
T PRK12939          6 AGKRALVTGAARGLGAAFAEALAEAGATVAFNDGLAAEARELAAALEAAGGRAHAIAADLADPASVQRFFDAAAAAL-G-   83 (250)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHC-C-
T ss_conf             99879995836689999999999879999999698899999999999559909999924899999999999999974-9-


Q ss_pred             CCCCCCCCCCCCC---C-C----------------------CCCCCCC--CCCCCEEEEECCCCCCCCCC----------
Q ss_conf             1112222111111---2-2----------------------2221122--34530479833787543222----------
Q gi|254780290|r  214 GIDIILDMVGAEY---L-N----------------------QHLTLLS--KEGKLIIISFLGGNIATEIN----------  255 (332)
Q Consensus       214 g~Divid~~G~~~---~-~----------------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~----------  255 (332)
                      +.|+++++.|...   + +                      .+++.|+  .+|+++.++...+..+.+-.          
T Consensus        84 ~iDiLVNNAG~~~~~~~~~~~~e~~~~~~~iNl~~~~~~~k~~~~~m~~~~~G~IInisS~~~~~~~~~~~~Y~asKaal  163 (250)
T PRK12939         84 GLDGLVNNAGITNSKSATELDIDTWDAVMNVNVRGTFLMSRAALPHLRDSGRGRIVNLASDTALWGAPKLLAYVASKGAV  163 (250)
T ss_pred             CCCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
T ss_conf             99799988778999990349999999999998299999999999999984993799980677676899858899999999


Q ss_pred             -------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC---CCCC
Q ss_conf             -------433430532167775124000113789999999999999869831021247418999999999982---9981
Q gi|254780290|r  256 -------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK---SEHI  325 (332)
Q Consensus       256 -------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~---g~~~  325 (332)
                             ..++-..++++....-+... .  .........+..+.+.+.  .|. .+.-.-+|+.++...|.+   +-.+
T Consensus       164 ~~ltk~lA~e~a~~~IrvN~V~PG~i~-T--~~~~~~~~~e~~~~~~~~--~Pl-~R~g~pedia~~v~fL~S~~s~~it  237 (250)
T PRK12939        164 IGMTRSLARELGGRGITVNAIAPGLTA-T--EATAYVPAEERHAYYLQG--RAL-ERLQVPDDVAGAVLFLLSDAARFVT  237 (250)
T ss_pred             HHHHHHHHHHHHHHCEEEEEEEECCCC-C--HHHHCCCCHHHHHHHHHC--CCC-CCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             999999999960329399988767798-7--032258988999999857--999-9980999999999999481646905


Q ss_pred             CEEEE
Q ss_conf             32898
Q gi|254780290|r  326 GKIIL  330 (332)
Q Consensus       326 GKvVi  330 (332)
                      |-++.
T Consensus       238 G~~i~  242 (250)
T PRK12939        238 GQLLP  242 (250)
T ss_pred             CCEEE
T ss_conf             88289


No 162
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed
Probab=95.50  E-value=0.0013  Score=42.95  Aligned_cols=110  Identities=20%  Similarity=0.227  Sum_probs=66.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             22222333222111222222222222113444443222221222222221112232211111----12233222222222
Q gi|254780290|r  125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHAINYLKE  200 (332)
Q Consensus       125 ~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~vi~~~~~  200 (332)
                      .+.-+.+.|.  +.+..+++++++||..|+  |.|..+.-+++..+ +|+++.+.++-.+.+    +++|.+++.- ...
T Consensus        60 ~is~P~~~A~--ml~~L~l~~~~~VLeIGt--GsGY~tAlLa~l~~-~V~siE~~~~l~~~a~~~l~~~~~~nv~~-~~g  133 (213)
T PRK00312         60 TISQPYMVAR--MTELLELKPGDRVLEIGT--GSGYQAAVLAHLVE-RVFSVERIKTLQWQAKRRLKQLGLHNVSV-RHG  133 (213)
T ss_pred             EECHHHHHHH--HHHHHCCCCCCEEEEECC--CCCHHHHHHHHHCC-CEEEEECCHHHHHHHHHHHHHCCCCCEEE-EEC
T ss_conf             9767999999--999843689975999659--86099999998629-28999428999999999999849987699-968


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCEEE
Q ss_conf             111122222222211122221111112-2222112234530479
Q gi|254780290|r  201 DFLEILQKETQGRGIDIILDMVGAEYL-NQHLTLLSKEGKLIII  243 (332)
Q Consensus       201 ~~~~~i~~~t~g~g~Divid~~G~~~~-~~~~~~l~~~G~iv~~  243 (332)
                      |..+-..   ...+||.|+=+.+.+.. ...++.|++||+++..
T Consensus       134 dg~~g~~---~~~pfD~Iii~~a~~~~P~~l~~qL~~gGrLV~P  174 (213)
T PRK00312        134 DGWKGWP---AYAPFDRILVTAAAPEIPRALLDQLAEGGILVAP  174 (213)
T ss_pred             CCCCCCC---CCCCCCEEEEEECCHHHHHHHHHHCCCCCEEEEE
T ss_conf             8766787---6697248999843412259999845329799999


No 163
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated
Probab=95.49  E-value=0.00083  Score=44.32  Aligned_cols=178  Identities=16%  Similarity=0.197  Sum_probs=93.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCCC----CCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----12233222---22222211----11222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKEDF----LEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~~----~~~i~~~t~g~  213 (332)
                      .|+++||+||++++|.+.++.+...|++|+.+.++.++.+.+    ++.|.+.+   .|-++.+-    .+.+.+..+  
T Consensus        10 ~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~G--   87 (255)
T PRK06113         10 DGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAVSKLG--   87 (255)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHC--
T ss_conf             999899958877899999999998799999996988999999999996599089998368999999999999999819--


Q ss_pred             CCCCCCCCCCCC---CCC----------------------CCCCCCC--CCCCCEEEEECCCCCCCCCC-----------
Q ss_conf             111222211111---122----------------------2221122--34530479833787543222-----------
Q gi|254780290|r  214 GIDIILDMVGAE---YLN----------------------QHLTLLS--KEGKLIIISFLGGNIATEIN-----------  255 (332)
Q Consensus       214 g~Divid~~G~~---~~~----------------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~-----------  255 (332)
                      ++|+++++.|..   .++                      .+++.++  .+|+++.++...+.....-.           
T Consensus        88 ~iDilVnNAG~~~~~~~d~~~~~~~~~~~~Nl~~~~~~~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y~asKaav~  167 (255)
T PRK06113         88 KVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAAS  167 (255)
T ss_pred             CCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCHHHHHHHHHHH
T ss_conf             98899987887899877599999999999964999999999999888718967999844654688998520899999999


Q ss_pred             ------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC---CCCCC
Q ss_conf             ------433430532167775124000113789999999999999869831021247418999999999982---99813
Q gi|254780290|r  256 ------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK---SEHIG  326 (332)
Q Consensus       256 ------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~---g~~~G  326 (332)
                            ..++-..++++....-+...-   .........+..+.+.+.  .| ..+.-.-+|+..+.-.|.+   +-.+|
T Consensus       168 ~ltk~lA~ela~~gIrVN~V~PG~i~T---~~~~~~~~~~~~~~~~~~--~P-l~R~g~pediA~~v~fL~S~~a~~itG  241 (255)
T PRK06113        168 HLVRNMAFDLGEKNIRVNGIAPGAILT---DALKSVITPEIEQKMLQH--TP-IRRLGQPQDIANAALFLCSPAASWVSG  241 (255)
T ss_pred             HHHHHHHHHHHHCCEEEEEEEECCCCC---CHHHHCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCCC
T ss_conf             999999999826494999986488987---022201799999999857--99-889829999999999994814279668


Q ss_pred             EEEE
Q ss_conf             2898
Q gi|254780290|r  327 KIIL  330 (332)
Q Consensus       327 KvVi  330 (332)
                      -++.
T Consensus       242 ~~i~  245 (255)
T PRK06113        242 QILT  245 (255)
T ss_pred             CEEE
T ss_conf             8699


No 164
>PRK05867 short chain dehydrogenase; Provisional
Probab=95.49  E-value=0.00092  Score=44.01  Aligned_cols=81  Identities=27%  Similarity=0.322  Sum_probs=52.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC---CCCCC---CCCCCCCC----CCCCCCC
Q ss_conf             22222222222113444443222221222222221112232211111-12---23322---22222221----1112222
Q gi|254780290|r  140 TANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LK---LGAKH---AINYLKED----FLEILQK  208 (332)
Q Consensus       140 ~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~---lGa~~---vi~~~~~~----~~~~i~~  208 (332)
                      ..++ .|+++||+||++|+|.+..+.+...|++|+.+.+++++.+.+ ++   .|...   ..|-++++    +.+++.+
T Consensus         4 ~f~L-~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~r~~~~~~~~~~ei~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~   82 (253)
T PRK05867          4 LFDL-HGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSGGKVVPVCCDVSQHQQVTSMLDQVTA   82 (253)
T ss_pred             CCCC-CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             6388-999899979565999999999998699999997988999999999984599199998369999999999999999


Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             222221112222111
Q gi|254780290|r  209 ETQGRGIDIILDMVG  223 (332)
Q Consensus       209 ~t~g~g~Divid~~G  223 (332)
                      ..+  ++|+.+++.|
T Consensus        83 ~~G--~iDiLVnNAG   95 (253)
T PRK05867         83 ELG--GIDIAVCNAG   95 (253)
T ss_pred             HHC--CCCEEEECCC
T ss_conf             959--9859998997


No 165
>PRK06057 short chain dehydrogenase; Provisional
Probab=95.47  E-value=0.00081  Score=44.36  Aligned_cols=77  Identities=29%  Similarity=0.417  Sum_probs=51.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC-CCCCCCCCC----CCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111-11223322-222222211----1122222222211122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA-CLKLGAKH-AINYLKEDF----LEILQKETQGRGIDII  218 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~-~~~lGa~~-vi~~~~~~~----~~~i~~~t~g~g~Div  218 (332)
                      .|++++|+||++|+|.+.++.....|++|+.+.+++++.+. +.++++.. ..|-++++-    .+++.+.. | ++|+.
T Consensus         6 ~gKvalVTGas~GIG~aia~~la~~Ga~Vvi~d~~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~v~~~~~~~-G-~iDiL   83 (255)
T PRK06057          6 AGRVAVITGGASGIGLATARRMRAEGATVVVGDIDPEAGKAAADELGGLFVQVDVTDEDAVNALFDTAAETY-G-SVDIA   83 (255)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHH-C-CCCEE
T ss_conf             999899968488899999999998699899996988999999986499799981699999999999999981-9-98789


Q ss_pred             CCCCC
Q ss_conf             22111
Q gi|254780290|r  219 LDMVG  223 (332)
Q Consensus       219 id~~G  223 (332)
                      +++.|
T Consensus        84 VNnAG   88 (255)
T PRK06057         84 FNNAG   88 (255)
T ss_pred             EECCC
T ss_conf             98885


No 166
>PRK07479 consensus
Probab=95.45  E-value=0.00086  Score=44.20  Aligned_cols=77  Identities=19%  Similarity=0.269  Sum_probs=50.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCCCC----CCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----1223322---2222222111----1222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKEDFL----EILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~~~----~~i~~~t~g~  213 (332)
                      .|+++||+||++++|.+.++-+...|++|+.+.+++++.+.+    ++.|...   ..|-++++-.    +.+.+..  .
T Consensus         4 ~gK~alITGgs~GIG~a~a~~la~~G~~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~--G   81 (252)
T PRK07479          4 SGKVAIVTGAGSGFGEGIAKRFAREGAKVVVADLNAAAAERVASEIADAGGNAIAVAADVSRGADVEALVEAALEAF--G   81 (252)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH--C
T ss_conf             99889993887689999999999879999999798999999999998539978999925899999999999999981--9


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      ++|+++++.|
T Consensus        82 ~iD~lVnnAG   91 (252)
T PRK07479         82 RVDIVVNNAG   91 (252)
T ss_pred             CCCEEEECCC
T ss_conf             9859998997


No 167
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family. This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.
Probab=95.44  E-value=0.0024  Score=41.26  Aligned_cols=96  Identities=15%  Similarity=0.262  Sum_probs=54.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCC-
Q ss_conf             22211344444322222122222222111223221111112233222222222111122222222--211122221111-
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQG--RGIDIILDMVGA-  224 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g--~g~Divid~~G~-  224 (332)
                      +|||+||+|.+|...+..++..|.+|.+.+|++++......-|+.  +|+.+.+-.+...+...+  +++|.+|-.... 
T Consensus         1 TIlVtGATG~iG~~v~~~L~~~g~~v~~~~R~~~~~~~~~~~~v~--~d~~d~~~~~~a~~~~d~~~~~v~~v~l~~p~~   78 (285)
T TIGR03649         1 TILLTGGTGKTASRIARLLQAASVPFLVASRSSSSSAGPNEKHVK--FDWLDEDTWDNPFSSDDGMEPEISAVYLVAPPI   78 (285)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCEEE--EECCCCCCHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             989998998189999999986899789995885664666675368--644481148889763532312741899838998


Q ss_pred             -C---CCCCCCCCCCCCC--CCEEEEE
Q ss_conf             -1---1222221122345--3047983
Q gi|254780290|r  225 -E---YLNQHLTLLSKEG--KLIIISF  245 (332)
Q Consensus       225 -~---~~~~~~~~l~~~G--~iv~~G~  245 (332)
                       +   .....+...+..|  +++.++.
T Consensus        79 ~~~~~~~~~~i~aA~~aGV~~iV~lS~  105 (285)
T TIGR03649        79 PDLAPPMIKFIDFARSKGVRRFVLLSA  105 (285)
T ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             776789999999999849988999830


No 168
>PRK07074 short chain dehydrogenase; Provisional
Probab=95.43  E-value=0.00098  Score=43.84  Aligned_cols=181  Identities=15%  Similarity=0.126  Sum_probs=89.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC----CCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             2222211344444322222122222222111223221111-1122332222----22222111122222-2222111222
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA-CLKLGAKHAI----NYLKEDFLEILQKE-TQGRGIDIIL  219 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~-~~~lGa~~vi----~~~~~~~~~~i~~~-t~g~g~Divi  219 (332)
                      ++++||+||++++|.+.++-....|++|+.+.+++++.+. +++++..++.    |-++++-.+.+.+. ..-.++|+.+
T Consensus         2 nKvalITGgs~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~l~~~~~~~~~~Dv~~~~~~~~~~~~i~~~g~iDiLV   81 (256)
T PRK07074          2 SRTALVTGAAGGIGQALARRFLAAGDRVLALDIDRAALAAFVDALGDAAVAPVICDLTDAASVERLAAALANEGPVDVLV   81 (256)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             98899988468999999999998699999997988999999998269977999972799999999999999859987999


Q ss_pred             CCCCCC-----------CCC---------------CCCCCCC--CCCCCEEEEECCCCCCCCCC----------------
Q ss_conf             211111-----------122---------------2221122--34530479833787543222----------------
Q gi|254780290|r  220 DMVGAE-----------YLN---------------QHLTLLS--KEGKLIIISFLGGNIATEIN----------------  255 (332)
Q Consensus       220 d~~G~~-----------~~~---------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~----------------  255 (332)
                      +..|..           .|+               ..++.|+  .+|+++.++...+......+                
T Consensus        82 NNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~Y~asKaal~~ltk~l  161 (256)
T PRK07074         82 ANAGAARAATLHDTTSASWRADNALNLEATYLCVEAVEAGMKARSRGAIVNIGSVNGMAALGHPAYSAAKAGLISYTKSL  161 (256)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             88877899891559999999999998599999999999999875997699996656567688578999999999999999


Q ss_pred             CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CCCCEEEE
Q ss_conf             4334305321677751240001137899999999999998698310212474189999999999829---98132898
Q gi|254780290|r  256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EHIGKIIL  330 (332)
Q Consensus       256 ~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~~GKvVi  330 (332)
                      ..++-..++++....-+.. +............+..+.+.+  ..| ..+.-..+|+.++.-.|.+-   -.+|-++.
T Consensus       162 A~e~~~~gIrVN~VaPG~i-~T~~~~~~~~~~~~~~~~~~~--~~P-l~R~g~pedIA~~v~FLaS~~as~iTG~~i~  235 (256)
T PRK07074        162 AIEYGRFGIRANAVCPGTV-KTQAWEARVAANPQVFEELKK--WYP-LQDFATPDDVANAVLFLASPAARAITGVCLP  235 (256)
T ss_pred             HHHHHHCCEEEEEEEECCC-CCHHHHHHHHCCHHHHHHHHH--CCC-CCCCCCHHHHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             9996424979999842779-873666432249999999984--799-8898699999999999958053593587388


No 169
>PRK07774 short chain dehydrogenase; Provisional
Probab=95.42  E-value=0.00089  Score=44.11  Aligned_cols=77  Identities=17%  Similarity=0.269  Sum_probs=50.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----12233222---2222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++++|...++.+...|++|+.+.+++++.+.+    ++.|.+..   .|-++++    +.+++.+..  .
T Consensus         5 ~gK~alVTGgs~GiG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~f--G   82 (250)
T PRK07774          5 DDKVAIVTGAAGGIGQAYAEALAREGASVVVADINAEGAERVAKQIVADGGTAIAVQVDVSDPDSAKAMADRTVSAF--G   82 (250)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH--C
T ss_conf             99889997976889999999999869999999798899999999998559849999825899999999999999983--9


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      ++|+++++.|
T Consensus        83 ~iDilVNnAg   92 (250)
T PRK07774         83 GIDYLVNNAA   92 (250)
T ss_pred             CCCEEEECCC
T ss_conf             9989998884


No 170
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional
Probab=95.42  E-value=0.0014  Score=42.87  Aligned_cols=75  Identities=19%  Similarity=0.171  Sum_probs=47.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111122332222222221----1112222222221112222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKED----FLEILQKETQGRGIDIILD  220 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~----~~~~i~~~t~g~g~Divid  220 (332)
                      .|+++||+||++|+|.+.++.+...|++|+..+.++++.+..+-..  ...|-++++    +.+++.+..+  ++|+.++
T Consensus         8 ~gKvalVTGgs~GIG~aia~~la~~Ga~V~~~d~~~~~~~~~~~~~--~~~Dvt~~~~v~~~v~~~~~~~G--~iDiLVN   83 (266)
T PRK06171          8 QGKIIIVTGGSSGIGLAIVEELLAQGANVQMVDIHGGDEKHKGYQF--WPTDISSAKEVNHTVAEIIERFG--RIDGLVN   83 (266)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCEEE--EECCCCCHHHHHHHHHHHHHHHC--CCCEEEE
T ss_conf             9997999477878999999999987999999978853505897699--98169999999999999999839--9889998


Q ss_pred             CCC
Q ss_conf             111
Q gi|254780290|r  221 MVG  223 (332)
Q Consensus       221 ~~G  223 (332)
                      +.|
T Consensus        84 NAG   86 (266)
T PRK06171         84 NAG   86 (266)
T ss_pred             CCC
T ss_conf             886


No 171
>PRK07454 short chain dehydrogenase; Provisional
Probab=95.41  E-value=0.0014  Score=42.88  Aligned_cols=104  Identities=23%  Similarity=0.241  Sum_probs=64.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCC---CCCCCCCC----CCCCCCCCCCC
Q ss_conf             22222221134444432222212222222211122322111111----223322---22222221----11122222222
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL----KLGAKH---AINYLKED----FLEILQKETQG  212 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~----~lGa~~---vi~~~~~~----~~~~i~~~t~g  212 (332)
                      ..-+++||+||++|+|.+..+.....|++|+.+.+++++.+.+.    +.|.+.   ..|-++++    +.+++.+..+ 
T Consensus         4 ~~mKvalITGas~GIG~a~A~~la~~G~~V~l~~R~~~~l~~~~~e~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~G-   82 (241)
T PRK07454          4 NSMPTALITGASRGIGKATALAFAKAGWDLALVARSQDALEALAEELRSTGVKVAAYSIDLSNPEAIAPGIAELLEQFG-   82 (241)
T ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCC-
T ss_conf             9998899917587899999999998799899998999999999999996599289999518999999999999999759-


Q ss_pred             CCCCCCCCCCCCC----CCC----------------------CCCCCC--CCCCCCEEEEECCCC
Q ss_conf             2111222211111----122----------------------222112--234530479833787
Q gi|254780290|r  213 RGIDIILDMVGAE----YLN----------------------QHLTLL--SKEGKLIIISFLGGN  249 (332)
Q Consensus       213 ~g~Divid~~G~~----~~~----------------------~~~~~l--~~~G~iv~~G~~~~~  249 (332)
                       .+|+.+++.|..    ..+                      ..++.+  +.+|+++.++...+.
T Consensus        83 -~iDiLVnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IinisS~ag~  146 (241)
T PRK07454         83 -CPSVLINNAGAAYTGPLLEMPLSDWQWVIQLNLTSVFQCCSAVLPGMRARGGGLIINVSSHAAR  146 (241)
T ss_pred             -CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC
T ss_conf             -9889998898899999266999999999999869999999999999997399899998356544


No 172
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed
Probab=95.37  E-value=0.0021  Score=41.60  Aligned_cols=105  Identities=24%  Similarity=0.302  Sum_probs=66.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1122222222222211344444322222122222--2221112232211111122----332222222221111222222
Q gi|254780290|r  137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG--ATVYTTAKSEEKCLACLKL----GAKHAINYLKEDFLEILQKET  210 (332)
Q Consensus       137 l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G--~~vi~~~~~~~~~~~~~~l----Ga~~vi~~~~~~~~~~i~~~t  210 (332)
                      +.+..++++|++||=.|  .|.|.++..+++..+  ++|++++-|++-++.+++.    +...-+.....|..+ + .. 
T Consensus        43 ~v~~l~~~~g~~vLDvg--cGTG~~~~~l~~~~~~~~~v~g~D~S~~ML~~A~~k~~~~~~~~~i~~~~~da~~-l-pf-  117 (239)
T PRK00216         43 TIKWLGVRPGDKVLDLA--CGTGDLAIALAKAVGETGEVVGLDFSEGMLAVGREKLLDKGLSGNVEFVQGDAEA-L-PF-  117 (239)
T ss_pred             HHHHCCCCCCCEEEEEC--CCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEECCCC-C-CC-
T ss_conf             99862789999898845--7763879999997299767999919889999999999973898885079823556-8-88-


Q ss_pred             CCCCCCCCCCCCC-------CCCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             2221112222111-------11122222112234530479833
Q gi|254780290|r  211 QGRGIDIILDMVG-------AEYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       211 ~g~g~Divid~~G-------~~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      ...-||+|.-+.|       ...+....+.|+|||+++++-..
T Consensus       118 ~d~sfD~v~~~f~l~~~~d~~~~l~E~~RVLkPGG~l~ilefs  160 (239)
T PRK00216        118 PDNSFDAVTIAFGLRNVPDIDKALREMYRVLKPGGRLVILEFS  160 (239)
T ss_pred             CCCCCCCCCCCCEEEECCCHHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             7666765002615671486799999999876648089999758


No 173
>PRK05876 short chain dehydrogenase; Provisional
Probab=95.35  E-value=0.0011  Score=43.37  Aligned_cols=77  Identities=18%  Similarity=0.188  Sum_probs=50.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCCC----CCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----1223322---222222211----11222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKEDF----LEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~~----~~~i~~~t~g~  213 (332)
                      .|++++|+||++|+|.+..+-+...|++|+.+++++++++.+    +..|.+.   ..|-++.+-    .++..+..  .
T Consensus         5 ~gKvavITGaasGIG~a~A~~la~~Ga~Vvi~d~~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~v~~l~~~~~~~~--G   82 (275)
T PRK05876          5 PGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRLL--G   82 (275)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH--C
T ss_conf             99879992826699999999999879989999798899999999998269847999788899999999999999984--8


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      ++|+++++.|
T Consensus        83 ~iDilvnNAG   92 (275)
T PRK05876         83 HVDVVFSNAG   92 (275)
T ss_pred             CCCEEECCCC
T ss_conf             9885121574


No 174
>PRK05717 oxidoreductase; Validated
Probab=95.33  E-value=0.00099  Score=43.78  Aligned_cols=178  Identities=15%  Similarity=0.151  Sum_probs=90.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC---CCCCCCC-C---CCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111-1112233222---2222221-1---11222222222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL-ACLKLGAKHA---INYLKED-F---LEILQKETQGRGID  216 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~-~~~~lGa~~v---i~~~~~~-~---~~~i~~~t~g~g~D  216 (332)
                      .|+.+||+||++++|...++-....|++|+.+.+++++.+ .++++|-...   .|-++++ .   .+++.+.. | .+|
T Consensus         9 ~GKvalITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~i~~~~~~~-G-~id   86 (255)
T PRK05717          9 NGRVALVTGAARGIGLGIAAWLIAEGWQVVLADLDRERGAKVAKALGENAWFIAMDVADEAQVAAGVAEVLGQF-G-RLD   86 (255)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHH-C-CCC
T ss_conf             99889995878889999999999879989999698899999999848975899930799999999999999982-9-998


Q ss_pred             CCCCCCCCC-----CCC-----------------------CCCCCC-CCCCCCEEEEECCCCCCCCCC------------
Q ss_conf             222211111-----122-----------------------222112-234530479833787543222------------
Q gi|254780290|r  217 IILDMVGAE-----YLN-----------------------QHLTLL-SKEGKLIIISFLGGNIATEIN------------  255 (332)
Q Consensus       217 ivid~~G~~-----~~~-----------------------~~~~~l-~~~G~iv~~G~~~~~~~~~~~------------  255 (332)
                      +++++.|..     .++                       .+.+.+ ..+|.++.++...+....+-.            
T Consensus        87 ~lvnNAg~~~~~~~~l~~~~~~~w~~~~~vNl~g~f~~~k~~~~~m~~~~G~IInisS~~~~~~~~~~~~Y~asKaal~~  166 (255)
T PRK05717         87 ALVCNAAIANPHNTTLESLSLAQWNRVLAVNLGGPMLLAKHCAPYLRAHNGAIVNLASTRARQSEPDTEAYAASKGGLLA  166 (255)
T ss_pred             EEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHCHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99987730578999835599999999999860426577664319887479986999760145478983767999999999


Q ss_pred             ----CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---CCCEE
Q ss_conf             ----43343053216777512400011378999999999999986983102124741899999999998299---81328
Q gi|254780290|r  256 ----LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---HIGKI  328 (332)
Q Consensus       256 ----~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~~GKv  328 (332)
                          +..-+..++++....-+.. +.....  ......+.+.....  .| ..+.-..+|+..+...|.+..   .+|-+
T Consensus       167 ltkslA~e~a~~IRvN~I~PG~i-~t~~~~--~~~~~~~~~~~~~~--~P-l~R~g~~edia~~v~fL~S~~ss~iTGq~  240 (255)
T PRK05717        167 LTHALAISLGPEIRVNAVSPGWI-DARDPS--QRRAEPLSEADHAQ--HP-AGRVGTVEDVAAMVAWLLSRNAGFVTGQE  240 (255)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCC-CCCCHH--HHCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCCCCE
T ss_conf             99999999779998999962718-888745--52464689999847--99-78981999999999999677214815983


Q ss_pred             EE
Q ss_conf             98
Q gi|254780290|r  329 IL  330 (332)
Q Consensus       329 Vi  330 (332)
                      +.
T Consensus       241 i~  242 (255)
T PRK05717        241 FV  242 (255)
T ss_pred             EE
T ss_conf             89


No 175
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase; InterPro: IPR013454    Rhamnose is a methyl-pentose sugar which is found as a constituent of pectin within the cell walls of dicotyledonous plants and has also been found in the mucilage of a number of legume plants . RhaD from Rhizobium leguminosarum bv. trifolii is encoded by a gene occurring in a rhamnose utilisation cluster, and is necessary for growth on this compound . This protein is predicted to be a bifunctional NAD-dependent aldolase/dehydrogenase..
Probab=95.31  E-value=0.0026  Score=41.00  Aligned_cols=215  Identities=21%  Similarity=0.273  Sum_probs=109.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             233333221111111222222232221222222333222111222222--222222113444443222221222222221
Q gi|254780290|r   97 GGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLR--SGQTVLIHGGSSGIGTTAIQLASYFGATVY  174 (332)
Q Consensus        97 ~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~--~g~~vlV~ga~g~vG~~a~qla~~~G~~vi  174 (332)
                      --+..||+-++++--+.| +.|.+|+|=            |.+.-+.+  +++-++|+||+||||.....=+-.-|++|+
T Consensus       386 A~Av~~Y~~L~e~E~F~I-EYW~LEeaK------------L~rmP~ek~LA~~Va~VtGGasGIG~~~A~rL~~eGAhvV  452 (709)
T TIGR02632       386 AEAVSEYAALPEQEAFDI-EYWALEEAK------------LRRMPKEKELARRVAFVTGGASGIGRETARRLVDEGAHVV  452 (709)
T ss_pred             CCHHHHCCCCCCCCCCCC-CHHHHHHHH------------HHCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHCCCEEE
T ss_conf             111210258751103341-011679998------------7247659671570688973886526899999973697799


Q ss_pred             CCCCCCCCC-----CCCCCCCCCCCCCCCC----C-------CC--CCCCCC------CCCCCCCCCCCCCCCC----C-
Q ss_conf             112232211-----1111223322222222----2-------11--112222------2222211122221111----1-
Q gi|254780290|r  175 TTAKSEEKC-----LACLKLGAKHAINYLK----E-------DF--LEILQK------ETQGRGIDIILDMVGA----E-  225 (332)
Q Consensus       175 ~~~~~~~~~-----~~~~~lGa~~vi~~~~----~-------~~--~~~i~~------~t~g~g~Divid~~G~----~-  225 (332)
                      ..+-+.++.     ++.+++|++.++.-++    .       |.  .+.+++      ++.| |+|+|.++.|-    + 
T Consensus       453 ~aD~d~~~a~~va~~~~~~fG~d~a~AGsdisaCGPaiGl~~DvT~e~~v~~~f~~v~~~yG-GvD~vv~nAGi~~S~p~  531 (709)
T TIGR02632       453 LADLDAEAAEAVAAEIVDKFGADKAVAGSDISACGPAIGLKLDVTDEEAVKAAFAEVALAYG-GVDIVVNNAGIAVSSPL  531 (709)
T ss_pred             EECCCHHHHHHHHHHHHHHCCCCCEECCCCHHCCCCCEEEEEEECCHHHHHHHHHHHHHHHC-CEEEEEECCCHHCCCCC
T ss_conf             96236578999999986313888121143200046710027631758999999999999749-84787652530105770


Q ss_pred             -------CCC---------------CCCCCCCC---CCCCEEEEECCCCCCCCCC------------CCH-----HHCCC
Q ss_conf             -------122---------------22211223---4530479833787543222------------433-----43053
Q gi|254780290|r  226 -------YLN---------------QHLTLLSK---EGKLIIISFLGGNIATEIN------------LNP-----IISKR  263 (332)
Q Consensus       226 -------~~~---------------~~~~~l~~---~G~iv~~G~~~~~~~~~~~------------~~~-----~~~~~  263 (332)
                             .|+               ++++.++.   +|-+|.++...+-...+-+            +..     +=..+
T Consensus       532 ~~t~r~~~W~l~~di~atG~FLVareA~r~~~~Q~lGG~~VfiaSkNav~A~kn~~AY~aaKA~~~Hl~R~LA~Ela~~G  611 (709)
T TIGR02632       532 EETERLEEWDLNLDILATGYFLVAREAARLMRKQGLGGNIVFIASKNAVVAGKNASAYSAAKAAEAHLARCLAAELAELG  611 (709)
T ss_pred             HHHHHHHHHHHCCEEEEECCHHHHHHHHHHHHHCCCCCCEEEECCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             23221554320120101200358889999997317985567761100011178840555899999989999998147886


Q ss_pred             CE---------EEEEEECCCHHCCH-----------HHHHHHHHHHHHHHHHCCC-CCCCCEEEEEHHHHHHHHHHHHC-
Q ss_conf             21---------67775124000113-----------7899999999999998698-31021247418999999999982-
Q gi|254780290|r  264 IT---------ITGSTLRRRTDIAK-----------QSIRDSLQLKIWPLLNSHV-IAPVIHTVLPLGKVAMAHDIMEK-  321 (332)
Q Consensus       264 ~~---------i~g~~~~~~~~~~~-----------~~~~~~~~~~~~~~i~~g~-l~p~i~~~~~l~~i~~A~~~l~~-  321 (332)
                      ++         +.||.+........           .+-.+.+..++.+.++++. |+-   ++|| +|+.||+=.+.+ 
T Consensus       612 iRVNtV~PdaVl~GS~if~~~W~~~raA~ygi~ftadePtdvl~d~L~~fY~~RslLk~---~v~p-~d~AeAvf~L~S~  687 (709)
T TIGR02632       612 IRVNTVNPDAVLRGSGIFDGEWREERAAAYGIPFTADEPTDVLADKLEEFYAKRSLLKR---EVLP-ADIAEAVFFLASD  687 (709)
T ss_pred             EEEECCCCCHHCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCC---CCCC-HHHHHHHHHHHCC
T ss_conf             46401065001105521533678888877077434687235788889889875432377---6680-8899999997345


Q ss_pred             --CCCCCEEE
Q ss_conf             --99813289
Q gi|254780290|r  322 --SEHIGKII  329 (332)
Q Consensus       322 --g~~~GKvV  329 (332)
                        .|++|.+|
T Consensus       688 ~~~~tTG~~i  697 (709)
T TIGR02632       688 KLEKTTGLII  697 (709)
T ss_pred             CCCCCCCCEE
T ss_conf             1010278664


No 176
>PRK06523 short chain dehydrogenase; Provisional
Probab=95.24  E-value=0.0019  Score=41.96  Aligned_cols=75  Identities=27%  Similarity=0.381  Sum_probs=47.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111122332222222221----1112222222221112222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKED----FLEILQKETQGRGIDIILD  220 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~----~~~~i~~~t~g~g~Divid  220 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.+.++..+...-....  ...|-++++    +.++..+..+  ++|+.++
T Consensus         8 ~gK~alITG~s~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~~--~~~Dv~~~~~v~~~v~~~~~~~g--~iDiLVn   83 (260)
T PRK06523          8 AGKRALVTGGTKGIGAATVARFREAGARVVTTARSRPDDLPEGVEF--VAADLTTAEGCAAVARAVLERLG--GVDILVH   83 (260)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCEE--EECCCCCHHHHHHHHHHHHHHCC--CCCEEEE
T ss_conf             9998999475769999999999987999999948840137986289--98379999999999999999749--9979998


Q ss_pred             CCC
Q ss_conf             111
Q gi|254780290|r  221 MVG  223 (332)
Q Consensus       221 ~~G  223 (332)
                      +.|
T Consensus        84 NAG   86 (260)
T PRK06523         84 VLG   86 (260)
T ss_pred             CCC
T ss_conf             998


No 177
>PRK08278 short chain dehydrogenase; Provisional
Probab=95.23  E-value=0.0013  Score=43.06  Aligned_cols=77  Identities=30%  Similarity=0.362  Sum_probs=48.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----------CCCCCCCCCC---CCCCCCCCCC----CCC
Q ss_conf             222222113444443222221222222221112232211-----------1111223322---2222222111----122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC-----------LACLKLGAKH---AINYLKEDFL----EIL  206 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~-----------~~~~~lGa~~---vi~~~~~~~~----~~i  206 (332)
                      .|+++||+||++|+|.+..+-+...|++|+.+.++.+..           +.+++.|.+.   ..|-++++-.    +++
T Consensus         5 ~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~l~~~~~~~a~e~~~~g~~~~~~~~Dv~~~~~v~~~v~~~   84 (273)
T PRK08278          5 SGKTLFITGASRGIGLAIALRAARDGANIVIAAKTAEPHPKLPGTIHTAAAEIEAAGGQALPLVGDVRDEDQVAAAVAKT   84 (273)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             99989994876599999999999879989999677222133454899999999974990899971179999999999999


Q ss_pred             CCCCCCCCCCCCCCCCC
Q ss_conf             22222221112222111
Q gi|254780290|r  207 QKETQGRGIDIILDMVG  223 (332)
Q Consensus       207 ~~~t~g~g~Divid~~G  223 (332)
                      .+.. | ++|+.+++.|
T Consensus        85 ~~~~-G-~iDiLVNNAG   99 (273)
T PRK08278         85 VERF-G-GIDICVNNAS   99 (273)
T ss_pred             HHHH-C-CCCEEEECCC
T ss_conf             9985-9-9629998786


No 178
>PRK07814 short chain dehydrogenase; Provisional
Probab=95.20  E-value=0.0012  Score=43.16  Aligned_cols=184  Identities=18%  Similarity=0.197  Sum_probs=93.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCC---CCCCCCCCCCC----CCCC
Q ss_conf             222222222222113444443222221222222221112232211111----122332---22222222111----1222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAK---HAINYLKEDFL----EILQ  207 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~---~vi~~~~~~~~----~~i~  207 (332)
                      +..++ .|+++||+||++|+|.+.++-....|++|+.+.+++++.+.+    ++.|..   ...|-++++-.    +++.
T Consensus         4 ~~~~L-~gKvalITGgs~GIG~aia~~la~~Ga~V~i~~~~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~   82 (263)
T PRK07814          4 DRFRL-DGQVAVVTGAGRGLGAAIALAFAEAGADVLIAARTESQLDEVAEQIRAAGRRAHVVAADLAHPEATAGLAGQAV   82 (263)
T ss_pred             HHCCC-CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             20089-99989995896689999999999879989999698999999999998529928999815899999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCC-----------CC---------------CCCCCC---CCCCCCEEEEECCCCCCCCCC---
Q ss_conf             2222221112222111111-----------22---------------222112---234530479833787543222---
Q gi|254780290|r  208 KETQGRGIDIILDMVGAEY-----------LN---------------QHLTLL---SKEGKLIIISFLGGNIATEIN---  255 (332)
Q Consensus       208 ~~t~g~g~Divid~~G~~~-----------~~---------------~~~~~l---~~~G~iv~~G~~~~~~~~~~~---  255 (332)
                      +..  .++|+.+++.|...           |+               .+++.+   +.+|+++.++...+....+-.   
T Consensus        83 ~~~--G~iDiLVnNAg~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~IInisS~~~~~~~~~~~~Y  160 (263)
T PRK07814         83 EAF--GRLDIVVNNVGGTMPNPLLSTSTKDLADAFTFNVATAHALTRAAVPLMLEHSGGGSIINITSTMGRLAGRGFAAY  160 (263)
T ss_pred             HHH--CCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHH
T ss_conf             982--998899989866788844548899999999997199999999999999984799469998126547789984889


Q ss_pred             -------------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC-
Q ss_conf             -------------433430532167775124000113789999999999999869831021247418999999999982-
Q gi|254780290|r  256 -------------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK-  321 (332)
Q Consensus       256 -------------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~-  321 (332)
                                   +..-+.+++++....-+...- .... ......+..+.+.+.  .| ..+.=..+|+.++.-.|.+ 
T Consensus       161 ~asKaal~~ltk~lA~e~a~~IrVN~V~PG~i~T-~~~~-~~~~~~~~~~~~~~~--~P-l~R~g~pedia~~v~FL~Sd  235 (263)
T PRK07814        161 GTAKAALAHYTRLAALDLCPRIRVNAIAPGSILT-SALE-VVAANDELRAPMEKA--TP-LRRLGDPEDIAAAAVYLASP  235 (263)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC-HHHH-HCCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCC
T ss_conf             9999999999999999977997899997798886-0454-325999999999857--99-88980999999999999484


Q ss_pred             --CCCCCEEEE
Q ss_conf             --998132898
Q gi|254780290|r  322 --SEHIGKIIL  330 (332)
Q Consensus       322 --g~~~GKvVi  330 (332)
                        +-.+|-++.
T Consensus       236 ~s~~iTG~~i~  246 (263)
T PRK07814        236 AGSYLTGKTLE  246 (263)
T ss_pred             HHCCCCCCEEE
T ss_conf             32594488288


No 179
>PRK07035 short chain dehydrogenase; Provisional
Probab=95.17  E-value=0.0012  Score=43.18  Aligned_cols=179  Identities=17%  Similarity=0.245  Sum_probs=89.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC-C--CCCCCCC----CCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111----11223322-2--2222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA----CLKLGAKH-A--INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~----~~~lGa~~-v--i~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++++|...++.+...|++|+.+.++.++.+.    +++.|... .  .|-++.+    +.+.+.+..+  
T Consensus         7 ~gKvalITGas~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G--   84 (252)
T PRK07035          7 TGKIALVTGASRGIGEAIAKLLAQQGAHVIVSSRKLDGCQAVADAIVAAGGKAEALACHIGEMEQIDALFAQIRERHG--   84 (252)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC--
T ss_conf             899899958874999999999998799899997988999999999996499579998248999999999999999829--


Q ss_pred             CCCCCCCCCCCC-C-----------CC---------------CCCCCCC--CCCCCEEEEECCCCCCCCCC---------
Q ss_conf             111222211111-1-----------22---------------2221122--34530479833787543222---------
Q gi|254780290|r  214 GIDIILDMVGAE-Y-----------LN---------------QHLTLLS--KEGKLIIISFLGGNIATEIN---------  255 (332)
Q Consensus       214 g~Divid~~G~~-~-----------~~---------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~---------  255 (332)
                      ++|+.+++.|.. .           |+               ..++.|+  .+|+++.++...+..+.+..         
T Consensus        85 ~iDilVnnAg~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IvnisS~~~~~~~~~~~~Y~asKaa  164 (252)
T PRK07035         85 RLDILVNNAAANPYFGHILDTDLGAFQKTVDVNIRGYFFMSVEAGKLMKEQGGGSIVNVASVNGVSPGDFQGIYSITKAA  164 (252)
T ss_pred             CCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHH
T ss_conf             97789876855888888200999999999998712431000453699996699749997254436889874889999999


Q ss_pred             --------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CC
Q ss_conf             --------4334305321677751240001137899999999999998698310212474189999999999829---98
Q gi|254780290|r  256 --------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EH  324 (332)
Q Consensus       256 --------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~  324 (332)
                              ..++-.+++++....-+...-........  ..+..+.+.+.  .| ..+.-..+|+.++...|.+.   -.
T Consensus       165 l~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~--~~~~~~~~~~~--~P-l~R~g~pedia~~v~fL~S~~a~~i  239 (252)
T PRK07035        165 VISMTKAFAKECAPFGIRVNALLPGLTDTKFASALFK--NDAILKQALAH--IP-LRRHAEPSEMAGAVLYLVSDASSYT  239 (252)
T ss_pred             HHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHCCCC--CHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             9999999999860329599999628788742430248--99999999856--99-9998299999999999968542293


Q ss_pred             CCEEEE
Q ss_conf             132898
Q gi|254780290|r  325 IGKIIL  330 (332)
Q Consensus       325 ~GKvVi  330 (332)
                      +|-++.
T Consensus       240 TG~~i~  245 (252)
T PRK07035        240 TGECLN  245 (252)
T ss_pred             CCCEEE
T ss_conf             686488


No 180
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional
Probab=95.17  E-value=0.0012  Score=43.28  Aligned_cols=180  Identities=16%  Similarity=0.172  Sum_probs=89.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCC----CCCCCC----CCCCCCCCCCC
Q ss_conf             222221134444432222212222222211122322111111-----22332222----222221----11122222222
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-----KLGAKHAI----NYLKED----FLEILQKETQG  212 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-----~lGa~~vi----~~~~~~----~~~~i~~~t~g  212 (332)
                      ++.+||+||++++|.+.++.+...|++|+.+.++.++.+.+.     +.|...++    |-++++    +.+++.+.. |
T Consensus         2 nKvalITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~-G   80 (259)
T PRK12384          2 NKVAVVIGGGQTLGAFLCHGLAEEGYRVAVADINSEKAANVAQEINAEYGEGMAYGFGADATSEQSVLALSRGVDEIF-G   80 (259)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHH-C
T ss_conf             978999468868999999999987999999979889999999999862488608999832799999999999999982-9


Q ss_pred             CCCCCCCCCCCCC---C--------CC---------------CCCCCC---CCCCCCEEEEECCCCCCCCCC--------
Q ss_conf             2111222211111---1--------22---------------222112---234530479833787543222--------
Q gi|254780290|r  213 RGIDIILDMVGAE---Y--------LN---------------QHLTLL---SKEGKLIIISFLGGNIATEIN--------  255 (332)
Q Consensus       213 ~g~Divid~~G~~---~--------~~---------------~~~~~l---~~~G~iv~~G~~~~~~~~~~~--------  255 (332)
                       ++|+++++.|..   .        |+               ..++.+   +.+|+++.++...+.......        
T Consensus        81 -~iDilVnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~Iv~isS~~~~~~~~~~~~Y~asK~  159 (259)
T PRK12384         81 -RVDLLVYSAGIAKAAKITDFQLGDFDRSLQVNLVGYFLCAREFSRLMIRDGIQGRIIQINSKSGKVGSKHNSGYSAAKF  159 (259)
T ss_pred             -CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCCHHHHHHH
T ss_conf             -9719998997778899145999999999998864422346776368997389845999835254558854306799999


Q ss_pred             ---------CCHHHCCCCEEEEEEECCCHHCCH-HHHHHHH-------HHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHH
Q ss_conf             ---------433430532167775124000113-7899999-------99999999869831021247418999999999
Q gi|254780290|r  256 ---------LNPIISKRITITGSTLRRRTDIAK-QSIRDSL-------QLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDI  318 (332)
Q Consensus       256 ---------~~~~~~~~~~i~g~~~~~~~~~~~-~~~~~~~-------~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~  318 (332)
                               ..++-.+++++....-+...+... .......       ..++.+.+.+.  .| ..+.-..+|+.++...
T Consensus       160 al~~ltk~lA~e~a~~gIrVN~I~PG~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~P-l~R~g~p~diA~~v~f  236 (259)
T PRK12384        160 GGVGLTQSLALDLAEYGITVHSLMLGNLLKSPMFQSLLPQYAKKLGIKPDEVEQYYIDK--VP-LKRGCDYQDVLNMLLF  236 (259)
T ss_pred             HHHHHHHHHHHHHHHHCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHC--CC-CCCCCCHHHHHHHHHH
T ss_conf             99999999999962319799998388715676666655878877299989999999847--99-8999699999999999


Q ss_pred             HHCCC---CCCEEEE
Q ss_conf             98299---8132898
Q gi|254780290|r  319 MEKSE---HIGKIIL  330 (332)
Q Consensus       319 l~~g~---~~GKvVi  330 (332)
                      |.+.+   .+|-++.
T Consensus       237 L~S~~a~~iTG~~i~  251 (259)
T PRK12384        237 YASPKASYCTGQSIN  251 (259)
T ss_pred             HHCCHHCCCCCCEEE
T ss_conf             958563380387289


No 181
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.16  E-value=0.002  Score=41.71  Aligned_cols=177  Identities=18%  Similarity=0.224  Sum_probs=89.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC----CCCCCCC---CCCCCCCC----CCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322-11111----1223322---22222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE-KCLAC----LKLGAKH---AINYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~-~~~~~----~~lGa~~---vi~~~~~~----~~~~i~~~t~g  212 (332)
                      +|++++|+||++++|.+.++.+...|++|+.++++.+ ..+.+    +..|.+.   ..|-++++    +.+.+.+.. |
T Consensus         6 kgK~~lITGas~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~-g   84 (250)
T PRK12825          6 SGRVALVTGAARGIGRAIALRLAAAGADVIVHPPSDEAAAEETVAAVEALGRRAQAVQADVTDAAALEAAVEELVERF-G   84 (250)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHC-C
T ss_conf             978899938955899999999998799899997988789999999998539948999941899999999999999976-9


Q ss_pred             CCCCCCCCCCCCCC-----------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC---------
Q ss_conf             21112222111111-----------22---------------222112--234530479833787543222---------
Q gi|254780290|r  213 RGIDIILDMVGAEY-----------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN---------  255 (332)
Q Consensus       213 ~g~Divid~~G~~~-----------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~---------  255 (332)
                       ++|+++++.|...           |+               .+++.+  ..+|+++.++...+....+-.         
T Consensus        85 -~iDilInnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~~~~~~~Y~~sK~A  163 (250)
T PRK12825         85 -AIDILVNNAGITGDGRLWEMSDDEWERVIDVNLTGVFNVLRAVVPPMIEAGGGRIVNISSVAGLKGNPGQVNYAAAKAG  163 (250)
T ss_pred             -CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHHHHH
T ss_conf             -9989998998899989023999999999998518999999998999997499739999145555789996778999999


Q ss_pred             --------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---C
Q ss_conf             --------43343053216777512400011378999999999999986983102124741899999999998299---8
Q gi|254780290|r  256 --------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---H  324 (332)
Q Consensus       256 --------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~  324 (332)
                              ..++-..++++....-+... ..   ..+....+..+.+.+.  .|. .+.-.-+|+.++...|.+.+   .
T Consensus       164 l~~l~~~la~e~~~~gIrvN~I~PG~v~-T~---~~~~~~~~~~~~~~~~--~p~-~R~~~pedva~~v~fL~s~~s~~i  236 (250)
T PRK12825        164 LVGLTKALARELAERGIRVNAVAPGAID-TE---MIEATIEEAREAILKL--IPL-GRLGTPEEIADAVAFLASDAAGYI  236 (250)
T ss_pred             HHHHHHHHHHHHHHHCEEEEEEEECCCC-CC---CCCCCCHHHHHHHHHC--CCC-CCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             9999999999860429299999728887-70---3212588899999826--998-998399999999999968622282


Q ss_pred             CCEEEE
Q ss_conf             132898
Q gi|254780290|r  325 IGKIIL  330 (332)
Q Consensus       325 ~GKvVi  330 (332)
                      +|-++.
T Consensus       237 tG~~i~  242 (250)
T PRK12825        237 TGQVIA  242 (250)
T ss_pred             CCCEEE
T ss_conf             488689


No 182
>PRK08628 short chain dehydrogenase; Provisional
Probab=95.15  E-value=0.0017  Score=42.29  Aligned_cols=182  Identities=14%  Similarity=0.127  Sum_probs=89.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCC---CCCCCCC----CCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111---2233222---2222221----1112222222221
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL---KLGAKHA---INYLKED----FLEILQKETQGRG  214 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~---~lGa~~v---i~~~~~~----~~~~i~~~t~g~g  214 (332)
                      .|++++|+||++|+|...++.+...|++|+.+++++++.+.++   ..|.+..   .|-++++    +.+++.+.. | +
T Consensus         6 ~gKvalVTG~s~GIG~a~a~~la~~Ga~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~v~~~~~~~-g-~   83 (258)
T PRK08628          6 KDKVVIVTGGASGIGAAISLRLAEEGAIPVVFGRSAPDDEFAEELRALQPRAEFVQVDLQDDAQCRDAVAQTVAKF-G-R   83 (258)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHH-C-C
T ss_conf             9998999277778999999999987998999808802399999999539978999952799999999999999982-9-9


Q ss_pred             CCCCCCCCCC---CCCC----------------------CCCCCCC-CCCCCEEEEECCCCCCCCCC-------------
Q ss_conf             1122221111---1122----------------------2221122-34530479833787543222-------------
Q gi|254780290|r  215 IDIILDMVGA---EYLN----------------------QHLTLLS-KEGKLIIISFLGGNIATEIN-------------  255 (332)
Q Consensus       215 ~Divid~~G~---~~~~----------------------~~~~~l~-~~G~iv~~G~~~~~~~~~~~-------------  255 (332)
                      +|+.+++.|.   ..++                      .+++.|+ .+|+++.++...+..+.+-.             
T Consensus        84 iDiLVnnAGi~~~~~~e~~~e~~~~~~~~Nl~~~~~l~~~~~p~l~~~~GsIInisS~~a~~~~~~~~~Y~asKaal~~l  163 (258)
T PRK08628         84 IDGLVNNAGVNDGVGLDAGRDAFVASLERNLIHYYVMAHYCLPHLKASRGAIVNISSKTALTGQGGTSGYAAAKGAQLGL  163 (258)
T ss_pred             CCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHCCCCCCCCHHHHHHHHHHHHH
T ss_conf             88999888227887778999999999998749999999999998885495499981221016799848899999999999


Q ss_pred             ----CCHHHCCCCEEEEEEECCCHHCCHHHHHHH--HHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC---CCCCC
Q ss_conf             ----433430532167775124000113789999--999999999869831021247418999999999982---99813
Q gi|254780290|r  256 ----LNPIISKRITITGSTLRRRTDIAKQSIRDS--LQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK---SEHIG  326 (332)
Q Consensus       256 ----~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~--~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~---g~~~G  326 (332)
                          ..++-..++++....-+...-.........  ......+.+.+.  .|...+.-.-+|+.++.-.|.+   +-.+|
T Consensus       164 tr~lA~e~~~~gIRvNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~--~pl~~R~g~p~eiA~~v~FL~Sd~s~~iTG  241 (258)
T PRK08628        164 TREWAVALAKDGVRVNAVIPAEVMTPLYANWLATFDDPEAKLAKITRK--IPLGHRMTTAEEIADTAVFLLSERASHTTG  241 (258)
T ss_pred             HHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHCCCHHHHHHHHHHC--CCCCCCCCCHHHHHHHHHHHHCCHHCCCCC
T ss_conf             999999964119599999878898766798876047869999999954--998678829999999999995834349338


Q ss_pred             EEEE
Q ss_conf             2898
Q gi|254780290|r  327 KIIL  330 (332)
Q Consensus       327 KvVi  330 (332)
                      -++.
T Consensus       242 ~~i~  245 (258)
T PRK08628        242 QWLF  245 (258)
T ss_pred             CEEE
T ss_conf             8799


No 183
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=95.14  E-value=0.0019  Score=41.87  Aligned_cols=183  Identities=16%  Similarity=0.185  Sum_probs=89.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCC---CCCCCCC----CCCCCCCC
Q ss_conf             2222222222211344444322222122222222111223221---111112233222---2222221----11122222
Q gi|254780290|r  140 TANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK---CLACLKLGAKHA---INYLKED----FLEILQKE  209 (332)
Q Consensus       140 ~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~---~~~~~~lGa~~v---i~~~~~~----~~~~i~~~  209 (332)
                      ..++ .|+++||+||++|+|.+.++.+...|++|+.+.++++.   .+.+++.|.+..   .|-++++    +.+++.+.
T Consensus        10 ~f~L-~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~v~~~~~~   88 (258)
T PRK06935         10 FFSL-KGKVAIVTGGNTGLGQGYAVALAKAGADIIITTHGTNWDETRRLIEKEGRKVTFVQLDLTKKESAEAVVAEALEK   88 (258)
T ss_pred             HCCC-CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             3199-999899948575899999999998799999972997899999999966993799990489999999999999997


Q ss_pred             CCCCCCCCCCCCCCCC----C-------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC------
Q ss_conf             2222111222211111----1-------22---------------222112--234530479833787543222------
Q gi|254780290|r  210 TQGRGIDIILDMVGAE----Y-------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN------  255 (332)
Q Consensus       210 t~g~g~Divid~~G~~----~-------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~------  255 (332)
                      .+  ++|+.+++.|..    .       |+               ..++.+  +.+|+++.++...+....+..      
T Consensus        89 ~G--~iDiLVNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IInisS~~~~~g~~~~~~Y~as  166 (258)
T PRK06935         89 FG--KIDILVNNAGTIRRAPLLEYKDEDWQAVIDINLNSVYHLSQAVAKVMAKQGSGKIINIASMLSFQGGKFVPPYTAS  166 (258)
T ss_pred             CC--CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHCCCCCCCHHHHHH
T ss_conf             49--9999998999999998023999999999998647899999999999998389818999532016788887669999


Q ss_pred             -----------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC-
Q ss_conf             -----------43343053216777512400011378999999999999986983102124741899999999998299-
Q gi|254780290|r  256 -----------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE-  323 (332)
Q Consensus       256 -----------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~-  323 (332)
                                 ..++-..++++....-+...-......... .....++...   .| ..+.-.-+|+..+.-.|.+.. 
T Consensus       167 Kaav~~lTr~lA~e~a~~gIrVNaVaPG~i~T~~~~~~~~~-~~~~~~~~~~---iP-lgR~g~peeiA~~v~FLaSd~s  241 (258)
T PRK06935        167 KHGVAGLTKAFANELAAYNIQVNAIAPGYIKTANTAPIRAD-KARNAEILKR---IP-AGRWGEPDDLMGAAVFLASRAS  241 (258)
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCC-HHHHHHHHHC---CC-CCCCCCHHHHHHHHHHHHCCHH
T ss_conf             99999999999999722698999985488978650112479-9999999955---99-9997789999999999838432


Q ss_pred             --CCCEEEE
Q ss_conf             --8132898
Q gi|254780290|r  324 --HIGKIIL  330 (332)
Q Consensus       324 --~~GKvVi  330 (332)
                        .+|-++.
T Consensus       242 ~~iTG~~i~  250 (258)
T PRK06935        242 DYVNGHILA  250 (258)
T ss_pred             CCCCCCEEE
T ss_conf             691287289


No 184
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional
Probab=95.14  E-value=0.0028  Score=40.81  Aligned_cols=104  Identities=22%  Similarity=0.300  Sum_probs=67.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222221134444432222212222--222211122322111111----2233222222222111122222222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYF--GATVYTTAKSEEKCLACL----KLGAKHAINYLKEDFLEILQKETQG  212 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~--G~~vi~~~~~~~~~~~~~----~lGa~~vi~~~~~~~~~~i~~~t~g  212 (332)
                      ...++++++.++=.|+  |.|..++..|+..  +.+|+++.++++..++++    ++|...-+.--..+..+.+.++.. 
T Consensus        34 ~~L~l~~~~~vwDIGa--GsGsvsiEaa~~~~~~~~V~aIE~~~e~~~~~~~N~~kfg~~~nv~~i~G~ap~~l~~l~p-  110 (198)
T PRK00377         34 SKLRLFKGGKLVDVGC--GTGSVSVEAALIVGEGGKVYAIDKDELAVELTKKNAEKFGVGDNVVLIEGEAPEVLPKLNP-  110 (198)
T ss_pred             HHHCCCCCCEEEEECC--CEEHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHCCCC-
T ss_conf             9709999899999177--0329999999966978759999678889999999999809998859995254887720899-


Q ss_pred             CCCCCCCC-CCCC---CCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             21112222-1111---1122222112234530479833
Q gi|254780290|r  213 RGIDIILD-MVGA---EYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       213 ~g~Divid-~~G~---~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                       .+|.||= -.++   +.++.+++.|+++|++|.-..+
T Consensus       111 -~pD~vFIGG~~g~l~~il~~~~~~L~~gGriVinaVt  147 (198)
T PRK00377        111 -KSDRYFIGGGGEELPEIIQAALEKIGKGGRIVADAIL  147 (198)
T ss_pred             -CCCEEEEECCCCCHHHHHHHHHHHCCCCCEEEEEEEC
T ss_conf             -8898999788777899999999857999899998362


No 185
>PRK07097 gluconate 5-dehydrogenase; Provisional
Probab=95.13  E-value=0.0013  Score=43.02  Aligned_cols=181  Identities=19%  Similarity=0.195  Sum_probs=93.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCC---CCCCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----122332---222222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAK---HAINYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~---~vi~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++|+|.+.++-....|++|+.+.+++++.+.+    ++.|..   ...|-++.+    +.+++.+..+  
T Consensus         9 ~gK~alVTG~s~GIG~aiA~~la~~Ga~Vii~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~g--   86 (265)
T PRK07097          9 KGKIALITGASYGIGFAIAKAYAEAGATIVFNDIKQELVDKGLAAYRELGIEAHGYVCDVTDEDGIQAMVAQIEKEVG--   86 (265)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCC--
T ss_conf             999899958576899999999998699999995998999999999995499179999328999999999999999829--


Q ss_pred             CCCCCCCCCCCC---C--------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC----------
Q ss_conf             111222211111---1--------22---------------222112--234530479833787543222----------
Q gi|254780290|r  214 GIDIILDMVGAE---Y--------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN----------  255 (332)
Q Consensus       214 g~Divid~~G~~---~--------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~----------  255 (332)
                      ++|+.+++.|..   .        |+               .+++.+  +..|+++.++...+....+-.          
T Consensus        87 ~iDiLVnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaav  166 (265)
T PRK07097         87 VIDILVNNAGIIRRIPMLEMSAEDFRQVIDIDLNAPFIVSKAVLPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGGL  166 (265)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCCCCCCCHHHHHHHHHH
T ss_conf             99899989989999882659999999999986072899999999989980897599990521156788866899999999


Q ss_pred             -------CCHHHCCCCEEEEEEECCCHHCCHHHHHH----HHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC--
Q ss_conf             -------43343053216777512400011378999----99999999998698310212474189999999999829--
Q gi|254780290|r  256 -------LNPIISKRITITGSTLRRRTDIAKQSIRD----SLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS--  322 (332)
Q Consensus       256 -------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~----~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g--  322 (332)
                             ..++-.+++++....-+............    .....+.+++.+.  .| ..+.-..+|+..+.-.+.+.  
T Consensus       167 ~~ltr~lA~e~a~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~--~P-~~R~g~p~dia~~v~FL~Sd~s  243 (265)
T PRK07097        167 KMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRERQADGSRHPFDQFIIAK--TP-AARWGTPEDLAGPAVFLASDAS  243 (265)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHH
T ss_conf             99999999997024959999965889886304566531011121599999847--99-8897889999999999948442


Q ss_pred             -CCCCEEEE
Q ss_conf             -98132898
Q gi|254780290|r  323 -EHIGKIIL  330 (332)
Q Consensus       323 -~~~GKvVi  330 (332)
                       -.+|-++.
T Consensus       244 ~~iTGq~i~  252 (265)
T PRK07097        244 NFVNGHILY  252 (265)
T ss_pred             CCCCCCEEE
T ss_conf             483587599


No 186
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.11  E-value=0.0014  Score=42.71  Aligned_cols=102  Identities=27%  Similarity=0.326  Sum_probs=61.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC-CCCCCCCC----CCCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221-11111223322-22222221----11122222222211122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK-CLACLKLGAKH-AINYLKED----FLEILQKETQGRGIDII  218 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~-~~~~~~lGa~~-vi~~~~~~----~~~~i~~~t~g~g~Div  218 (332)
                      .|+++||+||++|+|.+.++.+...|++|+...++.++ .+.+++.|... ..|-++++    +.+++.+..+  ++|+.
T Consensus         6 ~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G--~iDiL   83 (254)
T PRK06463          6 KGKVALITGGSRGIGRAIAEKFLKEGAKVAILYNSSEDKAKELKEKGVETFKCDVSNRDQVRKAKEEIHKKLG--RIDVL   83 (254)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHC--CCCEE
T ss_conf             9898999484778999999999988999999649978999999866988999738999999999999999829--99899


Q ss_pred             CCCCCCC-----------CCC---------------CCCCCC-CCCCCCEEEEECCC
Q ss_conf             2211111-----------122---------------222112-23453047983378
Q gi|254780290|r  219 LDMVGAE-----------YLN---------------QHLTLL-SKEGKLIIISFLGG  248 (332)
Q Consensus       219 id~~G~~-----------~~~---------------~~~~~l-~~~G~iv~~G~~~~  248 (332)
                      +++.|..           .|+               ..++.| +.+|+++.++...+
T Consensus        84 VNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~G~IVnisS~~g  140 (254)
T PRK06463         84 VNNAGIWYLMPFEEFDEEKYNRMLDVNLNGTIYTTYEFLPDLKEENGVIINIASNAG  140 (254)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEHHH
T ss_conf             989977899991559999999999998389999999999988763986999975754


No 187
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.10  E-value=0.0022  Score=41.55  Aligned_cols=171  Identities=23%  Similarity=0.235  Sum_probs=89.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCC--CCCCCCCC----CCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111----223322--22222221----1112222222221
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL----KLGAKH--AINYLKED----FLEILQKETQGRG  214 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~----~lGa~~--vi~~~~~~----~~~~i~~~t~g~g  214 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.+.+++++.+.++    +.|.-.  ..|-++++    +.+++.+..  .+
T Consensus         4 ~gK~~lVTGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~~~~~Dvs~~~~v~~~~~~~~~~~--g~   81 (238)
T PRK05786          4 KGKNVLIVGVSPGLGYAVAYFALREGASVYAFARSEEKLKEIKKTLAKYGNVIYVVGDVSKLEGAREAAEKAAKVF--GA   81 (238)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH--CC
T ss_conf             9988999289878999999999987999999969889999999987435977999757899999999999999983--99


Q ss_pred             CCCCCCCCCCC---CC---------------------CCCCCCCCCCCCCEEEEECCCCCCC-C--CC------------
Q ss_conf             11222211111---12---------------------2222112234530479833787543-2--22------------
Q gi|254780290|r  215 IDIILDMVGAE---YL---------------------NQHLTLLSKEGKLIIISFLGGNIAT-E--IN------------  255 (332)
Q Consensus       215 ~Divid~~G~~---~~---------------------~~~~~~l~~~G~iv~~G~~~~~~~~-~--~~------------  255 (332)
                      +|+++.+.|..   .+                     +..++.++++|.++.++...+.... +  ..            
T Consensus        82 iD~lv~naG~~~~~~~~~~~~~~~~~~~nl~~~~~~~~~~~~~m~~g~~ii~iss~~~~~~~~~~~~~Y~asKaal~~lt  161 (238)
T PRK05786         82 LHGLVVTAGGYIEDTVEELAGLEDMLNNHLKAPLYAVNASLPLLREGSSIVLVSSIRGIYKAWPRQLSYAAAKAGLAKAV  161 (238)
T ss_pred             CCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECHHHCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             88799805756788523189999999998589999999999974216779999644541678986178999999999999


Q ss_pred             ---CCHHHCCCCEEEEEEECCCH-HCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---CCCEE
Q ss_conf             ---43343053216777512400-011378999999999999986983102124741899999999998299---81328
Q gi|254780290|r  256 ---LNPIISKRITITGSTLRRRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---HIGKI  328 (332)
Q Consensus       256 ---~~~~~~~~~~i~g~~~~~~~-~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~~GKv  328 (332)
                         ..++-.+++++....-+... +..+...    .....++         ....-+.+|+.++...|.+-+   .+|-+
T Consensus       162 k~lA~ela~~gIrVN~IaPG~i~t~~~~~~~----~~~~~~~---------~~~~~~peeiA~~v~fL~S~~a~~iTG~~  228 (238)
T PRK05786        162 EILAAELLDRGIRVNGVAPSGIDGDFVPGRD----WKKLRKL---------GDPQAPPEDFAKVIIWLLTDEAEWVNGVV  228 (238)
T ss_pred             HHHHHHHCCCCEEEEEEECCCCCCCCCCCCC----HHHHHHH---------CCCCCCHHHHHHHHHHHHCCHHCCCCCCE
T ss_conf             9999996417959999962889988877768----6987763---------01799999999999999697213966880


Q ss_pred             EE
Q ss_conf             98
Q gi|254780290|r  329 IL  330 (332)
Q Consensus       329 Vi  330 (332)
                      +.
T Consensus       229 i~  230 (238)
T PRK05786        229 IP  230 (238)
T ss_pred             EE
T ss_conf             88


No 188
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.04  E-value=0.0027  Score=40.88  Aligned_cols=176  Identities=20%  Similarity=0.204  Sum_probs=85.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112233222222222111122222222211122221111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA  224 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~  224 (332)
                      .|+++||+||++|+|.+.++.....|++|+++.+++.. ....++.. ...|-+++.+ +++.+..  ..+|+.+++.|.
T Consensus         4 ~gK~alVTGas~GIG~aia~~~a~~Ga~V~~~d~~~~~-~~~~~~~~-~~~Dv~~~~v-~~~~~~~--g~iDiLvNnAGi   78 (237)
T PRK06550          4 MTKTVLVTGAASGIGLAQARAFLEQGAHVYGVDKSDKP-DLSGNFHF-IQLDLSSDKL-EPLFKVV--PSVDILCNTAGI   78 (237)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHH-HCCCCEEE-EECCCCHHHH-HHHHHHC--CCCCEEEECCCC
T ss_conf             99899993747799999999999879999997086124-30697389-9863888999-9999975--999799989888


Q ss_pred             -CC---C--------C---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC-----------------CCH
Q ss_conf             -11---2--------2---------------222112--234530479833787543222-----------------433
Q gi|254780290|r  225 -EY---L--------N---------------QHLTLL--SKEGKLIIISFLGGNIATEIN-----------------LNP  258 (332)
Q Consensus       225 -~~---~--------~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~-----------------~~~  258 (332)
                       ..   +        +               ..++.|  +.+|+++.++...+....+-.                 ..+
T Consensus        79 ~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IVnisS~~g~~~~~~~~~Y~asKaal~~lTrslA~e  158 (237)
T PRK06550         79 LDDYKPLLDTSDEEWQHIFDINLFSTFLLTRAYLPQMLEKKSGVIINMCSIAGFVAGGGGVAYTASKHALAGFTKQLALD  158 (237)
T ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999905599999999999972999999999999999809918999546343557998688999999999999999999


Q ss_pred             HHCCCCEEEEEEECCCH-HCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CCCCEEEE
Q ss_conf             43053216777512400-01137899999999999998698310212474189999999999829---98132898
Q gi|254780290|r  259 IISKRITITGSTLRRRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EHIGKIIL  330 (332)
Q Consensus       259 ~~~~~~~i~g~~~~~~~-~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~~GKvVi  330 (332)
                      +-..++++....-+... .......  ....+..+.+.+.  .| ..+.-.-+|+.++.-.|.+-   -.+|-++.
T Consensus       159 la~~gIrVNaVaPG~i~T~m~~~~~--~~~~~~~~~~~~~--~P-l~R~g~p~eiA~~v~FLaSd~as~iTG~~i~  229 (237)
T PRK06550        159 YAKDGIQVFGIAPGAIKTPMNAADF--AEPGGMADWVARE--TP-IKRWAEPEEVAELTLFLASGKADYMQGTIVP  229 (237)
T ss_pred             HCCCCEEEEEEEECCCCCCCHHHHC--CCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             6501959999976889873201003--5969999999856--99-9997889999999999958553381486289


No 189
>PRK12746 short chain dehydrogenase; Provisional
Probab=95.04  E-value=0.0017  Score=42.18  Aligned_cols=180  Identities=22%  Similarity=0.235  Sum_probs=90.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC-CC---CCCCCC---CCCCCCC----CCCCCCCC---
Q ss_conf             2222221134444432222212222222211-12232211111-12---233222---2222221----11122222---
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYT-TAKSEEKCLAC-LK---LGAKHA---INYLKED----FLEILQKE---  209 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~-~~~~~~~~~~~-~~---lGa~~v---i~~~~~~----~~~~i~~~---  209 (332)
                      .|++++|+||++++|...+..+...|++|+. ..+++++.+.+ ++   .|....   .|-++.+    +.+.+.+.   
T Consensus         5 ~gKvalITGga~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~~~   84 (254)
T PRK12746          5 DGKVALVTGASRGIGRAIAMRLANDGALVAIHYGRNKAAADETIREIESNGGKAFLIEADLNSIDGVKKLVEQLKNELQI   84 (254)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99889994847689999999999879999996599989999999999855992899975779999999999999999866


Q ss_pred             -CCCCCCCCCCCCCCCC---C--------C---------------CCCCCCCCCCCCCEEEEECCCCCCCCCC-------
Q ss_conf             -2222111222211111---1--------2---------------2222112234530479833787543222-------
Q gi|254780290|r  210 -TQGRGIDIILDMVGAE---Y--------L---------------NQHLTLLSKEGKLIIISFLGGNIATEIN-------  255 (332)
Q Consensus       210 -t~g~g~Divid~~G~~---~--------~---------------~~~~~~l~~~G~iv~~G~~~~~~~~~~~-------  255 (332)
                       .++.++|+.+++.|..   .        |               +..+++++.+|+++.++........+-.       
T Consensus        85 ~~g~g~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~f~~~k~~~p~m~~~G~IVnisS~~~~~~~~~~~~Y~asK  164 (254)
T PRK12746         85 RVGTSEIDILVNNAGIGTQGTIENTTEEIFDEIMAVNIKAPFFLIQQTLPLLRAEGRVINISSAEVRLGFTGSIAYGLSK  164 (254)
T ss_pred             HCCCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECHHHCCCCCCCHHHHHHH
T ss_conf             41689851899799788999914499999999999853468999999999986169669992432335788737789999


Q ss_pred             ----------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHH-HHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC-
Q ss_conf             ----------4334305321677751240001137899999-9999999986983102124741899999999998299-
Q gi|254780290|r  256 ----------LNPIISKRITITGSTLRRRTDIAKQSIRDSL-QLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE-  323 (332)
Q Consensus       256 ----------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~-~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~-  323 (332)
                                ..++-.+++++....-+... ..  ...... ..++.+...+..   ...+.-..+|+.++...|.+.. 
T Consensus       165 aal~~ltr~lA~e~a~~gIrVNaVaPG~i~-T~--~~~~~~~~~~~~~~~~~~~---~lgR~g~p~dia~~v~FL~S~~s  238 (254)
T PRK12746        165 GALNTMTLPLAKHLGERGITVNTIMPGYTK-TD--INAKLLDDPEIRNFATNSS---VFGRIGQVEDIADAVAFLASSDS  238 (254)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEEECCCC-CH--HHHHCCCCHHHHHHHHHCC---CCCCCCCHHHHHHHHHHHHCCHH
T ss_conf             999999999999965139899998789898-63--3433049999999997279---97897599999999999958632


Q ss_pred             --CCCEEEE
Q ss_conf             --8132898
Q gi|254780290|r  324 --HIGKIIL  330 (332)
Q Consensus       324 --~~GKvVi  330 (332)
                        .+|-++.
T Consensus       239 ~~iTG~~l~  247 (254)
T PRK12746        239 RWVTGQIID  247 (254)
T ss_pred             CCEECCEEE
T ss_conf             384088588


No 190
>PRK07402 precorrin-6B methylase; Provisional
Probab=95.04  E-value=0.0044  Score=39.54  Aligned_cols=103  Identities=20%  Similarity=0.194  Sum_probs=65.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222113444443222221222-2222211122322111111----22332222222221111222222222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASY-FGATVYTTAKSEEKCLACL----KLGAKHAINYLKEDFLEILQKETQGR  213 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~-~G~~vi~~~~~~~~~~~~~----~lGa~~vi~~~~~~~~~~i~~~t~g~  213 (332)
                      ...++++++.+.=.|+  |.|..++..|+. .+.+|++++++++..++.+    ++|++++- --..+..+.+.++.  .
T Consensus        34 ~kL~l~~~~~vwDIGa--GtGsVsiEaa~~~~~g~V~AIE~~~~a~~li~~N~~rfgv~nv~-ii~g~ape~L~~l~--p  108 (196)
T PRK07402         34 SQLRLEPDSVLWDIGA--GTGTIPVEAALLCPKGRVIAIERDEEVANLIRRNCDRFGVKNVE-VIEGSAPECLAQLA--P  108 (196)
T ss_pred             HHHCCCCCCEEEEECC--CCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEE-EEECCCHHHHHHCC--C
T ss_conf             9708999999999478--87799999998789988999976888999999989972999879-99726366684089--9


Q ss_pred             CCCCCCCCCCC---CCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             11122221111---1122222112234530479833
Q gi|254780290|r  214 GIDIILDMVGA---EYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       214 g~Divid~~G~---~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      ..|.||=--|+   +.++.+++.|+++|++|.-..+
T Consensus       109 ~pD~vFIGGg~~l~~il~~~~~~L~pgGriVinait  144 (196)
T PRK07402        109 APDRICIEGGRPIKEILQAVWQYLKPGGRLVATASS  144 (196)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEEEEE
T ss_conf             999999848968899999999867999899998570


No 191
>PRK06949 short chain dehydrogenase; Provisional
Probab=95.02  E-value=0.0019  Score=41.98  Aligned_cols=78  Identities=24%  Similarity=0.334  Sum_probs=51.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111----12233222---2222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|+++||+||++|+|.+.+..+...|++|+.+.++.++.+.+    +..|.+..   .|-++++    +.+++.+..+  
T Consensus         8 ~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G--   85 (258)
T PRK06949          8 EGKVALVTGASSGLGQRFAQVLSQAGAKVVLASRRVERLKELRAEIEAEGGAAHVVSLDVTDYQSIKAAVAHAETEAG--   85 (258)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC--
T ss_conf             999899958577999999999998799999996988999999999996599289998268999999999999999849--


Q ss_pred             CCCCCCCCCCC
Q ss_conf             11122221111
Q gi|254780290|r  214 GIDIILDMVGA  224 (332)
Q Consensus       214 g~Divid~~G~  224 (332)
                      ++|+.+++.|.
T Consensus        86 ~iDiLVnnAG~   96 (258)
T PRK06949         86 TIDILVNNSGV   96 (258)
T ss_pred             CCCEEEECCCC
T ss_conf             99899989988


No 192
>PRK06138 short chain dehydrogenase; Provisional
Probab=94.98  E-value=0.0016  Score=42.45  Aligned_cols=178  Identities=13%  Similarity=0.205  Sum_probs=90.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC--CCC---CCCCCCCCC----CCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-122--332---222222221----1112222222221
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKL--GAK---HAINYLKED----FLEILQKETQGRG  214 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~l--Ga~---~vi~~~~~~----~~~~i~~~t~g~g  214 (332)
                      .|+.+||+||++|+|.+.++-....|++|+.+.+++++.+.+ +++  |.+   ...|-++++    +.+++.+.. | +
T Consensus         4 ~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~-G-~   81 (252)
T PRK06138          4 AGRVAIVTGAGSGIGRATAKLFAREGARVVVADRDAEAAERVAAAIAAGGRAFARQGDVGSAEAVEALVDFVAARW-G-R   81 (252)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHC-C-C
T ss_conf             9988999474679999999999987998999968878999999998379919999942899999999999999982-9-9


Q ss_pred             CCCCCCCCCCC----C-------CC---------------CCCCCCC--CCCCCEEEEECCCCCCCCCC-----------
Q ss_conf             11222211111----1-------22---------------2221122--34530479833787543222-----------
Q gi|254780290|r  215 IDIILDMVGAE----Y-------LN---------------QHLTLLS--KEGKLIIISFLGGNIATEIN-----------  255 (332)
Q Consensus       215 ~Divid~~G~~----~-------~~---------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~-----------  255 (332)
                      +|+.+++.|..    .       |+               .+++.|+  .+|+++.++...+....+-.           
T Consensus        82 iDiLVNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y~asKaav~  161 (252)
T PRK06138         82 LDVLVNNAGFGCGGTVVTTDEADWDAVMRVNVGGVFLWAKYAIPIMQRQGGGSIVNTASQLALAGGRGRAAYVASKGAIA  161 (252)
T ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
T ss_conf             98999898899999801099999999999996999999999999999819967999765665778999778999999999


Q ss_pred             ------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHH-----HHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC--
Q ss_conf             ------4334305321677751240001137899999-----999999998698310212474189999999999829--
Q gi|254780290|r  256 ------LNPIISKRITITGSTLRRRTDIAKQSIRDSL-----QLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS--  322 (332)
Q Consensus       256 ------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~-----~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g--  322 (332)
                            ..++-..++++....-+...   .+.....+     ...+.+.+.+.  .| ..+.=..+|+..+.-.|.+-  
T Consensus       162 ~lTk~lA~e~a~~gIrVNaI~PG~i~---T~~~~~~~~~~~~~~~~~~~~~~~--~P-l~R~g~pedIA~~v~FL~Sd~a  235 (252)
T PRK06138        162 SLTRAMALDHATDGIRVNAVAPGTID---TPYFRRIFARHADPEALREALRAR--HP-MNRFGTAEEVAQAALFLASDES  235 (252)
T ss_pred             HHHHHHHHHHHHCCEEEEEEEECCCC---CHHHHHHHHHCCCHHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHH
T ss_conf             99999999862229199999758899---735667766138979999999717--99-8997889999999999967632


Q ss_pred             -CCCCEEEE
Q ss_conf             -98132898
Q gi|254780290|r  323 -EHIGKIIL  330 (332)
Q Consensus       323 -~~~GKvVi  330 (332)
                       -.+|-++.
T Consensus       236 s~iTG~~i~  244 (252)
T PRK06138        236 SFATGTTLV  244 (252)
T ss_pred             CCCCCCEEE
T ss_conf             593687488


No 193
>PRK12744 short chain dehydrogenase; Provisional
Probab=94.97  E-value=0.0019  Score=41.96  Aligned_cols=99  Identities=21%  Similarity=0.297  Sum_probs=58.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C-------CCCCCCCCCC---CCCCCCC----CCCCCCCC
Q ss_conf             222222113444443222221222222221112232211-1-------1112233222---2222221----11122222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC-L-------ACLKLGAKHA---INYLKED----FLEILQKE  209 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~-~-------~~~~lGa~~v---i~~~~~~----~~~~i~~~  209 (332)
                      .|+++||+||++++|...++.+...|++|+++..+.++. +       .++..|.+..   .|-++++    +.+++.+.
T Consensus         7 ~gKvalVTGgs~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~   86 (257)
T PRK12744          7 KGKVVLIAGGAKNLGGLIARDLAAQGAKAVAIHYNSAATKADAEETVAAVKAAGAKAVAFQADLTTAAAVEKLFDDAKAA   86 (257)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             99989992887589999999999879989999378743689999999999973992899976889999999999999998


Q ss_pred             CCCCCCCCCCCCCCCC----C----------------------CCCCCCCCCCCCCCEEEEE
Q ss_conf             2222111222211111----1----------------------2222211223453047983
Q gi|254780290|r  210 TQGRGIDIILDMVGAE----Y----------------------LNQHLTLLSKEGKLIIISF  245 (332)
Q Consensus       210 t~g~g~Divid~~G~~----~----------------------~~~~~~~l~~~G~iv~~G~  245 (332)
                      . | ++|+.+++.|..    .                      .+.+.+.++.+|+++.+..
T Consensus        87 ~-G-~iDilVnnAG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~~G~ii~i~s  146 (257)
T PRK12744         87 F-G-RPDIAINTVGKVLKKPIVEISEAEYDEMFAVNSKSAFFFIKEAGRHLNDNGKIVTLVT  146 (257)
T ss_pred             C-C-CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             0-9-9889997664456772333228888889888876699999999998741894999981


No 194
>PRK06114 short chain dehydrogenase; Provisional
Probab=94.96  E-value=0.0022  Score=41.48  Aligned_cols=77  Identities=18%  Similarity=0.241  Sum_probs=49.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C----CCCCCCCCCCC---CCCCCCC----CCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221-1----11112233222---2222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK-C----LACLKLGAKHA---INYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~-~----~~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g  212 (332)
                      .|+.+||+||++++|.+..+.+...|++|+.+.++.+. .    +.+++.|.+..   .|-++++    +.+++.+.. |
T Consensus        15 ~gKvalVTGa~~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~-G   93 (262)
T PRK06114         15 DGQVAFVTGAGSGIGQRIAIGLAQAGADVALFDLRTDDGLAETAEHIEAAGRRAIQIAADVTSKSDLAAAVARTEAEL-G   93 (262)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC-C
T ss_conf             999899968478999999999998799899995897469999999999659958999816899999999999999981-9


Q ss_pred             CCCCCCCCCCC
Q ss_conf             21112222111
Q gi|254780290|r  213 RGIDIILDMVG  223 (332)
Q Consensus       213 ~g~Divid~~G  223 (332)
                       ++|+.+++.|
T Consensus        94 -~iDiLVNnAG  103 (262)
T PRK06114         94 -ALTLAVNAAG  103 (262)
T ss_pred             -CCCEEEECCC
T ss_conf             -9989998998


No 195
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional
Probab=94.96  E-value=0.0019  Score=41.99  Aligned_cols=179  Identities=16%  Similarity=0.222  Sum_probs=86.1

Q ss_pred             CCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCC--CCCCCCCCC----CCCCCCCCC
Q ss_conf             2222221134444--43222221222222221112232211----11112233222--222222111----122222222
Q gi|254780290|r  145 SGQTVLIHGGSSG--IGTTAIQLASYFGATVYTTAKSEEKC----LACLKLGAKHA--INYLKEDFL----EILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~--vG~~a~qla~~~G~~vi~~~~~~~~~----~~~~~lGa~~v--i~~~~~~~~----~~i~~~t~g  212 (332)
                      .|+++||+||+|+  +|....+.....|++|+.+.++++..    ++++++|...+  .|-++++-.    +++.+..  
T Consensus         5 ~GK~alVTGaa~g~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~~~~~~~~~--   82 (254)
T PRK07533          5 AGKRGLVVGIANEQSIAWGCARAFRALGAELAVTYLNDKARPYVEPLAEELDAPLLMPLDVREPGQLEAVFARIAEEW--   82 (254)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHH--
T ss_conf             999899968889808999999999987999999828877899999999745981899916999999999999999984--


Q ss_pred             CCCCCCCCCCCC---C-----C-------C---------------CCCCCCCCCCCCCEEEEECCCCCCCC-CC------
Q ss_conf             211122221111---1-----1-------2---------------22221122345304798337875432-22------
Q gi|254780290|r  213 RGIDIILDMVGA---E-----Y-------L---------------NQHLTLLSKEGKLIIISFLGGNIATE-IN------  255 (332)
Q Consensus       213 ~g~Divid~~G~---~-----~-------~---------------~~~~~~l~~~G~iv~~G~~~~~~~~~-~~------  255 (332)
                      .++|+++++.+.   .     .       |               +...++++.+|.++.++..+.....+ ..      
T Consensus        83 G~iDilVnna~~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~m~~gG~iv~iss~~~~~~~~~~~~y~~aK  162 (254)
T PRK07533         83 GRLDFVLHSIAFAPKEDLHGRVVDCSREGFALAMDVSCHSFIRMARLAEPLMTNGGSLLTMSYYGAEKVVENYNLMGPVK  162 (254)
T ss_pred             CCCCEEEECCCCCCCHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEHHHCCCCCCCCHHHHHH
T ss_conf             99778974221266011147601499999999999985999999999888865178315673200114677731578899


Q ss_pred             ----------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---
Q ss_conf             ----------4334305321677751240001137899999999999998698310212474189999999999829---
Q gi|254780290|r  256 ----------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---  322 (332)
Q Consensus       256 ----------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---  322 (332)
                                ..++-.+++++....-+........... .. .+..+.+.+.  .| ..+.-..+|+.++.-.|.+-   
T Consensus       163 aal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~-~~-~~~~~~~~~~--~P-~~R~~~pedvA~~v~fL~Sd~a~  237 (254)
T PRK07533        163 AALESSVRYLAAELGPRGIRVHAISPGPLKTRAASGID-DF-DALLEDARER--AP-LHRLVDIDDVGAVAAFLASDAAR  237 (254)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHCCCC-CH-HHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHC
T ss_conf             99999999999983766879999865777662320688-75-9999999965--99-89998999999999999588324


Q ss_pred             CCCCEEEE
Q ss_conf             98132898
Q gi|254780290|r  323 EHIGKIIL  330 (332)
Q Consensus       323 ~~~GKvVi  330 (332)
                      ..+|-++.
T Consensus       238 ~iTG~~i~  245 (254)
T PRK07533        238 ALTGNTLY  245 (254)
T ss_pred             CCCCCEEE
T ss_conf             85588178


No 196
>PRK05599 hypothetical protein; Provisional
Probab=94.96  E-value=0.0014  Score=42.70  Aligned_cols=74  Identities=24%  Similarity=0.298  Sum_probs=45.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCC----CCCCCCCC----CCCCCCCCCCCC
Q ss_conf             222211344444322222122222222111223221111----112233222----22222211----112222222221
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA----CLKLGAKHA----INYLKEDF----LEILQKETQGRG  214 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~----~~~lGa~~v----i~~~~~~~----~~~i~~~t~g~g  214 (332)
                      .+|||+||++|+|.+....+. .|.+++.+++++++++.    +++.|...+    +|-++.+-    .+++.+..  ..
T Consensus         1 MtvlITGASsGIG~a~A~~lA-~G~~vvl~~R~~e~l~~l~~~l~~~g~~~v~~~~~Dvtd~~~~~~~v~~~~~~~--g~   77 (246)
T PRK05599          1 MSILILGGTSDIAGEIATLLA-HGEDVVLAARRPEAAGGLAEDLRQLGATSVHVLSFDATDLDSHRELVKQTQELA--GE   77 (246)
T ss_pred             CEEEEECCCHHHHHHHHHHHH-CCCCEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHC--CC
T ss_conf             989998886899999999998-599499999999999999999986259718997289999999999999999861--98


Q ss_pred             CCCCCCCCC
Q ss_conf             112222111
Q gi|254780290|r  215 IDIILDMVG  223 (332)
Q Consensus       215 ~Divid~~G  223 (332)
                      +|+++.+.|
T Consensus        78 id~lv~naG   86 (246)
T PRK05599         78 ISLAVVAFG   86 (246)
T ss_pred             CEEEEECCC
T ss_conf             439998776


No 197
>PRK12367 short chain dehydrogenase; Provisional
Probab=94.95  E-value=0.0052  Score=39.05  Aligned_cols=39  Identities=26%  Similarity=0.298  Sum_probs=34.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222221134444432222212222222211122322
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE  181 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~  181 (332)
                      ...|++|.|+||+|+.|++..+..+..|++|++.+++..
T Consensus        14 ~~kgKtIgITGAsGaLG~AL~k~f~~~GakVIalTh~~~   52 (250)
T PRK12367         14 RWNGKRIGITGASGALGKALTKLFRAKGAKVIGLTHSKI   52 (250)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             638987999678738999999999988998999836888


No 198
>PRK07453 protochlorophyllide oxidoreductase; Validated
Probab=94.92  E-value=0.0024  Score=41.21  Aligned_cols=77  Identities=27%  Similarity=0.341  Sum_probs=48.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC----CC--CCCCC----CCCCCCCCCCCCCCC
Q ss_conf             222221134444432222212222222211122322111111-22332----22--22222----211112222222221
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-KLGAK----HA--INYLK----EDFLEILQKETQGRG  214 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~lGa~----~v--i~~~~----~~~~~~i~~~t~g~g  214 (332)
                      ..||+|+||++|+|+.+++-+...|++||.++|+++|.+.+. +++..    .+  +|-.+    ..+.+++.+.  ...
T Consensus         6 ~~TvvITGansGIG~eta~~La~~ga~Vil~~R~~~k~~~a~~~i~~~~~~~~~~~lDLssl~SVr~~a~~~~~~--~~~   83 (322)
T PRK07453          6 KGTVLITGASSGVGLYAAKALAKRGWHVIMACRSLKKAEAAAQELGIPPDSYTIIHIDLGDLDSVRRFVDDFRAL--GKP   83 (322)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHH--CCC
T ss_conf             983999688868999999999978998999979999999999996188987799989889999999999999986--598


Q ss_pred             CCCCCCCCCC
Q ss_conf             1122221111
Q gi|254780290|r  215 IDIILDMVGA  224 (332)
Q Consensus       215 ~Divid~~G~  224 (332)
                      .|+.++..|.
T Consensus        84 lDiLInNAGv   93 (322)
T PRK07453         84 LDALVCNAAV   93 (322)
T ss_pred             CEEEEECCCC
T ss_conf             4089865654


No 199
>PRK08589 short chain dehydrogenase; Validated
Probab=94.92  E-value=0.0012  Score=43.20  Aligned_cols=104  Identities=23%  Similarity=0.372  Sum_probs=61.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCC---CCCCCCCC----CCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111---1223322---22222221----1112222222221
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC---LKLGAKH---AINYLKED----FLEILQKETQGRG  214 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~---~~lGa~~---vi~~~~~~----~~~~i~~~t~g~g  214 (332)
                      .|+++||+||++|+|.+.++.+...|++|+....+++..+.+   ++.|.+.   ..|-++++    +.+++.+.. | +
T Consensus         5 ~gKvalVTGas~GIG~aiA~~la~~Ga~Vv~~d~~~~~~~~~~~i~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~-G-~   82 (272)
T PRK08589          5 ENKVAVITGASTGIGQASAIALAQEGAYVLAVDIAEAVSETVDKIKSNGGKAKAYHVDISDEQQVKDFASDIKEQF-G-H   82 (272)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHH-C-C
T ss_conf             9798999782569999999999986999999838278999999999559948999960799999999999999982-9-9


Q ss_pred             CCCCCCCCCC-C---CC--------C---------------CCCCCC-CCCCCCEEEEECCCCC
Q ss_conf             1122221111-1---12--------2---------------222112-2345304798337875
Q gi|254780290|r  215 IDIILDMVGA-E---YL--------N---------------QHLTLL-SKEGKLIIISFLGGNI  250 (332)
Q Consensus       215 ~Divid~~G~-~---~~--------~---------------~~~~~l-~~~G~iv~~G~~~~~~  250 (332)
                      +|+.+++.|. .   .+        +               .+++.+ +.+|+++.++...+..
T Consensus        83 iDiLVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~p~m~~~gG~IVnisS~~g~~  146 (272)
T PRK08589         83 IDVLFNNAGVDNAAGRIHEYPVDVFDKIMAVDMRGTFLMTKMLLPLMMEQGGSIINTSSFSGQA  146 (272)
T ss_pred             CCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCC
T ss_conf             8789989866788887100999999999999829999999999999997599079991234367


No 200
>PRK08219 short chain dehydrogenase; Provisional
Probab=94.92  E-value=0.0019  Score=41.86  Aligned_cols=100  Identities=21%  Similarity=0.309  Sum_probs=59.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222113444443222221222222221112232211111-122332-22222222111122222222211122221111
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAK-HAINYLKEDFLEILQKETQGRGIDIILDMVGA  224 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~-~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~  224 (332)
                      +++||+||++|+|.+.++.+. .+.+++.++++.++.+.+ .++++. ...|.++++..+...+..  .++|+++++.|.
T Consensus         4 KvalITGas~GIG~aia~~la-~~g~vv~~~r~~~~l~~l~~~~~~~~~~~Dlt~~~~i~~~~~~~--~~iD~lVnnAG~   80 (226)
T PRK08219          4 PTALITGASRGIGAAIARALA-RTHTLLLAGRPSERLDAVAARLGATTWPADLTDPEAIAAAVEPL--DRLDVLVHNAGV   80 (226)
T ss_pred             CEEEEECCCHHHHHHHHHHHH-HCCCEEEEECCHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHC--CCCCEEEECCCC
T ss_conf             999992846499999999999-69989999898899999999709937860579999999999965--998899989968


Q ss_pred             C---CC--------C---------------CCCCCC-CCCCCCEEEEECCCC
Q ss_conf             1---12--------2---------------222112-234530479833787
Q gi|254780290|r  225 E---YL--------N---------------QHLTLL-SKEGKLIIISFLGGN  249 (332)
Q Consensus       225 ~---~~--------~---------------~~~~~l-~~~G~iv~~G~~~~~  249 (332)
                      .   .+        +               ..+..+ +.+|+++.++...+.
T Consensus        81 ~~~~~~~~~~~~~~~~~~~vNl~~~~~l~~~~lp~m~~~~G~IV~isS~~g~  132 (226)
T PRK08219         81 AELGPVAESTVDEWRATLDVNVVAPAELTRLLLPALRAARGHVVFINSGAGL  132 (226)
T ss_pred             CCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHC
T ss_conf             9998737699999999999866999999999999999739849999476764


No 201
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated
Probab=94.90  E-value=0.0019  Score=41.94  Aligned_cols=80  Identities=24%  Similarity=0.297  Sum_probs=48.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCC---CCCCCCCCC----CCCCCCCCC
Q ss_conf             222222222211344444322222122222222111223221--11111223322---222222211----112222222
Q gi|254780290|r  141 ANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK--CLACLKLGAKH---AINYLKEDF----LEILQKETQ  211 (332)
Q Consensus       141 ~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~--~~~~~~lGa~~---vi~~~~~~~----~~~i~~~t~  211 (332)
                      .++ .|+++||+||++++|...++-+...|++|+.+..++.+  .+.++..|...   ..|-++.+-    .+++.+.. 
T Consensus         6 ~~L-~gK~alITGas~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~v~~~~~~~~~~~-   83 (253)
T PRK08993          6 FSL-EGKVAVVTGCDTGLGQGMALGLAEAGCDIVGINIVEPTETIEQVTALGRRFLSLTADLRKIDGIPALLERAVAEF-   83 (253)
T ss_pred             CCC-CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH-
T ss_conf             399-999899938876899999999998799999955877499999999659957999803799999999999999984-


Q ss_pred             CCCCCCCCCCCC
Q ss_conf             221112222111
Q gi|254780290|r  212 GRGIDIILDMVG  223 (332)
Q Consensus       212 g~g~Divid~~G  223 (332)
                      | ++|+++++.|
T Consensus        84 G-~iDilVnnAG   94 (253)
T PRK08993         84 G-HIDILVNNAG   94 (253)
T ss_pred             C-CCEEEEECCC
T ss_conf             9-9729998997


No 202
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis]
Probab=94.89  E-value=0.0037  Score=40.03  Aligned_cols=103  Identities=20%  Similarity=0.267  Sum_probs=70.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1222222222222113444443222221222222--22111223221111112----23322222222211112222222
Q gi|254780290|r  138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA--TVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQ  211 (332)
Q Consensus       138 ~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~--~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~  211 (332)
                      ....++.||++|+=.|  .|-|.++..||++.|-  +|+.....+++.+.+++    +|....+.....|+.+.+-    
T Consensus        87 ~~~~gi~pg~rVlEAG--tGSG~lt~~La~~vg~~G~v~tyE~r~d~~k~A~~Nl~~~~l~d~v~~~~~Dv~~~~~----  160 (256)
T COG2519          87 VARLGISPGSRVLEAG--TGSGALTAYLARAVGPEGHVTTYEIREDFAKTARENLSEFGLGDRVTLKLGDVREGID----  160 (256)
T ss_pred             HHHCCCCCCCEEEECC--CCCHHHHHHHHHHHCCCCEEEEEEECHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCC----
T ss_conf             9870999887899815--6805999999996488845999995278999999999984245613787054000246----


Q ss_pred             CCCCCCCC-CCCCC-CCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             22111222-21111-1122222112234530479833
Q gi|254780290|r  212 GRGIDIIL-DMVGA-EYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       212 g~g~Divi-d~~G~-~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      ++.+|.+| |..-. +.++.+.+.|+++|.++++...
T Consensus       161 ~~~vDav~LDmp~PW~~le~~~~~Lkpgg~~~~y~P~  197 (256)
T COG2519         161 EEDVDAVFLDLPDPWNVLEHVSDALKPGGVVVVYSPT  197 (256)
T ss_pred             CCCCCEEEECCCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             5546779975898489999999871799679998397


No 203
>PRK12828 short chain dehydrogenase; Provisional
Probab=94.88  E-value=0.0018  Score=42.14  Aligned_cols=104  Identities=18%  Similarity=0.277  Sum_probs=63.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC---CCC-CCCCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-122---332-222222221----11122222222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKL---GAK-HAINYLKED----FLEILQKETQGRGI  215 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~l---Ga~-~vi~~~~~~----~~~~i~~~t~g~g~  215 (332)
                      .|+++||+||++|+|.+.+.-+...|++|+.+.++.++.+.. +++   +.+ ..+|-++++    +.+++.+..+  ++
T Consensus         6 ~gKvalITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~~~~~v~~~~~~~G--~i   83 (239)
T PRK12828          6 QGKVVAITGGFGGLGRATAAWLAARGARVALIGRGAAPLSQTLPGVPADALRIGGIDLVDPQAARRAVDEVNRQFG--RL   83 (239)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCC--CC
T ss_conf             9898999472548999999999987998999979877899999875178856999607999999999999999839--99


Q ss_pred             CCCCCCCCCCC-----------CC---------------CCCCCC--CCCCCCEEEEECCCCC
Q ss_conf             12222111111-----------22---------------222112--2345304798337875
Q gi|254780290|r  216 DIILDMVGAEY-----------LN---------------QHLTLL--SKEGKLIIISFLGGNI  250 (332)
Q Consensus       216 Divid~~G~~~-----------~~---------------~~~~~l--~~~G~iv~~G~~~~~~  250 (332)
                      |+++++.|...           |+               .+++.|  ..+|+++.++...+..
T Consensus        84 DilVnNAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IInisS~~~~~  146 (239)
T PRK12828         84 DALVNIAGAFVWGTIADGDADTWDRMYGVNVKTTLNASKAALPALTASGGGRIVNIGAGAALK  146 (239)
T ss_pred             CEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCC
T ss_conf             799989778999990449999999999999699999999999999876998699997778677


No 204
>PRK06346 consensus
Probab=94.84  E-value=0.0016  Score=42.38  Aligned_cols=181  Identities=16%  Similarity=0.196  Sum_probs=90.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC---CCCC---CCCCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-12---2332---222222221----111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LK---LGAK---HAINYLKED----FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~---lGa~---~vi~~~~~~----~~~~i~~~t~g~  213 (332)
                      .|++++|+||++++|...++.+...|++|+.+.+++++.+.+ .+   .|-+   ...|-++++    +.+++.+.. | 
T Consensus         4 ~gKv~lITGgs~GIG~a~a~~la~~Ga~V~i~~r~~e~~~~~~~~l~~~~~~~~~~~~Dv~~~~~v~~~i~~~~~~f-g-   81 (251)
T PRK06346          4 KGKVAIVTGAASGMGKSIAELFAKEGAKVVVADLNLERAQKVVEEITSNGGTAIAVVANVTKQEDIENMVDTAVDTY-G-   81 (251)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHC-C-
T ss_conf             99889994757889999999999879989999798999999999999639908999778898999999999999982-9-


Q ss_pred             CCCCCCCCCCC--C--C--------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC---------
Q ss_conf             11122221111--1--1--------22---------------222112--234530479833787543222---------
Q gi|254780290|r  214 GIDIILDMVGA--E--Y--------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN---------  255 (332)
Q Consensus       214 g~Divid~~G~--~--~--------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~---------  255 (332)
                      ++|+.+++.|.  .  .        |+               .+++.|  +.+|+++.++...+....+..         
T Consensus        82 ~iDiLVnNAgi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IInisS~~~~~~~~~~~~Y~asK~a  161 (251)
T PRK06346         82 TLDILVNNAGIMDNFVPVGELTDELWDKVFAVNTTGVMRATRKALPIFEEKGSGVIVNIASVGGLNGSRAGAAYTASKHA  161 (251)
T ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHHHHH
T ss_conf             99799989988999987112899999999999709999999999999998599549999456547889887589999999


Q ss_pred             --------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CC
Q ss_conf             --------4334305321677751240001137899999999999998698310212474189999999999829---98
Q gi|254780290|r  256 --------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EH  324 (332)
Q Consensus       256 --------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~  324 (332)
                              ..++-..++++....-+...-...............+....-...+   +.-..+|+..+.-.+.+.   -.
T Consensus       162 l~~ltr~lA~e~a~~gIrvN~I~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~---R~g~pediA~~v~fL~Sd~s~~i  238 (251)
T PRK06346        162 VIGLTKNTGFMYANKGIRCNAIAPGAVNTNIGTTITAPDEFGQERAMAGMGTNP---RAGQAEEIAQVALFLASDDASFV  238 (251)
T ss_pred             HHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHCCCCCHHHHHHHHHCCCCCC---CCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             999999999986241959999876889772333124789779998862488889---87689999999999957153593


Q ss_pred             CCEEEE
Q ss_conf             132898
Q gi|254780290|r  325 IGKIIL  330 (332)
Q Consensus       325 ~GKvVi  330 (332)
                      +|-++.
T Consensus       239 TG~~i~  244 (251)
T PRK06346        239 NGTVIT  244 (251)
T ss_pred             CCCEEE
T ss_conf             686288


No 205
>PRK12747 short chain dehydrogenase; Provisional
Probab=94.83  E-value=0.0035  Score=40.14  Aligned_cols=179  Identities=20%  Similarity=0.267  Sum_probs=87.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC----CCCCCCCCC-CC--CCCCC----CCCCCC----CC
Q ss_conf             222222113444443222221222222221112-2322111----111223322-22--22222----111122----22
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTA-KSEEKCL----ACLKLGAKH-AI--NYLKE----DFLEIL----QK  208 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~-~~~~~~~----~~~~lGa~~-vi--~~~~~----~~~~~i----~~  208 (332)
                      .|+++||+||++|+|.+.++.+...|++|+... +++++.+    .+++.|.+. .+  |-++.    ++.+.+    .+
T Consensus         3 ~gKvalITGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~   82 (252)
T PRK12747          3 KGKVALVTGASRGIGRAIAKRLANDGALVAIHYGNRKEEAEETVYEIQSNGGSAFSIGANLESLHGVEALYSSLDNELQK   82 (252)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHH
T ss_conf             95999994847789999999999879999996599878999999999964995799833635679999999999999998


Q ss_pred             CCCCCCCCCCCCCCCC---CC-----------------------CCCCCCCCCCCCCCEEEEECCCCCCCCCC-------
Q ss_conf             2222211122221111---11-----------------------22222112234530479833787543222-------
Q gi|254780290|r  209 ETQGRGIDIILDMVGA---EY-----------------------LNQHLTLLSKEGKLIIISFLGGNIATEIN-------  255 (332)
Q Consensus       209 ~t~g~g~Divid~~G~---~~-----------------------~~~~~~~l~~~G~iv~~G~~~~~~~~~~~-------  255 (332)
                      ..+...+|+.+++.|.   ..                       .+.+++.++.+|+++.++...+....+-.       
T Consensus        83 ~~g~~~iDiLVnnAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~g~IVnisS~~~~~~~~~~~~Y~asK  162 (252)
T PRK12747         83 RTGSTKFDILINNAGIGPGAFIEETTEQFFDRMVSVNAKAPFFIIQQALSRLRDNSRIINISSAATRISLPDFIAYSMTK  162 (252)
T ss_pred             HCCCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCHHHHHHH
T ss_conf             42899810899899999998813499999999999975689999999999997669750898511126889727789999


Q ss_pred             ----------CCHHHCCCCEEEEEEECCCH-HCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC-
Q ss_conf             ----------43343053216777512400-011378999999999999986983102124741899999999998299-
Q gi|254780290|r  256 ----------LNPIISKRITITGSTLRRRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE-  323 (332)
Q Consensus       256 ----------~~~~~~~~~~i~g~~~~~~~-~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~-  323 (332)
                                ..++-.+++++....-+... +.......+.   ...+....  ..| ..+.-..+|+.++...|.+.. 
T Consensus       163 aav~~ltr~lA~ela~~gIrVNaV~PG~i~T~~~~~~~~~~---~~~~~~~~--~~p-~~R~g~p~dvA~~v~fL~S~~a  236 (252)
T PRK12747        163 GAINTMTFTLAKQLGARGITVNAILPGFIKTDMNAELLSDP---MMKQYATT--ISA-FNRLGEVEDIADTAAFLASPDS  236 (252)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHHCCCH---HHHHHHHC--CCC-CCCCCCHHHHHHHHHHHHCCHH
T ss_conf             99999999999997333959988877759873221112789---99999864--788-7998599999999999958443


Q ss_pred             --CCCEEE
Q ss_conf             --813289
Q gi|254780290|r  324 --HIGKII  329 (332)
Q Consensus       324 --~~GKvV  329 (332)
                        .+|-++
T Consensus       237 ~~iTG~~i  244 (252)
T PRK12747        237 RWVTGQLI  244 (252)
T ss_pred             CCCCCCEE
T ss_conf             38228837


No 206
>PRK08703 short chain dehydrogenase; Provisional
Probab=94.80  E-value=0.0029  Score=40.71  Aligned_cols=78  Identities=28%  Similarity=0.443  Sum_probs=50.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCC-CC-C--CCC---CCCC---CCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111----2233-22-2--222---2221---111222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL----KLGA-KH-A--INY---LKED---FLEILQKET  210 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~----~lGa-~~-v--i~~---~~~~---~~~~i~~~t  210 (332)
                      .|+++||+||++|+|...++.+...|++|+.+.+++++.+.+.    +.+. +. .  +|-   .+.+   +...+.+..
T Consensus         5 ~gK~~lITGas~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~l~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~   84 (239)
T PRK08703          5 SDKTILVTGASQGLGEQVAKAYAAAGATVILVARHQKKLEKVYDAIVEAGHPEPFAIRFDLMSAEEKEFEQFAATIAEAT   84 (239)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             96989994886289999999999879989999798889999999999737995499998505630789999999999983


Q ss_pred             CCCCCCCCCCCCC
Q ss_conf             2221112222111
Q gi|254780290|r  211 QGRGIDIILDMVG  223 (332)
Q Consensus       211 ~g~g~Divid~~G  223 (332)
                      .| .+|+++++.|
T Consensus        85 ~G-~lD~lvnnAG   96 (239)
T PRK08703         85 QG-KLDGIVHCAG   96 (239)
T ss_pred             CC-CCCEEEECCC
T ss_conf             79-9768996665


No 207
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional
Probab=94.79  E-value=0.002  Score=41.74  Aligned_cols=79  Identities=20%  Similarity=0.236  Sum_probs=48.6

Q ss_pred             CCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCC--CCCCCC----CCCCCCCCC
Q ss_conf             22222222113444--4432222212222222211122322111----11122332222--222221----111222222
Q gi|254780290|r  143 LRSGQTVLIHGGSS--GIGTTAIQLASYFGATVYTTAKSEEKCL----ACLKLGAKHAI--NYLKED----FLEILQKET  210 (332)
Q Consensus       143 ~~~g~~vlV~ga~g--~vG~~a~qla~~~G~~vi~~~~~~~~~~----~~~~lGa~~vi--~~~~~~----~~~~i~~~t  210 (332)
                      +-.|+++||+||+|  |+|....+.+...|++|+.+.+++...+    +.+++|...++  |-++.+    +.+++.+..
T Consensus         4 ~L~GK~alITGaa~~~GIG~aiA~~La~~GA~V~i~~~~e~~~~~~~~~~~~~g~~~~~~~Dvsd~~~v~~~v~~~~~~~   83 (271)
T PRK06505          4 LMQGKRGLIMGVANDHSIAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAESLGSDLVLPCDVEDIASVDAVFEALEKKW   83 (271)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             57999799979999854999999999986999999818668899999999964981899837999999999999999983


Q ss_pred             CCCCCCCCCCCCC
Q ss_conf             2221112222111
Q gi|254780290|r  211 QGRGIDIILDMVG  223 (332)
Q Consensus       211 ~g~g~Divid~~G  223 (332)
                      +  ++|+.+++.|
T Consensus        84 G--~iDiLVnnAG   94 (271)
T PRK06505         84 G--KLDFVVHAIG   94 (271)
T ss_pred             C--CCCEEEECCC
T ss_conf             9--9878985664


No 208
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215   This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium. The B subunit is represented by IPR014214 from INTERPRO. This protein is also known as SpoVFA..
Probab=94.77  E-value=0.0056  Score=38.80  Aligned_cols=94  Identities=23%  Similarity=0.310  Sum_probs=72.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112233222222222111122222222211122221111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA  224 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~  224 (332)
                      -|.+++|.| -|-+|.......+.+|++|.+-+|+.+......++|.+ .|.  -+.+.+.+.+      +|++|||+-.
T Consensus       151 HgS~v~VlG-fGRtG~tiAr~f~aLGA~V~V~AR~~~dlARI~E~g~~-P~~--~~~L~~~v~e------~DIviNTiPa  220 (288)
T TIGR02853       151 HGSNVMVLG-FGRTGMTIARTFSALGARVSVGARSSADLARITEMGLE-PVP--LNKLEEKVAE------IDIVINTIPA  220 (288)
T ss_pred             ECCEEEEEC-CCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCC-CCC--HHHHHHHHCC------CCEEEECCCC
T ss_conf             013457884-47056899999972698057531783678999996068-827--1678876500------0247706763


Q ss_pred             CC-CCCCCCCCCCCCCCEEEEECCC
Q ss_conf             11-2222211223453047983378
Q gi|254780290|r  225 EY-LNQHLTLLSKEGKLIIISFLGG  248 (332)
Q Consensus       225 ~~-~~~~~~~l~~~G~iv~~G~~~~  248 (332)
                      -. ....++-|.++.-++.+....|
T Consensus       221 Lvlt~~~l~~lp~~AviiDLAS~PG  245 (288)
T TIGR02853       221 LVLTKDVLSKLPKHAVIIDLASKPG  245 (288)
T ss_pred             CCCCHHHHHHCCCCCEEEEECCCCC
T ss_conf             0036589952685848997327848


No 209
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA.
Probab=94.76  E-value=0.0048  Score=39.28  Aligned_cols=107  Identities=20%  Similarity=0.266  Sum_probs=66.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCC-CCC
Q ss_conf             11222222222222113444443222221222222--22111223221111112----233222222222111122-222
Q gi|254780290|r  137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA--TVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEIL-QKE  209 (332)
Q Consensus       137 l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~--~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i-~~~  209 (332)
                      +...++++||++|+=.|  .|-|.+...||++.|-  +|+.....+++.+.+++    .|.+..+.-...|..+.. .+.
T Consensus        94 I~~~ldi~PG~~VlEaG--tGSGsLT~~Laravgp~G~v~t~E~~e~r~~~A~~n~~~~g~~~~v~~~~rDv~~~gf~~~  171 (309)
T pfam08704        94 IIMMLELKPGSVVCESG--TGSGSLSHAIARTVAPTGHLYTFEFHEQRADKAREEFREHGLDSLVTVTHRDVCKSGFDTE  171 (309)
T ss_pred             HHHHHCCCCCCEEEEEC--CCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCHHCCCCCCC
T ss_conf             99980989999999836--7842999999997488865999844789999999999874987505889852001366644


Q ss_pred             CCCCCCCCC-CCCCCC-CCCCCCCCCCC-CCCCCEEEEEC
Q ss_conf             222211122-221111-11222221122-34530479833
Q gi|254780290|r  210 TQGRGIDII-LDMVGA-EYLNQHLTLLS-KEGKLIIISFL  246 (332)
Q Consensus       210 t~g~g~Div-id~~G~-~~~~~~~~~l~-~~G~iv~~G~~  246 (332)
                      .. ..+|.| +|.... ..++.+.++|+ +||+++++..+
T Consensus       172 ~~-~~~D~VfLDlp~PW~ai~~~~~~Lk~~Gg~l~~f~P~  210 (309)
T pfam08704       172 VS-NKADAVFLDLPAPWEAIPHAAKALKVEGGRLCSFSPC  210 (309)
T ss_pred             CC-CCCCEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             56-6435899758997998899998606899689999198


No 210
>PRK06701 short chain dehydrogenase; Provisional
Probab=94.72  E-value=0.0021  Score=41.59  Aligned_cols=197  Identities=18%  Similarity=0.225  Sum_probs=101.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C---
Q ss_conf             111122222223222122222233322211122222222222211344444322222122222222111223221-1---
Q gi|254780290|r  108 QGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK-C---  183 (332)
Q Consensus       108 ~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~-~---  183 (332)
                      ++..-|+|+..+            +.|.+   .++| .|+++||+||++++|....+.+...|++|+.+.++.++ .   
T Consensus        23 ~~~~~~~~~~~~------------~~~~~---~grL-~GKvalVTGgs~GIG~aiA~~la~~GA~V~i~~~~~~~~a~~~   86 (289)
T PRK06701         23 ESLMNPLPQYED------------PNYKG---SGKL-KGKVALITGGDSGIGRAVAVAFAKEGADIAIVYLDEHEDANET   86 (289)
T ss_pred             CCCCCCCCCCCC------------CCCCC---CCCC-CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH
T ss_conf             788899998899------------78866---8877-9998999682579999999999987998999828946789999


Q ss_pred             -CCCCCCCCCCCC---CCCCCC----CCCCCCCCCCCCCCCCCCCCCCC----CCC-----------------------C
Q ss_conf             -111122332222---222221----11122222222211122221111----112-----------------------2
Q gi|254780290|r  184 -LACLKLGAKHAI---NYLKED----FLEILQKETQGRGIDIILDMVGA----EYL-----------------------N  228 (332)
Q Consensus       184 -~~~~~lGa~~vi---~~~~~~----~~~~i~~~t~g~g~Divid~~G~----~~~-----------------------~  228 (332)
                       +.+++.|.+..+   |-++.+    +.+++.+..+  ++|+.+++.|.    ..+                       +
T Consensus        87 ~~~~~~~G~~~~~~~~Dv~d~~~v~~~v~~~~~~fG--~iDiLVNNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~f~~~~  164 (289)
T PRK06701         87 KQRVEKEGVKCLLIPGDVSDEQFCKDAVEETVRELG--RLDILVNNAAQQYPQQSLEDITAEQLDKTFRTNIYSYFHMTK  164 (289)
T ss_pred             HHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHC--CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             999996399089998478999999999999999859--998999888346788872449999999997452178999999


Q ss_pred             CCCCCCCCCCCCEEEEECCCCCCCCCC-----------------CCHHHCCCCEEEEEEECCCH-HCCHHHHHHHHHHHH
Q ss_conf             222112234530479833787543222-----------------43343053216777512400-011378999999999
Q gi|254780290|r  229 QHLTLLSKEGKLIIISFLGGNIATEIN-----------------LNPIISKRITITGSTLRRRT-DIAKQSIRDSLQLKI  290 (332)
Q Consensus       229 ~~~~~l~~~G~iv~~G~~~~~~~~~~~-----------------~~~~~~~~~~i~g~~~~~~~-~~~~~~~~~~~~~~~  290 (332)
                      .+++.|+.+|+++.++...+.....-.                 ..++-.+++++....-+... ........   ...+
T Consensus       165 ~~~p~m~~gg~IInisS~~~~~g~~~~~~Y~asKaav~~ltk~LA~Ela~~gIrVNaIaPG~v~T~~~~~~~~---~~~~  241 (289)
T PRK06701        165 AALPHLKPGSAIINTGSITGYEGNETLIDYSATKGAIHAFTRSLSQSLVQKGIRVNAVAPGPIWTPLIPSDFD---EEKV  241 (289)
T ss_pred             HHHHHHHCCCEEEEECCCEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCC---HHHH
T ss_conf             9999973497799950121525788407789999999999999999970339189899657887887656599---9999


Q ss_pred             HHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---CCCCEEE
Q ss_conf             99998698310212474189999999999829---9813289
Q gi|254780290|r  291 WPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---EHIGKII  329 (332)
Q Consensus       291 ~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~~~GKvV  329 (332)
                      .++...   .| ..+.-.-+|+..+.-.|.+.   -.+|-++
T Consensus       242 ~~~~~~---~P-lgR~g~peDIA~~v~fLaSd~ss~iTGq~i  279 (289)
T PRK06701        242 SQFGSD---TP-MKRPGQPEELAPAYVYLASPDSSYITGQML  279 (289)
T ss_pred             HHHHHC---CC-CCCCCCHHHHHHHHHHHHCCHHCCCCCCEE
T ss_conf             999856---99-899809999999999995741148548689


No 211
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional
Probab=94.71  E-value=0.0021  Score=41.69  Aligned_cols=178  Identities=17%  Similarity=0.210  Sum_probs=87.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCC----CCCCCCCCC---CCCCCCCC----CCCCCCCCCC
Q ss_conf             22222211344444322222122222222111-223221111----112233222---22222211----1122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTT-AKSEEKCLA----CLKLGAKHA---INYLKEDF----LEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~-~~~~~~~~~----~~~lGa~~v---i~~~~~~~----~~~i~~~t~g  212 (332)
                      .|++++|+||++++|.+.++-....|++|+.+ .+++++.+.    +++.|.+..   .|-++++-    .+++.+.. |
T Consensus         3 ~gKvalVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~-G   81 (250)
T PRK08063          3 SGKVALVTGSSRGIGKAIALRLAKEGYDIAINYARSRKAAEETANEIEQLGRKALVVKANVGDVEKIKEMFSQIDEHF-G   81 (250)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC-C
T ss_conf             949899958766999999999998899899975999899999999999549958999847999999999999999980-9


Q ss_pred             CCCCCCCCCCCCCC-----------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC---------
Q ss_conf             21112222111111-----------22---------------222112--234530479833787543222---------
Q gi|254780290|r  213 RGIDIILDMVGAEY-----------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN---------  255 (332)
Q Consensus       213 ~g~Divid~~G~~~-----------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~---------  255 (332)
                       .+|+.+++.|...           |+               .+++.+  +.+|+++.++...+....+-.         
T Consensus        82 -~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaa  160 (250)
T PRK08063         82 -RLDVFVNNAASGVLRPAMELEESHWDWTMNINAKALLFCAQEAAKLMEKNGGGKIISLSSLGSIRYLENYTTVGVSKAA  160 (250)
T ss_pred             -CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCHHHHHHHH
T ss_conf             -9889998785678899266999999999987403799999999999986389861588733105678996045878999


Q ss_pred             --------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHH-HHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC---C
Q ss_conf             --------4334305321677751240001137899999-999999998698310212474189999999999829---9
Q gi|254780290|r  256 --------LNPIISKRITITGSTLRRRTDIAKQSIRDSL-QLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS---E  323 (332)
Q Consensus       256 --------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~-~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g---~  323 (332)
                              ..++-..++++....-+... .  ....... ..+..+...+.  .| ..+.-..+|+.++...+.+.   -
T Consensus       161 l~~ltk~lA~ela~~gIrVNaI~PG~i~-T--~~~~~~~~~~~~~~~~~~~--~P-~~R~g~pedia~~v~fL~S~~s~~  234 (250)
T PRK08063        161 LEALTRYLAVELAPKGIAVNAVSGGAVD-T--DALKHFPNREELLEDAQAN--TP-AGRMVEPEDLVNAVLFLCSPKADM  234 (250)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEECCCCC-C--HHHHCCCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             9999999999972539289998608798-7--6776179849999999867--99-999869999999999993745348


Q ss_pred             CCCEEEE
Q ss_conf             8132898
Q gi|254780290|r  324 HIGKIIL  330 (332)
Q Consensus       324 ~~GKvVi  330 (332)
                      .+|-++.
T Consensus       235 iTG~~i~  241 (250)
T PRK08063        235 IRGQTII  241 (250)
T ss_pred             CCCCEEE
T ss_conf             2287088


No 212
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]
Probab=94.71  E-value=0.005  Score=39.14  Aligned_cols=102  Identities=22%  Similarity=0.217  Sum_probs=65.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222221134444432222212222-222211122322111111----22332222222221111222222222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYF-GATVYTTAKSEEKCLACL----KLGAKHAINYLKEDFLEILQKETQGR  213 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~-G~~vi~~~~~~~~~~~~~----~lGa~~vi~~~~~~~~~~i~~~t~g~  213 (332)
                      .+.++++|+.++=.|+  +.|..++++|+.. .++|++++++++..+..+    ++|++.+.- -..+.-+.+..+.   
T Consensus        28 s~L~~~~g~~l~DIGa--GtGsi~iE~a~~~p~~~v~AIe~~~~a~~~~~~N~~~fg~~n~~v-v~g~Ap~~L~~~~---  101 (187)
T COG2242          28 SKLRPRPGDRLWDIGA--GTGSITIEWALAGPSGRVIAIERDEEALELIERNAARFGVDNLEV-VEGDAPEALPDLP---  101 (187)
T ss_pred             HHHCCCCCCEEEEECC--CCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEE-EECCCHHHHCCCC---
T ss_conf             8608899998999578--866899999973988559999258889999999999849996799-9546457636999---


Q ss_pred             CCCCCCCCCCC---CCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             11122221111---1122222112234530479833
Q gi|254780290|r  214 GIDIILDMVGA---EYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       214 g~Divid~~G~---~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      .+|.+|=--|+   ..++.++..|+++|+++.-..+
T Consensus       102 ~~daiFIGGg~~i~~ile~~~~~l~~ggrlV~nait  137 (187)
T COG2242         102 SPDAIFIGGGGNIEEILEAAWERLKPGGRLVANAIT  137 (187)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHCCCCCEEEEEEEC
T ss_conf             999999879877789999999971868769998600


No 213
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed
Probab=94.67  E-value=0.0021  Score=41.68  Aligned_cols=177  Identities=20%  Similarity=0.269  Sum_probs=90.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC---CCCCCCC----CCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-12233222---2222221----111222222222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKHA---INYLKED----FLEILQKETQGRGID  216 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~v---i~~~~~~----~~~~i~~~t~g~g~D  216 (332)
                      .|+++||+||++++|...++-....|++|....++.++.+.+ +++|....   .|-++.+    +.+.+.+..  ...|
T Consensus         5 ~gK~alITG~s~GIG~aia~~~a~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~--g~iD   82 (245)
T PRK12936          5 TGRKALVTGASGGIGEEIARLLHAQGAIVGLHGTRVEKLEALAAELGERVKIFPANLSDRDEVKALGQKAEADL--EGVD   82 (245)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHC--CCCC
T ss_conf             99989992747689999999999869999998299999999999838966999913799999999999999975--9996


Q ss_pred             CCCCCCCCC----C-------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC-------------
Q ss_conf             222211111----1-------22---------------222112--234530479833787543222-------------
Q gi|254780290|r  217 IILDMVGAE----Y-------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN-------------  255 (332)
Q Consensus       217 ivid~~G~~----~-------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~-------------  255 (332)
                      +.+++.|..    .       |+               ..++.+  +..|+++.++...+....+-.             
T Consensus        83 iLINnAG~~~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~~~m~k~~~G~IInisS~a~~~~~~~~~~Y~asKaai~~l  162 (245)
T PRK12936         83 ILVNNAGITKDGLFVRMSDEDWDAVLEVNLTAVFRLTRELTHPMMRRRYGRIINITSVVGVTGNPGQANYCASKAGMIGF  162 (245)
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             99989988999981209999999999998199999999999999874885599973455356899858999999999999


Q ss_pred             ----CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---CCCEE
Q ss_conf             ----43343053216777512400011378999999999999986983102124741899999999998299---81328
Q gi|254780290|r  256 ----LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---HIGKI  328 (332)
Q Consensus       256 ----~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~~GKv  328 (332)
                          ..++-..++++....-+............    +..+.+.+.  .| ..+.-..+|+..+...+.+.+   .+|-+
T Consensus       163 trslA~ela~~gIrVN~IaPG~i~T~~~~~~~~----~~~~~~~~~--~P-l~R~g~p~dia~~v~fL~S~~a~~iTGq~  235 (245)
T PRK12936        163 SKSLAQEIATRNVTVNCVAPGFIESAMTGKLND----KQKEAIMGA--IP-MKRMGTGAEVASAVAYLASDEAAYVTGQT  235 (245)
T ss_pred             HHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCH----HHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCCCCE
T ss_conf             999999970529299999757688631000399----999999856--99-88982999999999999683434846871


Q ss_pred             EE
Q ss_conf             98
Q gi|254780290|r  329 IL  330 (332)
Q Consensus       329 Vi  330 (332)
                      +.
T Consensus       236 i~  237 (245)
T PRK12936        236 LH  237 (245)
T ss_pred             EE
T ss_conf             79


No 214
>PRK08945 short chain dehydrogenase; Provisional
Probab=94.66  E-value=0.0032  Score=40.42  Aligned_cols=78  Identities=24%  Similarity=0.390  Sum_probs=49.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCC-C-CC--CCCC--C-CC---CCCCCCCC
Q ss_conf             2222222113444443222221222222221112232211111----12233-2-22--2222--2-21---11122222
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGA-K-HA--INYL--K-ED---FLEILQKE  209 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa-~-~v--i~~~--~-~~---~~~~i~~~  209 (332)
                      -.|+++||+||++|+|...+.-+...|++|+.+.+++++.+.+    ++.|. . .+  +|-+  + ++   +.+.+.+.
T Consensus        11 L~gK~~lITGas~GIG~aiA~~la~~Ga~Vil~~r~~~~l~~~~~el~~~~~~~~~~~~~d~~~~~~~~~~~~~~~i~~~   90 (245)
T PRK08945         11 LKDRIILVTGAGDGIGREAALTYARHGATVILLGRTEEKLEAVYDEIEAAGGPQPAIIPLDLLGATEQNYQDLADTIEEQ   90 (245)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             89798999488618999999999987998999969889999999999974798448999446759999999999999998


Q ss_pred             CCCCCCCCCCCCCC
Q ss_conf             22221112222111
Q gi|254780290|r  210 TQGRGIDIILDMVG  223 (332)
Q Consensus       210 t~g~g~Divid~~G  223 (332)
                      .  .+.|+++++.|
T Consensus        91 ~--g~iD~lVnNAG  102 (245)
T PRK08945         91 F--GRLDGVLHNAG  102 (245)
T ss_pred             H--CCCCEEEECCC
T ss_conf             0--99879998887


No 215
>PRK12743 acetoin dehydrogenase; Provisional
Probab=94.64  E-value=0.0033  Score=40.36  Aligned_cols=176  Identities=14%  Similarity=0.165  Sum_probs=87.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC----CCCCCCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             222221134444432222212222222211122322-11----11112233222---2222221----111222222222
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE-KC----LACLKLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~-~~----~~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
                      ++.+||+||++|+|...+..+...|++|+.+.++.+ ..    +.+++.|.+..   .|-++++    +.+++.+..+  
T Consensus         2 ~KValITGgs~GIG~a~a~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~G--   79 (253)
T PRK12743          2 AQVAIVTASDSGIGKACALLLAQQGFDIGITWHSDEEGAKETAEEVVSHGVRAEIVHLDLSNLPEGAQAIEKLIQRLG--   79 (253)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCC--
T ss_conf             998999075889999999999987998999748997999999999994599189999048999999999999999819--


Q ss_pred             CCCCCCCCCCCCC-----------CC---------------CCCCCC---CCCCCCEEEEECCCCCCCCCC---------
Q ss_conf             1112222111111-----------22---------------222112---234530479833787543222---------
Q gi|254780290|r  214 GIDIILDMVGAEY-----------LN---------------QHLTLL---SKEGKLIIISFLGGNIATEIN---------  255 (332)
Q Consensus       214 g~Divid~~G~~~-----------~~---------------~~~~~l---~~~G~iv~~G~~~~~~~~~~~---------  255 (332)
                      ++|+.+++.|...           |+               .+++.+   ..+|+++.++...+....+-.         
T Consensus        80 ~iDilVNnAG~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~k~~~~G~IVnisS~~~~~~~~~~~~Y~asKaa  159 (253)
T PRK12743         80 RLDVLVNNAGAMTKAPFLDMAFDEWRKIFTVDVDGAFLCSQIAARHMVKQGQGGRIINITSVHEHTPLPDASAYTAAKHA  159 (253)
T ss_pred             CCCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEHHHCCCCCCCHHHHHHHHH
T ss_conf             99899989989999980029999999999998599999999999999975899638999636655788985899999999


Q ss_pred             --------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---C
Q ss_conf             --------43343053216777512400011378999999999999986983102124741899999999998299---8
Q gi|254780290|r  256 --------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---H  324 (332)
Q Consensus       256 --------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~  324 (332)
                              ..++-..++++....-+............    +..+...++  .| ..+.-..+|+..+...+.+.+   .
T Consensus       160 l~~ltk~lA~ela~~gIrVN~VaPG~i~T~~~~~~~~----~~~~~~~~~--iP-l~R~g~pedia~~v~fL~Sd~s~yi  232 (253)
T PRK12743        160 LGGLTKAMALELVEHKILVNAVAPGAIATPMNGMDDS----DVKPDAEPS--IP-LRRPGHTHEIASLVAWLCSEGASYT  232 (253)
T ss_pred             HHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCH----HHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             9999999999970219299999648898776667877----799999857--99-8998499999999999938522582


Q ss_pred             CCEEEE
Q ss_conf             132898
Q gi|254780290|r  325 IGKIIL  330 (332)
Q Consensus       325 ~GKvVi  330 (332)
                      +|-++.
T Consensus       233 TG~~i~  238 (253)
T PRK12743        233 TGQSLI  238 (253)
T ss_pred             CCCEEE
T ss_conf             586489


No 216
>PRK08936 glucose-1-dehydrogenase; Provisional
Probab=94.62  E-value=0.0034  Score=40.28  Aligned_cols=179  Identities=19%  Similarity=0.205  Sum_probs=89.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C----CCCCCCCCCCC---CCCCCCC----CCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221-1----11112233222---2222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK-C----LACLKLGAKHA---INYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~-~----~~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g  212 (332)
                      .|+.+||+||++++|.+.+.-....|++|+.+.++.++ .    +.+++.|.+..   .|-++++    +.+++.+..+ 
T Consensus         6 ~gKvalVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G-   84 (261)
T PRK08936          6 EGKVVVITGGSTGLGRAMAVRFGKEKAKVVINYRSDESEANDVAEEIKKVGGEAIAVKGDVTVESDVVNLIQSAVKEFG-   84 (261)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC-
T ss_conf             9998999684778999999999987999999728987899999999996599389998279999999999999999829-


Q ss_pred             CCCCCCCCCCCCC----C-------CC---------------CCCCCCC---CCCCCEEEEECCCCCCCCCC--------
Q ss_conf             2111222211111----1-------22---------------2221122---34530479833787543222--------
Q gi|254780290|r  213 RGIDIILDMVGAE----Y-------LN---------------QHLTLLS---KEGKLIIISFLGGNIATEIN--------  255 (332)
Q Consensus       213 ~g~Divid~~G~~----~-------~~---------------~~~~~l~---~~G~iv~~G~~~~~~~~~~~--------  255 (332)
                       ++|+.+++.|..    .       |+               .+++.+.   .+|+++.++...+....+..        
T Consensus        85 -~iDiLVNNAg~~~~~~~~~~~~e~w~~~~~iNl~~~f~~~k~~~~~m~~~~~~G~IInisS~~~~~~~~~~~~Y~asKa  163 (261)
T PRK08936         85 -TLDVMINNAGIENAVPSHEMPLEDWNKVINTNLTGAFLGSREAIKYFVEHDIKGSIINMSSVHEQIPWPLFVHYAASKG  163 (261)
T ss_pred             -CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEHHCCCCCCCCCHHHHHHH
T ss_conf             -9889998997899988133999999999999716499999999999998188614788733100578998600799999


Q ss_pred             ---------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---
Q ss_conf             ---------43343053216777512400011378999999999999986983102124741899999999998299---
Q gi|254780290|r  256 ---------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---  323 (332)
Q Consensus       256 ---------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---  323 (332)
                               ..++-.+++++....-+... . +.........+..+.+.+.  .| +.+.=.-+|+..+.-.|.+..   
T Consensus       164 av~~ltk~lA~ela~~gIrVN~I~PG~i~-T-~~~~~~~~~~~~~~~~~~~--~P-l~R~g~p~dIa~~v~FL~S~~asy  238 (261)
T PRK08936        164 GVKLMTETLAMEYAPKGIRVNNIGPGAIN-T-PINAEKFADPKQRADVESM--IP-MGYIGKPEEIAAVAAWLASSEASY  238 (261)
T ss_pred             HHHHHHHHHHHHHHHHCEEEEEEEECCCC-C-CCHHHHCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             99999999999973539599999789898-7-0121114899999999857--99-899839999999999982743268


Q ss_pred             CCCEEEE
Q ss_conf             8132898
Q gi|254780290|r  324 HIGKIIL  330 (332)
Q Consensus       324 ~~GKvVi  330 (332)
                      .+|-++.
T Consensus       239 iTG~~i~  245 (261)
T PRK08936        239 VTGITLF  245 (261)
T ss_pred             CCCCEEE
T ss_conf             3387388


No 217
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284   This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species. This enzyme is involved in type II fatty acid biosynthesis, where the individual metabolic transformations are carried out by different enzymes rather than by a single enzyme as occurs in type I fatty acid biosynthesis .   Structural studies show that the enzyme is a tetramer which forms a typical Rossman fold , . Unlike other members of the short-chain dehydrogenase/reductase superfamily, the enzyme undergoes a marked conformational change upon binding of the NADP(H)cofactor. This conformational change aligns the side chains of the catalytic triad at the active site in an active conformation and increases the affinity of the enzyme for its substrate.; GO: 0004316 3-oxoacyl-[acyl-carrier-protein] reductase activity, 0051287 NAD binding, 0006633 fatty acid biosynthetic process.
Probab=94.62  E-value=0.0028  Score=40.78  Aligned_cols=168  Identities=23%  Similarity=0.328  Sum_probs=93.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC----CCCCCCCCC---CCCCCCC-CCCCCCCCCCC-CCCCCCC
Q ss_conf             22113444443222221222222221112232-2111----111223322---2222222-11112222222-2211122
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSE-EKCL----ACLKLGAKH---AINYLKE-DFLEILQKETQ-GRGIDII  218 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~-~~~~----~~~~lGa~~---vi~~~~~-~~~~~i~~~t~-g~g~Div  218 (332)
                      +||+||+.|+|.+..+.+...|++|+.+.++. ++.+    .++++|...   ..|=++. +..+.+.+... -. +|++
T Consensus         1 AlVTGasRGIG~AIA~~LA~~Ga~V~i~y~~~e~~~~~~~~e~~~~G~~a~~~~~dvs~~~~~~~~~~~~~~~~G-iDiL   79 (238)
T TIGR01830         1 ALVTGASRGIGRAIALKLAKEGAKVIITYRTSEEGAEEVVEEIKELGVKAAGVVLDVSDREDVKALVEEAEEELG-IDIL   79 (238)
T ss_pred             CEECCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHHC-CEEE
T ss_conf             967167861679999999867995999659825788899999985697599996038888999999999999829-9089


Q ss_pred             CCCCC--CCC-----------------CCCCCCCC---------CCCCCCEEEEECCC---CCC--------------CC
Q ss_conf             22111--111-----------------22222112---------23453047983378---754--------------32
Q gi|254780290|r  219 LDMVG--AEY-----------------LNQHLTLL---------SKEGKLIIISFLGG---NIA--------------TE  253 (332)
Q Consensus       219 id~~G--~~~-----------------~~~~~~~l---------~~~G~iv~~G~~~~---~~~--------------~~  253 (332)
                      ++..|  .|.                 |.-.|+|.         ++.||++.++..-|   +..              +.
T Consensus        80 VNNAGITrD~Ll~RMk~edWd~Vi~~NL~g~F~~t~~v~~~M~K~R~GrIINisSVVG~~GN~GQaNYaASKAG~IGftK  159 (238)
T TIGR01830        80 VNNAGITRDNLLMRMKEEDWDAVINVNLKGVFNLTQAVLRPMIKQRSGRIINISSVVGLMGNAGQANYAASKAGVIGFTK  159 (238)
T ss_pred             EECCCCCCCCHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             97874134301004885568999986126687888998898875067434861002000068742678888755899999


Q ss_pred             CCCCHHHCCCCEEEEE----EECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEE-HHHHHHHHHHHHCCC---CC
Q ss_conf             2243343053216777----512400011378999999999999986983102124741-899999999998299---81
Q gi|254780290|r  254 INLNPIISKRITITGS----TLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP-LGKVAMAHDIMEKSE---HI  325 (332)
Q Consensus       254 ~~~~~~~~~~~~i~g~----~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~-l~~i~~A~~~l~~g~---~~  325 (332)
                      -...++=.|++++-..    .-..+.+.-+++.++.            -+.-.+=.+|+ -||+..+...|.|-+   .+
T Consensus       160 SlAkElasRnItVNaVAPGFI~TdMT~~L~e~~~~~------------~l~~IPLgR~G~pEeVA~~v~FLASd~AsYIT  227 (238)
T TIGR01830       160 SLAKELASRNITVNAVAPGFIETDMTDKLSEKVKKA------------MLSQIPLGRFGTPEEVANAVAFLASDEASYIT  227 (238)
T ss_pred             HHHHHCCCCCCEEEEECCCCCCCCCCHHCCHHHHHH------------HHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCC
T ss_conf             999860368705888748998970002169889999------------98527723267765699999973251247425


Q ss_pred             CEEE
Q ss_conf             3289
Q gi|254780290|r  326 GKII  329 (332)
Q Consensus       326 GKvV  329 (332)
                      |.|+
T Consensus       228 Gqv~  231 (238)
T TIGR01830       228 GQVI  231 (238)
T ss_pred             CCEE
T ss_conf             5166


No 218
>PRK06198 short chain dehydrogenase; Provisional
Probab=94.60  E-value=0.0028  Score=40.76  Aligned_cols=181  Identities=20%  Similarity=0.320  Sum_probs=88.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCC----CCCCCCCCCC---CCCCCC----CCCCCCCCCCC
Q ss_conf             2222221134444432222212222222-2111223221111----1122332222---222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLA----CLKLGAKHAI---NYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~~~~~~~----~~~lGa~~vi---~~~~~~----~~~~i~~~t~g  212 (332)
                      .|+++||+||++++|......+...|++ |+...+++++.+.    +++.|.+..+   |-++.+    +.+++.+.. |
T Consensus         5 ~gK~alVTGas~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~f-G   83 (268)
T PRK06198          5 DGKIALVTGGTQGLGAAIARLFAERGAAGLVICGRSAEKGEAKAAELEALGAKAVFVQADLAKVEDCRAVVAAADEAF-G   83 (268)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH-C
T ss_conf             998899958577899999999998799389996298889999999999549967999826899999999999999983-9


Q ss_pred             CCCCCCCCCCCCC----CC----------------------CCCCCCC-CC--CCCCEEEEECCCCCCCCCC--------
Q ss_conf             2111222211111----12----------------------2222112-23--4530479833787543222--------
Q gi|254780290|r  213 RGIDIILDMVGAE----YL----------------------NQHLTLL-SK--EGKLIIISFLGGNIATEIN--------  255 (332)
Q Consensus       213 ~g~Divid~~G~~----~~----------------------~~~~~~l-~~--~G~iv~~G~~~~~~~~~~~--------  255 (332)
                       ++|+.+++.|..    ..                      +.+++.+ +.  +|+++.++...+....+..        
T Consensus        84 -~iDiLVNnAG~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~IVnisS~~~~~~~~~~~~Y~asKa  162 (268)
T PRK06198         84 -RLDALVNAAGLTDRGTILDTSPELFDRMFAVNVRAPFFLMQEAIKLMRRRRAEGTIVNIGSMSAHGGQPFIAAYCASKG  162 (268)
T ss_pred             -CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCCCCCCCHHHHHHHH
T ss_conf             -9989998997899998265999999999998726999999999999997599927999915454568998568999999


Q ss_pred             ---------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHH---HHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC-
Q ss_conf             ---------43343053216777512400011378999999---99999998698310212474189999999999829-
Q gi|254780290|r  256 ---------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQ---LKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS-  322 (332)
Q Consensus       256 ---------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~---~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g-  322 (332)
                               ..++-..++++....-+...-...........   ....+.+.+.  .| ..+.-.-+|+.++.-.|.+- 
T Consensus       163 al~~ltkslA~e~a~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~--~P-lgR~g~peeiA~~v~FL~S~~  239 (268)
T PRK06198        163 ALATLTRNVAYALLRNRIRVNGLNIGWMASEGEDRIQREFHGAPDDWLEKAAAT--QP-FGRLVDPDEVARAVAFLLSDE  239 (268)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHHHHHCCCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCH
T ss_conf             999999999999705694999887577888426789887324879999999836--99-889769999999999996743


Q ss_pred             --CCCCEEEE
Q ss_conf             --98132898
Q gi|254780290|r  323 --EHIGKIIL  330 (332)
Q Consensus       323 --~~~GKvVi  330 (332)
                        -.+|-++.
T Consensus       240 s~~iTG~~i~  249 (268)
T PRK06198        240 SGLMTGSVID  249 (268)
T ss_pred             HCCCCCCEEE
T ss_conf             2286583789


No 219
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=94.57  E-value=0.0029  Score=40.72  Aligned_cols=78  Identities=19%  Similarity=0.301  Sum_probs=48.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCC---CCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221--111112233222---2222221----11122222222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK--CLACLKLGAKHA---INYLKED----FLEILQKETQGRGI  215 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~--~~~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g~g~  215 (332)
                      .|+++||+||++++|...++-+...|++|+.+.+++.+  .+.++.+|....   .|-++++    +.+++.+..+  .+
T Consensus         7 ~gKvalVTGas~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~g--~i   84 (251)
T PRK12481          7 NGKVAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEAPETQAQVEALGRKFHFITADLIQQKDIDSIVSQAVEVMG--HI   84 (251)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCC--CC
T ss_conf             9998999486768999999999986999999789871999999997599479999127999999999999999819--99


Q ss_pred             CCCCCCCCC
Q ss_conf             122221111
Q gi|254780290|r  216 DIILDMVGA  224 (332)
Q Consensus       216 Divid~~G~  224 (332)
                      |+.+++.|.
T Consensus        85 DilVNNAG~   93 (251)
T PRK12481         85 DILINNAGI   93 (251)
T ss_pred             CEEEECCCC
T ss_conf             899989989


No 220
>PRK05884 short chain dehydrogenase; Provisional
Probab=94.57  E-value=0.0022  Score=41.53  Aligned_cols=54  Identities=17%  Similarity=0.196  Sum_probs=40.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC-CCCCCCCC
Q ss_conf             222113444443222221222222221112232211111-1223322-22222221
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKH-AINYLKED  201 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~-vi~~~~~~  201 (332)
                      +|||+||++++|.+..+-....|++|+.+.+++++.+.+ +++.++. ++|..+.+
T Consensus         2 ~VlVTGgs~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~el~~~~~~~d~~d~~   57 (223)
T PRK05884          2 EVLVTGGDTDLGRTIAEGFRNDGHKVTLVGARRDDLEVAAKELDVDAIVCDNTDPA   57 (223)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEECCCHH
T ss_conf             39998788799999999999879999999598789999985348768998527889


No 221
>TIGR00507 aroE shikimate 5-dehydrogenase; InterPro: IPR011342   The shikimate pathway links the metabolism of carbohydrates to the biosynthesis of aromatic compounds and is essential for the biosynthesis of aromatic amino acids and other aromatic compounds in bacteria, eukaryotic microorganisms and plants . It is a seven-step pathway which converts phosphoenolpyruvate and erythrose 4-phosphate to chorismate, the common precursor for the synthesis of folic acid, ubiquinone, vitamins E and K, and aromatic amino acids. Since this pathway is absent in metazoans, which must therefore obtain the essential amino acids phenylalanine and tryptophan from their diet, the enzymes in this pathway are important targets for the development of novel herbicides and antimicrobial compounds.   This entry represents shikimate 5-dehydrogenases from prokaryotes and functionally equivalent C-terminal domains from larger, multifunctional proteins, the majority of which have an N-terminal quinate dehydrogenase domain. These multifunctional proteins occur in plants, chlamydiae, planctomycetes and a limited number of marine proteobacteria. Shikimate 5-dehydrogenase catalyses the fourth step of the shikimate pathway, which is the NADP-dependent reduction of 3-dehydroshikimate to shikimate .   Structural studies suggests that some shikimate dehydrogenases are monmers while others form homodimers , . Each shikimate dehydrogenase monomer forms a compact two-domain alpha/beta sandwich with a deep interdomain cleft. The N-terminal substrate-binding domain forms a three layer alpha-beta-alpha sandwich, while the C-terminal NADP-binding domain forms a nearly typical Rossman fold. The active site is thought to be located within the interdomain cleft, with substrate binding causing a conformational change which closes the active site cleft, forming a productive active site.; GO: 0004764 shikimate 5-dehydrogenase activity, 0050661 NADP binding.
Probab=94.57  E-value=0.0031  Score=40.54  Aligned_cols=124  Identities=19%  Similarity=0.214  Sum_probs=68.7

Q ss_pred             CCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11111122-22222322212222223332221112-22222222222113444443222221222222221112232211
Q gi|254780290|r  106 SHQGHTLP-IPKGYNAIQAASLPESFFTVWANLFQ-TANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC  183 (332)
Q Consensus       106 ~~~~~~~~-iP~~~s~~~aa~l~~~~~tA~~~l~~-~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~  183 (332)
                      ..+-|.++ +-++    +....=.-+.-.+.+|.+ ...+++++++||+||.|+-=-.++.|++.-+++|+.+=|+.+|.
T Consensus        83 ~gAVNTl~~le~g----~l~GyNTDG~G~~~~L~~~l~~l~~~~~~li~GAGGAa~a~a~~L~~~t~~~~~i~NRT~~ka  158 (286)
T TIGR00507        83 IGAVNTLKKLEDG----KLVGYNTDGIGLVSSLEQELSKLKPNQRVLIIGAGGAAKAVALELLKATDCNVIIANRTVEKA  158 (286)
T ss_pred             HCCCCCCEEEECC----EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             1124510243177----688861760457888888740368997799994286789999999860099789982877899


Q ss_pred             CCC----CC-----CCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCC------CCCCCCCCCCCCCCEEE
Q ss_conf             111----12-----23322222222211112222222221--112222111111------22222112234530479
Q gi|254780290|r  184 LAC----LK-----LGAKHAINYLKEDFLEILQKETQGRG--IDIILDMVGAEY------LNQHLTLLSKEGKLIII  243 (332)
Q Consensus       184 ~~~----~~-----lGa~~vi~~~~~~~~~~i~~~t~g~g--~Divid~~G~~~------~~~~~~~l~~~G~iv~~  243 (332)
                      +.|    ++     +|....+.-          +......  ||+||+|+....      .......++.+-.++.+
T Consensus       159 ~~La~~~~~kln~~~G~~~~~~~----------~~~~l~~G~~DlIINATs~G~~~~~~~~~v~~~~~~~~~~v~D~  225 (286)
T TIGR00507       159 EELAERFQRKLNKKYGEIQAFSL----------DEVPLHKGKVDLIINATSAGMSGNIDEPPVPAELLKEGKLVYDL  225 (286)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEC----------CCCCCCCCCEEEEEECCCCCCCCCCCCCCCCHHHCCCCCEEEEC
T ss_conf             99999989885342485365211----------33555578567998546778888988745685341688689951


No 222
>PRK07831 short chain dehydrogenase; Provisional
Probab=94.55  E-value=0.0029  Score=40.66  Aligned_cols=79  Identities=19%  Similarity=0.321  Sum_probs=50.9

Q ss_pred             CCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCCC----CCCCCCC----CCCCCCCC
Q ss_conf             222222211344-444322222122222222111223221111-----112233222----2222221----11122222
Q gi|254780290|r  144 RSGQTVLIHGGS-SGIGTTAIQLASYFGATVYTTAKSEEKCLA-----CLKLGAKHA----INYLKED----FLEILQKE  209 (332)
Q Consensus       144 ~~g~~vlV~ga~-g~vG~~a~qla~~~G~~vi~~~~~~~~~~~-----~~~lGa~~v----i~~~~~~----~~~~i~~~  209 (332)
                      -.|+++||+||+ .|+|.+.++-+...|++|+.+.+++++...     ..+.|...+    .|-++++    +.+++.+.
T Consensus        14 L~gKvalVTGgsg~GIG~a~a~~la~~Ga~V~i~d~~~~~~~e~~~~~~~~~g~~~v~~~~~Dvt~~~~v~~~v~~~~~~   93 (261)
T PRK07831         14 LAGKVVVVTAAAGTGIGSATARRALEEGADVVISDIHERRLGETADELAAELGLGRVEGVVCDVTSEAQVDALIDAAVER   93 (261)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             69984999499964789999999998799899980877778999999998438772899975689999999999999998


Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             222211122221111
Q gi|254780290|r  210 TQGRGIDIILDMVGA  224 (332)
Q Consensus       210 t~g~g~Divid~~G~  224 (332)
                      .+  ++|+.+++.|.
T Consensus        94 ~G--~iDiLVNNAG~  106 (261)
T PRK07831         94 LG--RLDVLVNNAGL  106 (261)
T ss_pred             HC--CCCEEEECCCC
T ss_conf             29--98699988866


No 223
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional
Probab=94.52  E-value=0.0025  Score=41.12  Aligned_cols=102  Identities=25%  Similarity=0.337  Sum_probs=58.6

Q ss_pred             CCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCC--CCCCCC----CCCCCCCCCCC
Q ss_conf             222222113444--443222221222222221112232211----111122332222--222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSS--GIGTTAIQLASYFGATVYTTAKSEEKC----LACLKLGAKHAI--NYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g--~vG~~a~qla~~~G~~vi~~~~~~~~~----~~~~~lGa~~vi--~~~~~~----~~~~i~~~t~g  212 (332)
                      +|+++||+||+|  ++|....+-+...|++|+.+.+++...    ++.+++|...++  |-++++    +.+++.+..  
T Consensus         4 ~GK~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvs~~~~v~~~~~~i~~~~--   81 (274)
T PRK08415          4 KGKKGLIVGVANNKSIAYGIAKACFEQGAELAFTYLNDALKKRVEPIAQELGSPYVYELDVSKEEHFKSLAESIKKDL--   81 (274)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHH--
T ss_conf             998799989999837999999999986999999848878999999999862997699902899999999999999985--


Q ss_pred             CCCCCCCCCCCCC---------------CCC---------------CCCCCCCCCCCCEEEEECCC
Q ss_conf             2111222211111---------------122---------------22211223453047983378
Q gi|254780290|r  213 RGIDIILDMVGAE---------------YLN---------------QHLTLLSKEGKLIIISFLGG  248 (332)
Q Consensus       213 ~g~Divid~~G~~---------------~~~---------------~~~~~l~~~G~iv~~G~~~~  248 (332)
                      .++|+++++.|..               .|+               ...+.++.+|.++.++...+
T Consensus        82 G~iDilVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~~~~~m~~~GsIi~iss~~~  147 (274)
T PRK08415         82 GEIDFIVHSVAFAPKEALEGSFLETSKEAFDIAMEISVYSLIELTRALLPLLNDGGSVLTLSYLGG  147 (274)
T ss_pred             CCCCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             898888533555764334687333899999999999999999999999987430798764220246


No 224
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=94.51  E-value=0.0029  Score=40.68  Aligned_cols=79  Identities=23%  Similarity=0.355  Sum_probs=47.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C-CC---CCCCCCCCCCC---CCCCCCCCCCCCCCC--CCCC
Q ss_conf             2222221134444432222212222222211122322-1-11---11122332222---222221111222222--2221
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE-K-CL---ACLKLGAKHAI---NYLKEDFLEILQKET--QGRG  214 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~-~-~~---~~~~lGa~~vi---~~~~~~~~~~i~~~t--~g~g  214 (332)
                      .|+.+||+||++|+|.+..+.+...|++|+..+.+.+ . .+   .+++.|.+..+   |-++.+-.+.+.+..  .| +
T Consensus         8 ~GKvalVTGas~GIGraiA~~lA~~GA~Vvi~d~~~~~~~~~~~~ei~~~G~~~~~~~~Dvsd~~~v~~lv~~~~~~G-~   86 (303)
T PRK07792          8 SGKVAVVTGAAAGLGRAEALGLARLGATVVVNDIASALDASDVLDEIRAAGAKAVAVAGDISQRATADELVATADGLG-G   86 (303)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC-C
T ss_conf             999899928866899999999998699999971897247999999998449938999667689999999999999839-9


Q ss_pred             CCCCCCCCCC
Q ss_conf             1122221111
Q gi|254780290|r  215 IDIILDMVGA  224 (332)
Q Consensus       215 ~Divid~~G~  224 (332)
                      +|+++++.|.
T Consensus        87 iDiLVNNAGi   96 (303)
T PRK07792         87 LDIVVNNAGI   96 (303)
T ss_pred             CCEEEECCCC
T ss_conf             9699988855


No 225
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=94.36  E-value=0.0029  Score=40.73  Aligned_cols=78  Identities=22%  Similarity=0.313  Sum_probs=48.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC-CCCCCCCCCCC---CCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322-11-11112233222---2222221----11122222222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE-KC-LACLKLGAKHA---INYLKED----FLEILQKETQGRGI  215 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~-~~-~~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g~g~  215 (332)
                      .|+++||+||++++|...++-+...|++|+.+.++.+ .. ++.+++|.+..   .|-++++    +.+++.+. .|++.
T Consensus         5 ~gK~alVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~-~G~~i   83 (254)
T PRK08642          5 SEQIVLVTGGSRGLGAAIARAFAREGARVVVNYHRSEDAAEALADELGDRAIAIQADVTDRNQVDAMFATATEH-FGKPI   83 (254)
T ss_pred             CCCEEEEECHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHH-HCCCC
T ss_conf             98999997811199999999999879999996189889999999981994699980699999999999999999-49977


Q ss_pred             CCCCCCCC
Q ss_conf             12222111
Q gi|254780290|r  216 DIILDMVG  223 (332)
Q Consensus       216 Divid~~G  223 (332)
                      |+++++.+
T Consensus        84 dilVnnA~   91 (254)
T PRK08642         84 TTVVNNAL   91 (254)
T ss_pred             EEEEECCE
T ss_conf             69986764


No 226
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional
Probab=94.35  E-value=0.0029  Score=40.70  Aligned_cols=78  Identities=19%  Similarity=0.301  Sum_probs=48.5

Q ss_pred             CCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCC---CCCCCCCC----CCCCCCCCCCC
Q ss_conf             2222222113--444443222221222222221112232211--1111223322---22222221----11122222222
Q gi|254780290|r  144 RSGQTVLIHG--GSSGIGTTAIQLASYFGATVYTTAKSEEKC--LACLKLGAKH---AINYLKED----FLEILQKETQG  212 (332)
Q Consensus       144 ~~g~~vlV~g--a~g~vG~~a~qla~~~G~~vi~~~~~~~~~--~~~~~lGa~~---vi~~~~~~----~~~~i~~~t~g  212 (332)
                      -.|+++||+|  +++++|.+..+.+...|++|+.+.++.++.  +.+++++...   ..|-++++    +.+++.+..+ 
T Consensus         5 L~GK~~lVTG~~~~~GIG~a~A~~la~~GA~Vvi~~~~~~~~~~~~~~~~~~~~~~i~~Dv~~~~~v~~~~~~~~~~~G-   83 (256)
T PRK07889          5 LEGKRILVTGVITDSSIAFHIARVAQEQGAEVVLTGFRRLRLTERIAKRLPEPAPVLELDVTNEEHLASLADRVREHIG-   83 (256)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHC-
T ss_conf             4999799989988568999999999987999999838935899999986588875999428899999999999999868-


Q ss_pred             CCCCCCCCCCC
Q ss_conf             21112222111
Q gi|254780290|r  213 RGIDIILDMVG  223 (332)
Q Consensus       213 ~g~Divid~~G  223 (332)
                       ++|+++++.|
T Consensus        84 -~lD~lVnnag   93 (256)
T PRK07889         84 -GLDGVVHSIG   93 (256)
T ss_pred             -CCCEEEECCC
T ss_conf             -9787974213


No 227
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional
Probab=94.30  E-value=0.0032  Score=40.40  Aligned_cols=180  Identities=17%  Similarity=0.237  Sum_probs=86.8

Q ss_pred             CCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCC--CCCCCCCC----CCCCCCCCC
Q ss_conf             22222221134444432--222212222222211122322111----1112233222--22222211----112222222
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGT--TAIQLASYFGATVYTTAKSEEKCL----ACLKLGAKHA--INYLKEDF----LEILQKETQ  211 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~--~a~qla~~~G~~vi~~~~~~~~~~----~~~~lGa~~v--i~~~~~~~----~~~i~~~t~  211 (332)
                      -+|+++||+||++++|.  +..+++...|++|+.+.+++...+    +.++.|...+  .|-++++-    .+++.+..+
T Consensus         6 L~GK~alVTGaa~g~Gig~aia~~~~~~Ga~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvt~~~~v~~~~~~~~~~~G   85 (260)
T PRK06603          6 LQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEVLEKRVKPLAEEIGCNFVSELDVTNPKSISNLFDDIKEKWG   85 (260)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             89998999899996689999999999879999996686799999999998438376986579999999999999999869


Q ss_pred             CCCCCCCCCCCCC---C-----C-------CC---------------CCCCCCCCCCCCEEEEECCCCCCCC-CC-----
Q ss_conf             2211122221111---1-----1-------22---------------2221122345304798337875432-22-----
Q gi|254780290|r  212 GRGIDIILDMVGA---E-----Y-------LN---------------QHLTLLSKEGKLIIISFLGGNIATE-IN-----  255 (332)
Q Consensus       212 g~g~Divid~~G~---~-----~-------~~---------------~~~~~l~~~G~iv~~G~~~~~~~~~-~~-----  255 (332)
                        ++|+.++..|.   .     .       |.               .+.++++.+|.++.++...+....+ ..     
T Consensus        86 --~iDiLVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~a~~~m~~~GsIi~iss~~~~~~~p~~~~Y~as  163 (260)
T PRK06603         86 --SFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALMHDGGSIVTLTYYGAEKVIPNYNVMGVA  163 (260)
T ss_pred             --CCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             --977899644237776567751029899999999999899999999977874179730234221001347864200665


Q ss_pred             -----------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC--
Q ss_conf             -----------4334305321677751240001137899999999999998698310212474189999999999829--
Q gi|254780290|r  256 -----------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS--  322 (332)
Q Consensus       256 -----------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g--  322 (332)
                                 ..++-..++++....-+.......... .... ...+...+  ..|. .+.-..+|+..+.-.|.+.  
T Consensus       164 Kaal~~ltr~lA~ela~~gIRVNaIaPG~i~T~~~~~~-~~~~-~~~~~~~~--~~Pl-~R~g~pedia~~~~FLaSd~s  238 (260)
T PRK06603        164 KAALEASVKYLANDMGENNIRVNAISAGPIKTLASSAI-GDFS-TMLKSHAA--TAPL-KRNTTQEDVGGAAVYLFSELS  238 (260)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHC-CCHH-HHHHHHHH--CCCC-CCCCCHHHHHHHHHHHHCCHH
T ss_conf             99999999999999663480899973277656422204-6779-99999985--7998-999599999999999966822


Q ss_pred             -CCCCEEEE
Q ss_conf             -98132898
Q gi|254780290|r  323 -EHIGKIIL  330 (332)
Q Consensus       323 -~~~GKvVi  330 (332)
                       -.+|-++.
T Consensus       239 ~~iTG~~i~  247 (260)
T PRK06603        239 KGVTGEIHY  247 (260)
T ss_pred             CCCCCCEEE
T ss_conf             372587178


No 228
>pfam01596 Methyltransf_3 O-methyltransferase. Members of this family are O-methyltransferases. The family includes catechol o-methyltransferase, caffeoyl-CoA O-methyltransferase, and a family of bacterial O-methyltransferases that may be involved in antibiotic production.
Probab=94.30  E-value=0.0021  Score=41.57  Aligned_cols=102  Identities=19%  Similarity=0.218  Sum_probs=69.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222221134444432222212222--2222111223221111112----233222222222111122222222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYF--GATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQG  212 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~--G~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~g  212 (332)
                      -..++...++||=+|  +.+|..++.+|+.+  +.+++.+..++++.+.+++    .|...-|.....+..+.+.++...
T Consensus        38 ~l~~~~~ak~iLEiG--T~~GySal~lA~~l~~~g~i~tiE~~~~~~~~A~~~~~~ag~~~~I~~~~gdA~~~l~~l~~~  115 (204)
T pfam01596        38 MLVKLVGAKRTLEIG--VFTGYSLLATALALPEDGKITACDIDREAYEIGLPFIQKAGVADKIEFRVGDALKTLEQLVED  115 (204)
T ss_pred             HHHHHHCCCEEEEEE--CCCCHHHHHHHHHCCCCCEEEEEEECHHHHHHHHHHHHHCCCCCEEEEEEECHHHHHHHHHHC
T ss_conf             999975987899983--432599999998489996899998048999999999997798744799987499999999844


Q ss_pred             ---CCCCCCC-CCCC---CCCCCCCCCCCCCCCCCEE
Q ss_conf             ---2111222-2111---1112222211223453047
Q gi|254780290|r  213 ---RGIDIIL-DMVG---AEYLNQHLTLLSKEGKLII  242 (332)
Q Consensus       213 ---~g~Divi-d~~G---~~~~~~~~~~l~~~G~iv~  242 (332)
                         ..||+|| |+-=   .++++.++++|++||.++.
T Consensus       116 ~~~~~fD~vFiDadK~~Y~~y~e~~~~lL~~gGiii~  152 (204)
T pfam01596       116 KPLGEFDFAFVDADKSSYPNYYERLLELVKVGGLIAI  152 (204)
T ss_pred             CCCCCCCEEEEECCHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             7777643899818887779999999986369809999


No 229
>PRK08643 acetoin reductase; Validated
Probab=94.21  E-value=0.0029  Score=40.67  Aligned_cols=77  Identities=18%  Similarity=0.239  Sum_probs=50.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC---CCCCCCC----CCCCCCCCCCCCC
Q ss_conf             22222113444443222221222222221112232211111----12233222---2222221----1112222222221
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA---INYLKED----FLEILQKETQGRG  214 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v---i~~~~~~----~~~~i~~~t~g~g  214 (332)
                      ++.+||+||++++|...++.+...|++|+.+.+++++.+.+    ++.|.+..   .|-++++    +.+++.+..+  +
T Consensus         2 nKvalVTGg~~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~~~~~~~~~G--~   79 (256)
T PRK08643          2 SKVALVTGAGQGIGFAIAKRLVEDGFKVAIVDYNEETAKAAADKLSSDGGKAIAVKADVSNRDQVFDAVQQVVDTFG--D   79 (256)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHC--C
T ss_conf             84999957578899999999998799999996988999999999985399099998058999999999999999829--9


Q ss_pred             CCCCCCCCCC
Q ss_conf             1122221111
Q gi|254780290|r  215 IDIILDMVGA  224 (332)
Q Consensus       215 ~Divid~~G~  224 (332)
                      +|+.+++.|.
T Consensus        80 iDiLVNnAG~   89 (256)
T PRK08643         80 LNVVVNNAGL   89 (256)
T ss_pred             CCEEEECCCC
T ss_conf             8799989988


No 230
>PRK12827 short chain dehydrogenase; Provisional
Probab=94.19  E-value=0.0046  Score=39.39  Aligned_cols=177  Identities=17%  Similarity=0.194  Sum_probs=87.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC-------CCCCCCCC---CCCCCCC----CCCCCCCC
Q ss_conf             222222113444443222221222222221112232211-111-------12233222---2222221----11122222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC-LAC-------LKLGAKHA---INYLKED----FLEILQKE  209 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~-~~~-------~~lGa~~v---i~~~~~~----~~~~i~~~  209 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.++++.++. +.+       ++.|.+..   .|-++++    +.+++.+.
T Consensus         5 ~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~   84 (251)
T PRK12827          5 DSRRVLITGGSGGLGRAIAVRLAADGADVIVLDIHPMRGRAEAEAVAALIEAAGGKALGLAFDVRDFAATRAALDAGVEE   84 (251)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             99889996825589999999999879989998488853289999999999964984999990389999999999999998


Q ss_pred             CCCCCCCCCCCCCCCC---C--------CC---------------CCCC-CC--CCCCCCEEEEECCCCCCCCCC-----
Q ss_conf             2222111222211111---1--------22---------------2221-12--234530479833787543222-----
Q gi|254780290|r  210 TQGRGIDIILDMVGAE---Y--------LN---------------QHLT-LL--SKEGKLIIISFLGGNIATEIN-----  255 (332)
Q Consensus       210 t~g~g~Divid~~G~~---~--------~~---------------~~~~-~l--~~~G~iv~~G~~~~~~~~~~~-----  255 (332)
                      .+  ++|+.+++.|..   .        |+               .+++ ++  +.+|+++.++...+....+-.     
T Consensus        85 ~G--~iDiLVNnAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~~G~IInisS~~~~~~~~~~~~Y~a  162 (251)
T PRK12827         85 FG--RLDILVNNAGIATDAAFAELSIEEWDDVIDVNLDGFFNVTQAALPPMIRARRGGRIVNIASVAGVRGNRGQVNYAA  162 (251)
T ss_pred             CC--CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHH
T ss_conf             39--9979998998899999034999999999999859999999999999998389946999825333557898688999


Q ss_pred             ------------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC-
Q ss_conf             ------------4334305321677751240001137899999999999998698310212474189999999999829-
Q gi|254780290|r  256 ------------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS-  322 (332)
Q Consensus       256 ------------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g-  322 (332)
                                  ..++-..++++....-+... .  +...... .+..+.+.+.  .| ..+.-..+|+..+.-.|.+. 
T Consensus       163 sKaav~~lTr~lA~e~a~~gIrVNaV~PG~i~-T--~~~~~~~-~~~~~~~~~~--~P-l~R~g~pediA~~v~fLaSd~  235 (251)
T PRK12827        163 SKAGLIGLTKTLANELAPRGITVNAVAPGAIN-T--PMADNAA-MTGGEHALNP--VP-VQRLGEPDEVAALVAFLVSDA  235 (251)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEEECCCC-C--HHHHCCC-HHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCH
T ss_conf             99999999999999965049699999648898-7--2011038-7699999847--99-889778999999999995833


Q ss_pred             --CCCCEEEE
Q ss_conf             --98132898
Q gi|254780290|r  323 --EHIGKIIL  330 (332)
Q Consensus       323 --~~~GKvVi  330 (332)
                        -.+|-++.
T Consensus       236 s~~iTG~~i~  245 (251)
T PRK12827        236 ASYVTGQVIP  245 (251)
T ss_pred             HCCCCCCEEE
T ss_conf             2496586487


No 231
>PRK05875 short chain dehydrogenase; Provisional
Probab=94.17  E-value=0.0048  Score=39.26  Aligned_cols=79  Identities=23%  Similarity=0.318  Sum_probs=48.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC---C--CCCC----CCCCCCC-CCCCCCCCCC-C
Q ss_conf             222222113444443222221222222221112232211111-122---3--3222----2222221-1112222222-2
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKL---G--AKHA----INYLKED-FLEILQKETQ-G  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~l---G--a~~v----i~~~~~~-~~~~i~~~t~-g  212 (332)
                      .|+++||+||++|+|.+.++.+...|++|+.+.+++++.+.+ +++   +  ...+    .|-++++ +.+.+.+... -
T Consensus         6 ~gK~alVTGas~GIG~aiA~~la~~Ga~Vii~~r~~~~l~~~~~~l~~~~~~~~~v~~~~~Dvs~~~~v~~~v~~~~~~~   85 (277)
T PRK05875          6 QDRTYLVTGGGSGIGKGVAAALVAAGAAVMIVGRNPDKLAAAAEEIEALAGGAGAVRYEPADVTNEDEVARAVDAATAWH   85 (277)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             99989994887499999999999879989999798899999999999612788628999578999999999999999984


Q ss_pred             CCCCCCCCCCC
Q ss_conf             21112222111
Q gi|254780290|r  213 RGIDIILDMVG  223 (332)
Q Consensus       213 ~g~Divid~~G  223 (332)
                      ..+|+++++.|
T Consensus        86 g~iD~LVnnAg   96 (277)
T PRK05875         86 GRLHGVVHCAG   96 (277)
T ss_pred             CCCEEEEECCC
T ss_conf             99539998781


No 232
>PRK07904 short chain dehydrogenase; Provisional
Probab=94.10  E-value=0.0046  Score=39.35  Aligned_cols=79  Identities=24%  Similarity=0.337  Sum_probs=43.7

Q ss_pred             CCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC-CCC----CCCCCCCCCC--C--CCCCCC-CCCCCCCCCCCC
Q ss_conf             2222221134444432222-212222222211122322-111----1112233222--2--222221-111222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAI-QLASYFGATVYTTAKSEE-KCL----ACLKLGAKHA--I--NYLKED-FLEILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~-qla~~~G~~vi~~~~~~~-~~~----~~~~lGa~~v--i--~~~~~~-~~~~i~~~t~g~  213 (332)
                      ..++|||+||++|+|.+.+ ++++.-+++|+...++++ +.+    .+++.|...+  +  |-.+.+ ..+.+.+.....
T Consensus         7 n~KtvlITGassGIG~a~a~~~~~~g~~~v~l~~r~~~~~~~~~~~~~~~~~~~~v~~~~~D~~d~~~~~~~i~~~~~~~   86 (253)
T PRK07904          7 NPQTILLLGGTSEIGLAICERYLRNAPARVVLAALPDDPRRDAAVAQMKAAGASSVEVIDFDALDTDSHPKVIDAAFAGG   86 (253)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHCC
T ss_conf             99989993565099999999999749898999978973269999999985499718999556679899999999998549


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      .+|+.+.+.|
T Consensus        87 ~idv~i~~aG   96 (253)
T PRK07904         87 DVDVAIVAFG   96 (253)
T ss_pred             CEEEEEECCC
T ss_conf             9359996244


No 233
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This family contains both shikimate and quinate dehydrogenases. Shikimate 5-dehydrogenase catalyses the conversion of shikimate to 5-dehydroshikimate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites 3-dehydroquinate and dehydroshikimate.
Probab=94.05  E-value=0.0062  Score=38.54  Aligned_cols=72  Identities=22%  Similarity=0.321  Sum_probs=49.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC-CCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222-221112232211-1111223322--222222211112222222221112222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKC-LACLKLGAKH--AINYLKEDFLEILQKETQGRGIDIILD  220 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~-~~~~~lGa~~--vi~~~~~~~~~~i~~~t~g~g~Divid  220 (332)
                      .+.++||.|+ |.+|..+++.++..|+ +++.+.|+.+|. +++.++|...  ++++.  ++.+.+.      .+|++|.
T Consensus        11 ~~~~vlVIGa-G~~~~~~~~~L~~~g~~~i~v~nRt~~ka~~la~~~~~~~~~~~~~~--~l~~~l~------~~DivI~   81 (134)
T pfam01488        11 KGKKVLLIGA-GEMARLAAKHLLSKGAKKITIANRTLEKAKELAEEFGGEEVEALPLD--ELEELLA------EADIVIS   81 (134)
T ss_pred             CCCEEEEECC-CHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCEEEEECH--HHHHHHH------HCCEEEE
T ss_conf             4898999996-09999999999975998899954757899999998499725898513--5441363------1999999


Q ss_pred             CCCCC
Q ss_conf             11111
Q gi|254780290|r  221 MVGAE  225 (332)
Q Consensus       221 ~~G~~  225 (332)
                      +++.+
T Consensus        82 aT~s~   86 (134)
T pfam01488        82 ATSAP   86 (134)
T ss_pred             ECCCC
T ss_conf             25999


No 234
>PRK08303 short chain dehydrogenase; Provisional
Probab=94.00  E-value=0.0035  Score=40.17  Aligned_cols=77  Identities=25%  Similarity=0.416  Sum_probs=47.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----------C----CCCCCCCCCC---CCCCCCCC----CC
Q ss_conf             22222211344444322222122222222111223221----------1----1111223322---22222221----11
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK----------C----LACLKLGAKH---AINYLKED----FL  203 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~----------~----~~~~~lGa~~---vi~~~~~~----~~  203 (332)
                      .|+.+||+||++|+|.+..+-+-..|++|+.+.++.+.          .    +.+.+.|...   ..|-++++    +.
T Consensus         7 ~GKvAlVTGasrGIGraiA~~LA~~GA~V~i~~r~~~~~~~~~~~~e~l~e~a~~i~~~Gg~~~~v~~Dvsd~~~v~~~v   86 (305)
T PRK08303          7 RGKVALVAGATRGAGRGIAVELGAAGATVYVTGRSTRARRSEYDRPETIEETAELVTAAGGRGIAVQVDHLVPEQVRALV   86 (305)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHH
T ss_conf             99989990887589999999999879989998276110000012067999999999975990899975689999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCC
Q ss_conf             12222222221112222111
Q gi|254780290|r  204 EILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       204 ~~i~~~t~g~g~Divid~~G  223 (332)
                      +++.+.. | ++|+.+++.+
T Consensus        87 ~~~~~~~-G-~lDILVNNa~  104 (305)
T PRK08303         87 ERIDREQ-G-RLDILVNDIW  104 (305)
T ss_pred             HHHHHHC-C-CCCEEEECCC
T ss_conf             9999952-9-6208985586


No 235
>KOG1502 consensus
Probab=93.98  E-value=0.0073  Score=38.06  Aligned_cols=46  Identities=30%  Similarity=0.281  Sum_probs=38.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCC
Q ss_conf             222222113444443222221222222221112232211---1111223
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC---LACLKLG  190 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~---~~~~~lG  190 (332)
                      .+.+|+|+||+|=+|.-.+..+...|.+|.+|+|++++.   ++++++.
T Consensus         5 ~~~~VcVTGAsGfIgswivk~LL~rGY~V~gtVR~~~~~k~~~~L~~l~   53 (327)
T KOG1502           5 EGKKVCVTGASGFIGSWIVKLLLSRGYTVRGTVRDPEDEKKTEHLRKLE   53 (327)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHCC
T ss_conf             8727999488208999999999868998999970863056589998651


No 236
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]
Probab=93.98  E-value=0.0045  Score=39.41  Aligned_cols=11  Identities=18%  Similarity=-0.173  Sum_probs=5.6

Q ss_pred             HHHHHHCCCCC
Q ss_conf             99999869831
Q gi|254780290|r  290 IWPLLNSHVIA  300 (332)
Q Consensus       290 ~~~~i~~g~l~  300 (332)
                      ...++.+|.+.
T Consensus       339 ~a~ll~~g~~~  349 (389)
T COG1748         339 GAELLAEGEWE  349 (389)
T ss_pred             HHHHHHCCCCC
T ss_conf             99999758878


No 237
>PRK12824 acetoacetyl-CoA reductase; Provisional
Probab=93.94  E-value=0.0051  Score=39.10  Aligned_cols=176  Identities=15%  Similarity=0.155  Sum_probs=87.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCC---CCCCCC---CCCCCCCCC----CCCCCCCCCCC
Q ss_conf             222221134444432222212222222211122322111--111---223322---222222211----11222222222
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL--ACL---KLGAKH---AINYLKEDF----LEILQKETQGR  213 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~--~~~---~lGa~~---vi~~~~~~~----~~~i~~~t~g~  213 (332)
                      .+++||+||++|+|...++-+...|++|+.+.++.++..  ..+   ..+.+.   ..|-++++-    .+.+.+..  .
T Consensus         2 ~KvalITGas~GIG~a~a~~la~~G~~Vv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~d~~~~~~~v~~~~~~~--g   79 (245)
T PRK12824          2 KKIALVTGAKRGIGSAIARELLADGYRVIATYFGNYDAAKDWFEEYGFTEDQVRLKSLDVTDTEECQEALARIEEEE--G   79 (245)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC--C
T ss_conf             85999947888899999999998799899995880778999999874049938999913899999999999999974--9


Q ss_pred             CCCCCCCCCCCC----C-------CC---------------CCCCCCC--CCCCCEEEEECCCCCCCCCC----------
Q ss_conf             111222211111----1-------22---------------2221122--34530479833787543222----------
Q gi|254780290|r  214 GIDIILDMVGAE----Y-------LN---------------QHLTLLS--KEGKLIIISFLGGNIATEIN----------  255 (332)
Q Consensus       214 g~Divid~~G~~----~-------~~---------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~----------  255 (332)
                      ++|+.+++.|..    .       |+               .+++.++  .+|+++.++...+.....-.          
T Consensus        80 ~iDiLVnnAG~~~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaal  159 (245)
T PRK12824         80 PVDILVNNAGITRDSGFKRMSHQEWNDVINTNLNSVFNVTQPLFPAMCEQGYGRIINISSVNGLKGQFGQTNYSAAKAGM  159 (245)
T ss_pred             CCCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
T ss_conf             99899989888999990239999999999997341599999999999983995599974677577889968999999999


Q ss_pred             -------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---CC
Q ss_conf             -------43343053216777512400011378999999999999986983102124741899999999998299---81
Q gi|254780290|r  256 -------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---HI  325 (332)
Q Consensus       256 -------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~~  325 (332)
                             ..++-..++++....-+... ..   .......+..+.+.+..  | ..+.-..+|+.++...|.+.+   .+
T Consensus       160 ~~ltk~lA~E~a~~gIrvN~I~PG~i~-T~---~~~~~~~e~~~~~~~~~--P-l~R~g~peevA~~v~FL~Sd~a~~iT  232 (245)
T PRK12824        160 IGFTKALASEGARYGITVNCIAPGYIA-TP---MVEQAGPEVLQSIKNQI--P-MKRLGTPEEIAAAVAFLVSEAAGFIT  232 (245)
T ss_pred             HHHHHHHHHHHHHHCEEEEEEEECCCC-CC---CCHHCCHHHHHHHHHCC--C-CCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             999999999972549199999744687-82---10005999999998569--9-88987899999999999586325841


Q ss_pred             CEEEE
Q ss_conf             32898
Q gi|254780290|r  326 GKIIL  330 (332)
Q Consensus       326 GKvVi  330 (332)
                      |-++.
T Consensus       233 G~~i~  237 (245)
T PRK12824        233 GETIS  237 (245)
T ss_pred             CCEEE
T ss_conf             85379


No 238
>COG4122 Predicted O-methyltransferase [General function prediction only]
Probab=93.90  E-value=0.0048  Score=39.25  Aligned_cols=102  Identities=25%  Similarity=0.378  Sum_probs=67.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCC----CCCCCCCCCCC-CCCCCCCCCCC
Q ss_conf             122222222222211344444322222122222--222111223221111112----23322222222-21111222222
Q gi|254780290|r  138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG--ATVYTTAKSEEKCLACLK----LGAKHAINYLK-EDFLEILQKET  210 (332)
Q Consensus       138 ~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G--~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~-~~~~~~i~~~t  210 (332)
                      ...++++..+++|=+|  +++|..++.+|..+.  .+++.+..++++.+.+++    .|++..+.-.- .|..+.+.+ .
T Consensus        52 ~~L~~~~~~k~iLEiG--T~~GySal~mA~~l~~~g~l~tiE~~~e~~~~A~~n~~~ag~~~~i~~~~~gdal~~l~~-~  128 (219)
T COG4122          52 RLLARLSGPKRILEIG--TAIGYSALWMALALPDDGRLTTIERDEERAEIARENLAEAGVDDRIELLLGGDALDVLSR-L  128 (219)
T ss_pred             HHHHHHCCCCEEEEEE--CCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHH-C
T ss_conf             9999734986499963--523799999996388897699970798999999999997597652898835747999973-3


Q ss_pred             CCCCCCCCC-CCCC---CCCCCCCCCCCCCCCCCEE
Q ss_conf             222111222-2111---1112222211223453047
Q gi|254780290|r  211 QGRGIDIIL-DMVG---AEYLNQHLTLLSKEGKLII  242 (332)
Q Consensus       211 ~g~g~Divi-d~~G---~~~~~~~~~~l~~~G~iv~  242 (332)
                      ....||+|| |+-=   ...++.++++|++||.++.
T Consensus       129 ~~~~fDliFIDadK~~yp~~le~~~~lLr~GGliv~  164 (219)
T COG4122         129 LDGSFDLVFIDADKADYPEYLERALPLLRPGGLIVA  164 (219)
T ss_pred             CCCCCCEEEEECCHHHCHHHHHHHHHHHCCCCEEEE
T ss_conf             478856899837843599999999997378968998


No 239
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional
Probab=93.84  E-value=0.0041  Score=39.74  Aligned_cols=182  Identities=18%  Similarity=0.223  Sum_probs=87.7

Q ss_pred             CCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCC--CCCCCCCC----CCCCCC
Q ss_conf             222222222113444--443222221222222221112232211----111122332222--22222111----122222
Q gi|254780290|r  142 NLRSGQTVLIHGGSS--GIGTTAIQLASYFGATVYTTAKSEEKC----LACLKLGAKHAI--NYLKEDFL----EILQKE  209 (332)
Q Consensus       142 ~~~~g~~vlV~ga~g--~vG~~a~qla~~~G~~vi~~~~~~~~~----~~~~~lGa~~vi--~~~~~~~~----~~i~~~  209 (332)
                      .+-.|+++||+||+|  ++|....+.+...|++|+.+.+++...    ++.++.|...++  |-++++-.    +.+.+.
T Consensus         6 g~L~GK~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvtd~~~v~~~v~~~~~~   85 (272)
T PRK08159          6 GLMQGKRGLILGVANNRSIAWGIAKACRAAGAELAFTYQGDALKKRVEPLAAELGAFVVGHCDVTDEASIDAVFETLEKK   85 (272)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             23589999998899986899999999998699999974866899999999986498189983789999999999999998


Q ss_pred             CCCCCCCCCCCCCCCC-----------C----C---------------CCCCCCCCCCCCCEEEEECCCCCCC-CCC---
Q ss_conf             2222111222211111-----------1----2---------------2222112234530479833787543-222---
Q gi|254780290|r  210 TQGRGIDIILDMVGAE-----------Y----L---------------NQHLTLLSKEGKLIIISFLGGNIAT-EIN---  255 (332)
Q Consensus       210 t~g~g~Divid~~G~~-----------~----~---------------~~~~~~l~~~G~iv~~G~~~~~~~~-~~~---  255 (332)
                      . | ++|+++++.|..           .    |               .....+++++|.++.++..+..... ...   
T Consensus        86 ~-G-~iDiLVnnag~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~m~~ggsIv~iss~~~~~~~p~~~~y~  163 (272)
T PRK08159         86 W-G-KLDFVVHAIGFSDKDELTGRYVDTSEDNFSMTMLISVYSLTAVAQRAEKLMTDGGSILTLTYYGAEKVMPHYNVMG  163 (272)
T ss_pred             H-C-CCCEEEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCHHH
T ss_conf             6-9-9788985354466644566543288999999998886899999988765404787034787541233477520256


Q ss_pred             -------------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC-
Q ss_conf             -------------433430532167775124000113789999999999999869831021247418999999999982-
Q gi|254780290|r  256 -------------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK-  321 (332)
Q Consensus       256 -------------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~-  321 (332)
                                   ..++-.+++++....-+........... .. ....++.+..  .| ..+.-.-+|+.++.-.|.+ 
T Consensus       164 ~sKaAl~~ltr~lA~elg~~gIRVNaVaPG~i~T~~~~~~~-~~-~~~~~~~~~~--~p-l~R~g~pedvA~av~fL~Sd  238 (272)
T PRK08159        164 VAKAALEASVRYLAVDLGPKNIRVNAISAGPIKTLAASGIG-DF-RYILKWNEYN--AP-LRRTVTIEEVGDSALYLLSD  238 (272)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHCCCC-CH-HHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCC
T ss_conf             78999999999999975789989999863777771000487-78-9999868737--99-78984999999999999586


Q ss_pred             --CCCCCEEEE
Q ss_conf             --998132898
Q gi|254780290|r  322 --SEHIGKIIL  330 (332)
Q Consensus       322 --g~~~GKvVi  330 (332)
                        +-.+|-++.
T Consensus       239 ~s~~iTGq~l~  249 (272)
T PRK08159        239 LSRGVTGEVHH  249 (272)
T ss_pred             HHCCCCCCEEE
T ss_conf             21585487088


No 240
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional
Probab=93.83  E-value=0.004  Score=39.82  Aligned_cols=180  Identities=17%  Similarity=0.181  Sum_probs=86.2

Q ss_pred             CCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC----CCCCCCCCCCCC
Q ss_conf             222222211344--444322222122222222111223221111112233222----2222221----111222222222
Q gi|254780290|r  144 RSGQTVLIHGGS--SGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHA----INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       144 ~~g~~vlV~ga~--g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~v----i~~~~~~----~~~~i~~~t~g~  213 (332)
                      -.|+++||+||+  .|+|...++.+...|++|+.+.++++..+.+.++..+.+    .|-++++    +.+++.+..+  
T Consensus         5 L~gK~~lVTGaag~~GIG~a~A~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~G--   82 (252)
T PRK06079          5 LSGKKIVVMGVANKRSIAWGCAQAIKDQGATVIYTYQNDRMKKSLQKLVDEEDLLVECDVASDESIERAFAQIKERFG--   82 (252)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHC--
T ss_conf             399889998999987799999999998699999984887999999985088865999518999999999999999868--


Q ss_pred             CCCCCCCCCCCC--------CC----------------------CCCCCCCCCCCCCEEEEECCCCCCCC-CC-------
Q ss_conf             111222211111--------12----------------------22221122345304798337875432-22-------
Q gi|254780290|r  214 GIDIILDMVGAE--------YL----------------------NQHLTLLSKEGKLIIISFLGGNIATE-IN-------  255 (332)
Q Consensus       214 g~Divid~~G~~--------~~----------------------~~~~~~l~~~G~iv~~G~~~~~~~~~-~~-------  255 (332)
                      ++|+++++.|..        .+                      +.....++.+|.++.++..++....+ ..       
T Consensus        83 ~iD~lVnnag~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~g~Iv~iss~~~~~~~p~~~~y~aaKa  162 (252)
T PRK06079         83 KIDGIVHAIAYAKKEELGGNVTDTSRDGYALAQDISAYSLIAVAKYARPLLNPPASIVTLTYFGSERAIPNYNVMGIAKA  162 (252)
T ss_pred             CCCEEEEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCCHHHHHH
T ss_conf             88734433202573102464443889999999988889999999888764035770678864403455777410177899


Q ss_pred             ---------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHC---CC
Q ss_conf             ---------433430532167775124000113789999999999999869831021247418999999999982---99
Q gi|254780290|r  256 ---------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEK---SE  323 (332)
Q Consensus       256 ---------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~---g~  323 (332)
                               ..++-.+++++....-+...-.......  ...++.+...+..   ...+.-..+|+.++.-.|.+   +-
T Consensus       163 al~~ltr~lA~ela~~gIRVN~IaPG~i~T~~~~~~~--~~~~~~~~~~~~~---p~gr~~~peeia~~v~FL~Sd~a~~  237 (252)
T PRK06079        163 ALESSVRYLARDLGKKGIRVNAISAGAIKTLAVTGIK--GHGDLLKESDSRT---VDGVSVTIEEVGNVAAFLLSDLSTG  237 (252)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCC--CCHHHHHHHHHCC---CCCCCCCHHHHHHHHHHHHCCHHCC
T ss_conf             9999999999998438989999963778770101566--7899999998579---9899989999999999994854168


Q ss_pred             CCCEEEE
Q ss_conf             8132898
Q gi|254780290|r  324 HIGKIIL  330 (332)
Q Consensus       324 ~~GKvVi  330 (332)
                      .+|-++.
T Consensus       238 iTGq~i~  244 (252)
T PRK06079        238 VTGDIIY  244 (252)
T ss_pred             CCCCEEE
T ss_conf             2597289


No 241
>KOG0725 consensus
Probab=93.81  E-value=0.0048  Score=39.26  Aligned_cols=79  Identities=35%  Similarity=0.446  Sum_probs=49.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C---CCCC------CCCCCCCCCCCCC----CCCCC
Q ss_conf             2222221134444432222212222222211122322111111-2---2332------2222222211112----22222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-K---LGAK------HAINYLKEDFLEI----LQKET  210 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~---lGa~------~vi~~~~~~~~~~----i~~~t  210 (332)
                      .|..+||+|++.|+|.+.+..+...|++|+.+.+++++.+..+ +   .+..      .+.|-++++-.+.    ..+..
T Consensus         7 ~gkvalVTG~s~GIG~aia~~la~~Ga~v~i~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~l~~~~~~~~   86 (270)
T KOG0725           7 AGKVALVTGGSSGIGKAIALLLAKAGAKVVITGRSEERLEETAQELGGLGYTGGKVLAIVCDVSKEVDVEKLVEFAVEKF   86 (270)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             88789997999815899999999879989998454566677899987436777614899755576788999999999984


Q ss_pred             CCCCCCCCCCCCCC
Q ss_conf             22211122221111
Q gi|254780290|r  211 QGRGIDIILDMVGA  224 (332)
Q Consensus       211 ~g~g~Divid~~G~  224 (332)
                      .| +.|+.+++.|.
T Consensus        87 ~G-kidiLvnnag~   99 (270)
T KOG0725          87 FG-KIDILVNNAGA   99 (270)
T ss_pred             CC-CCCEEEECCCC
T ss_conf             78-88779872664


No 242
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]
Probab=93.80  E-value=0.0072  Score=38.10  Aligned_cols=105  Identities=22%  Similarity=0.320  Sum_probs=68.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1122222222222211344444322222122222-222111223221111112----23322222222211112222222
Q gi|254780290|r  137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQ  211 (332)
Q Consensus       137 l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G-~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~  211 (332)
                      +.....+++|++||=.  ++|+|-+|..+++..| ++|++++.|++-++.+++    .|... +.+-..|.. .+.  ..
T Consensus        43 ~i~~~~~~~g~~vLDv--a~GTGd~a~~~~k~~g~g~v~~~D~s~~ML~~a~~k~~~~~~~~-i~fv~~dAe-~LP--f~  116 (238)
T COG2226          43 LISLLGIKPGDKVLDV--ACGTGDMALLLAKSVGTGEVVGLDISESMLEVAREKLKKKGVQN-VEFVVGDAE-NLP--FP  116 (238)
T ss_pred             HHHHHCCCCCCEEEEE--CCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHCCCCCC-EEEEEECHH-HCC--CC
T ss_conf             9986078999879996--68731999999996588449999799999999998743247663-279970565-498--88


Q ss_pred             CCCCCCCCCCCCC-------CCCCCCCCCCCCCCCCEEEEECC
Q ss_conf             2211122221111-------11222221122345304798337
Q gi|254780290|r  212 GRGIDIILDMVGA-------EYLNQHLTLLSKEGKLIIISFLG  247 (332)
Q Consensus       212 g~g~Divid~~G~-------~~~~~~~~~l~~~G~iv~~G~~~  247 (332)
                      ...||++.-+.|-       ..++...+.|+|+|+++++-...
T Consensus       117 D~sFD~vt~~fglrnv~d~~~aL~E~~RVlKpgG~~~vle~~~  159 (238)
T COG2226         117 DNSFDAVTISFGLRNVTDIDKALKEMYRVLKPGGRLLVLEFSK  159 (238)
T ss_pred             CCCCCEEEEEEHHHCCCCHHHHHHHHHHHHCCCEEEEEEECCC
T ss_conf             8765889865123527878999999987626874999987689


No 243
>PRK09186 flagellin modification protein A; Provisional
Probab=93.74  E-value=0.0066  Score=38.34  Aligned_cols=77  Identities=19%  Similarity=0.241  Sum_probs=49.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC---CCCCCC----CCCCCCC----CCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111-12---233222----2222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LK---LGAKHA----INYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~---lGa~~v----i~~~~~~----~~~~i~~~t~g  212 (332)
                      +|++++|+||++++|...++.+...|++|+.+.++.++.+.+ ++   .+-..+    .|-++++    +.+++.+..  
T Consensus         3 ~gK~~lVTGgs~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~l~~~~~~~v~~~~~Dvt~~~~v~~~~~~~~~~~--   80 (255)
T PRK09186          3 EGKTILITGAGGLIGSALVKAILEAGGIVIAADINKEALNKLLESLGTIEKTKLTLVELDITDQESLEEFLSKSQERY--   80 (255)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH--
T ss_conf             959899979586899999999998799999996988999999999987059807999846899999999999999981--


Q ss_pred             CCCCCCCCCCC
Q ss_conf             21112222111
Q gi|254780290|r  213 RGIDIILDMVG  223 (332)
Q Consensus       213 ~g~Divid~~G  223 (332)
                      .++|+++++.+
T Consensus        81 g~id~lVnnA~   91 (255)
T PRK09186         81 GKIDGAVNCAY   91 (255)
T ss_pred             CCCCEEEECCC
T ss_conf             99778997576


No 244
>PRK07791 short chain dehydrogenase; Provisional
Probab=93.73  E-value=0.0046  Score=39.36  Aligned_cols=77  Identities=19%  Similarity=0.325  Sum_probs=46.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---------CCC----CCCCCCCCCC---CCCCCCC----CCC
Q ss_conf             2222221134444432222212222222211122322---------111----1112233222---2222221----111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE---------KCL----ACLKLGAKHA---INYLKED----FLE  204 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~---------~~~----~~~~lGa~~v---i~~~~~~----~~~  204 (332)
                      .|+++||+||++++|.+........|++|+..+...+         ..+    .+++.|.+.+   .|-++++    +.+
T Consensus         5 ~GKvalVTGas~GIG~aiA~~lA~~GA~Vvi~D~~~~~~~~~~~~~~a~~~~~ei~~~g~~~~~~~~Dvsd~~~v~~~v~   84 (285)
T PRK07791          5 DGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPASGGAAQAVVDEITAAGGEAVANGDDIADWDQAANLVD   84 (285)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHH
T ss_conf             99879992867689999999999869999998376431224456799999999999749839999689999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222221112222111
Q gi|254780290|r  205 ILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       205 ~i~~~t~g~g~Divid~~G  223 (332)
                      ++.+.. | ++|+.+++.|
T Consensus        85 ~~~~~f-G-~iDiLVNNAG  101 (285)
T PRK07791         85 AAVETF-G-GLDVLVNNAG  101 (285)
T ss_pred             HHHHHH-C-CCCEEEECCC
T ss_conf             999983-9-9869997886


No 245
>PRK11036 putative metallothionein SmtA; Provisional
Probab=93.73  E-value=0.0053  Score=38.96  Aligned_cols=93  Identities=20%  Similarity=0.274  Sum_probs=59.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---
Q ss_conf             2211344444322222122222222111223221111112----233222222222111122222222211122221---
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQGRGIDIILDM---  221 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~---  221 (332)
                      .=|.-+.||.|+++..+|+. |.+|+.++.|++-++.++.    .|...-+.+...+. +++.+.. ...||+|+..   
T Consensus        46 lrVLDvG~G~G~~a~~lA~~-Gh~Vt~~D~S~~mL~~A~~~a~~~gv~~~~~~v~~~~-q~l~~~~-~~~fDlVlcHaVL  122 (256)
T PRK11036         46 LRVLDAGGGEGQTAIKMAEL-GHQVTLCDLSAEMIQRAKQAAEAKGVSDNMQFIHCAA-QDIAQHL-ETPVDLILFHAVL  122 (256)
T ss_pred             CEEEEECCCCCHHHHHHHHC-CCEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCH-HHHHHHC-CCCCCEEEEEHHH
T ss_conf             83998379877989999977-9979986699999999999988649661279885689-9885423-6886678651367


Q ss_pred             --CC--CCCCCCCCCCCCCCCCCEEEE
Q ss_conf             --11--111222221122345304798
Q gi|254780290|r  222 --VG--AEYLNQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       222 --~G--~~~~~~~~~~l~~~G~iv~~G  244 (332)
                        +-  ...++...++++|||.+..+.
T Consensus       123 E~v~dP~~~l~~l~~~lkPGG~lSLmf  149 (256)
T PRK11036        123 EWVADPKSVLQTLWSVLRPGGALSLMF  149 (256)
T ss_pred             HHCCCHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             723789999999999758993799984


No 246
>PRK09135 pteridine reductase; Provisional
Probab=93.70  E-value=0.0047  Score=39.32  Aligned_cols=103  Identities=18%  Similarity=0.242  Sum_probs=59.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC-CCCC---CCCCC----CCCCCCC----CCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322-1111-1122---33222----2222221----1112222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE-KCLA-CLKL---GAKHA----INYLKED----FLEILQKETQ  211 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~-~~~~-~~~l---Ga~~v----i~~~~~~----~~~~i~~~t~  211 (332)
                      .|+.+||+||++++|.+.++.+...|++|+.++++.+ +.+. ..++   +...+    .|-++++    +.+++.+.. 
T Consensus         5 sgKvalVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~l~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~-   83 (249)
T PRK09135          5 SSKVALITGGARRIGAAIARTLHAAGYRVAVHYHRSAAEADALAAELNRLRPGSAAALQADLLDPDALEQLVAAAVAAF-   83 (249)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC-
T ss_conf             9988999688758999999999987998999818987999999999985059818999816999999999999999983-


Q ss_pred             CCCCCCCCCCCCCC---C--------CC---------------CCCCCC-CCCCCCEEEEECCCC
Q ss_conf             22111222211111---1--------22---------------222112-234530479833787
Q gi|254780290|r  212 GRGIDIILDMVGAE---Y--------LN---------------QHLTLL-SKEGKLIIISFLGGN  249 (332)
Q Consensus       212 g~g~Divid~~G~~---~--------~~---------------~~~~~l-~~~G~iv~~G~~~~~  249 (332)
                      | ++|+.+++.|..   .        |+               ..++.| +.+|+++.++...+.
T Consensus        84 G-~iDiLVNNAg~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~G~IInisS~~~~  147 (249)
T PRK09135         84 G-RLDALVNNASSFYPTPLGEITEAQWDDLFASNAKAPFFLSQAAAPQLRKQRGAIVNITDIHAE  147 (249)
T ss_pred             C-CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             9-998999899889999815599999999999833999999999999987478878999871227


No 247
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=93.62  E-value=0.0049  Score=39.19  Aligned_cols=107  Identities=21%  Similarity=0.352  Sum_probs=62.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCC-CCCCCCCCCCCCCCCCCC--CCCC
Q ss_conf             222222222113444443222221222222221112232211---1111223322-222222211112222222--2211
Q gi|254780290|r  142 NLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC---LACLKLGAKH-AINYLKEDFLEILQKETQ--GRGI  215 (332)
Q Consensus       142 ~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~---~~~~~lGa~~-vi~~~~~~~~~~i~~~t~--g~g~  215 (332)
                      +.-.|+.++|+||++|+|.+..+.+...|++|++++..+...   +.+.++|... .+|-++.+-.+.+.+.+.  ..++
T Consensus       203 ~pL~GKVALVTGAArGIG~AIA~~LAreGA~VVi~Di~~a~~~l~~~a~elgg~al~~DVt~~~a~~~lv~~~~~~~G~l  282 (447)
T PRK08261        203 RPLAGKVALVTGAARGIGAAIAEVLARDGAHVVCLDVPQAGDDLAAVAARLGGTALALDITAPDAPAKIAEHLAERHGGL  282 (447)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCCC
T ss_conf             88999989991725789999999999869999998271148999999987098089953689999999999999964999


Q ss_pred             CCCCCCCCC---C--------CCCCC---------------CC--CCCCCCCCEEEEECCC
Q ss_conf             122221111---1--------12222---------------21--1223453047983378
Q gi|254780290|r  216 DIILDMVGA---E--------YLNQH---------------LT--LLSKEGKLIIISFLGG  248 (332)
Q Consensus       216 Divid~~G~---~--------~~~~~---------------~~--~l~~~G~iv~~G~~~~  248 (332)
                      |+++++.|.   .        .|+..               +.  ..+.+|+++.++..++
T Consensus       283 DILVnNAGi~~~~~l~~~~~e~Wd~v~~vNl~g~~~l~qall~~m~~~~gG~IVnIsSiag  343 (447)
T PRK08261        283 DIVVHNAGITRDKTLANMDEARWDSVIAVNLLAPLRITEALLDNGALGDGGRIVCVSSISG  343 (447)
T ss_pred             CEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCEEC
T ss_conf             8999899789997711199999999999986999999999999776547957998502000


No 248
>PRK09009 C factor cell-cell signaling protein; Provisional
Probab=93.61  E-value=0.0095  Score=37.31  Aligned_cols=72  Identities=25%  Similarity=0.356  Sum_probs=38.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222113444443222221222222--221112232211111122332-2222222211112222222221112222111
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGA--TVYTTAKSEEKCLACLKLGAK-HAINYLKEDFLEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~--~vi~~~~~~~~~~~~~~lGa~-~vi~~~~~~~~~~i~~~t~g~g~Divid~~G  223 (332)
                      +|||+||++|+|++.++-+...|.  .|.++.+....  ..+.-... ..+|-++++-.+.+.+...  .+|+++++.|
T Consensus         2 nVLITGas~GIG~aia~~l~~~~~~~~v~~~~~~~~~--~~~~~~v~~~~~Dvt~~~~i~~~~~~~~--~iD~linnAG   76 (235)
T PRK09009          2 NILIVGGSGGIGKAMVKQLLETYPDATVHATYRHHKP--DFRHDNVQWHALDVTDEAEIKQLSEQFT--QLDWLINCVG   76 (235)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCCC--CCCCCCEEEEECCCCCHHHHHHHHHHHC--CCCEEEECCC
T ss_conf             7999755639999999999856998099997377654--4457983899874799999999998708--7789997675


No 249
>PRK06947 glucose-1-dehydrogenase; Provisional
Probab=93.56  E-value=0.0061  Score=38.55  Aligned_cols=77  Identities=26%  Similarity=0.400  Sum_probs=47.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC----CCCCCCCCCCC---CCCCCC----CCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111-22322111----11122332222---222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTT-AKSEEKCL----ACLKLGAKHAI---NYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~-~~~~~~~~----~~~~lGa~~vi---~~~~~~----~~~~i~~~t~g  212 (332)
                      .++.++|+||++++|...+..+...|++|+.. .++++..+    .+++.|....+   |-++++    +.+++.+.. |
T Consensus         5 ~~KvalVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~-G   83 (252)
T PRK06947          5 DRKVVLITGASRGIGRATAVLAAARGWSVGINYARDAAAAEETADAVRAAGGRACVVAGDVANEADVIAMFDAVQAAF-G   83 (252)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH-C
T ss_conf             990899938835899999999998799899980898789999999999649928999847999999999999999984-9


Q ss_pred             CCCCCCCCCCC
Q ss_conf             21112222111
Q gi|254780290|r  213 RGIDIILDMVG  223 (332)
Q Consensus       213 ~g~Divid~~G  223 (332)
                       .+|+++++.|
T Consensus        84 -~iD~lVnNAG   93 (252)
T PRK06947         84 -RLDALVNNAG   93 (252)
T ss_pred             -CCCEEEECCC
T ss_conf             -9889998764


No 250
>PRK07707 consensus
Probab=93.55  E-value=0.0065  Score=38.39  Aligned_cols=177  Identities=20%  Similarity=0.221  Sum_probs=88.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCC-CCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222113444443222221222222221112-232211111-12233222----2222221111222222222111222
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTA-KSEEKCLAC-LKLGAKHA----INYLKEDFLEILQKETQGRGIDIIL  219 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~-~~~~~~~~~-~~lGa~~v----i~~~~~~~~~~i~~~t~g~g~Divi  219 (332)
                      .+.+||+||++|+|.+.++.+...|++|+... +++++.+.+ ++++....    .|-++.+-.+.+.+... +.+|+++
T Consensus         2 ~KvalVTG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~v~~Dl~~~~~~~~~~~~~~-~~iD~lV   80 (239)
T PRK07707          2 KKYALVTGASGGIGQAISKQLAQDGYTVYLHYNNNEEKVNELQEELGEVIPVPVQADLASPDGAEKLWSQIE-HPLDAIV   80 (239)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHC-CCCCEEE
T ss_conf             989999668878999999999987998999839998999999998443660699986899999999999857-8899999


Q ss_pred             CCCCCCC-----------CC---------------CCCCCC--CCCCCCEEEEECCCCCCCCCC----------------
Q ss_conf             2111111-----------22---------------222112--234530479833787543222----------------
Q gi|254780290|r  220 DMVGAEY-----------LN---------------QHLTLL--SKEGKLIIISFLGGNIATEIN----------------  255 (332)
Q Consensus       220 d~~G~~~-----------~~---------------~~~~~l--~~~G~iv~~G~~~~~~~~~~~----------------  255 (332)
                      ++.|...           |+               ..++.+  +.+|+++.++...+....+..                
T Consensus        81 nnAG~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~~~~~p~m~~~~~G~II~isS~~~~~g~~~~~~Y~asKaav~~ltr~  160 (239)
T PRK07707         81 YNSGKSIFGLVTDVTNDELNDMVQLHVKSPYKLLSMLLPSMIQRKSGNIVAVSSIWGQIGASCEVLYSMVKGAQNSFVKA  160 (239)
T ss_pred             ECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             89999999870109999999999999899999999998999876996799973788747687516889999999999999


Q ss_pred             -CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---CCCEEEE
Q ss_conf             -43343053216777512400011378999999999999986983102124741899999999998299---8132898
Q gi|254780290|r  256 -LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---HIGKIIL  330 (332)
Q Consensus       256 -~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~~GKvVi  330 (332)
                       ..++-..++++....-+.. +..  . ...+..+..+.+.+.  .| ..+.-..+|+.++...|.+.+   .+|-++.
T Consensus       161 lA~ela~~gIrVN~I~PG~i-~T~--~-~~~~~~~~~~~~~~~--~p-lgR~g~pediA~~v~FL~S~~a~~iTG~~l~  232 (239)
T PRK07707        161 LAKELAPSGIRVNAVAPGAI-ETE--M-LNVFSEEDKEEIAEE--IP-LGRLGLPEEVAKTVSFLLSPGASYITGQIIS  232 (239)
T ss_pred             HHHHHHHHCEEEEEEEECCC-CCH--H-HHHCCHHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCCHHCCCCCCEEE
T ss_conf             99997663969999974889-872--3-331399999999856--99-9998589999999999958722475186388


No 251
>pfam01370 Epimerase NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions.
Probab=93.43  E-value=0.01  Score=37.10  Aligned_cols=72  Identities=14%  Similarity=0.176  Sum_probs=44.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2211344444322222122222222111223221111112-23322-222222211112222222221112222111
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK-LGAKH-AINYLKEDFLEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~-lGa~~-vi~~~~~~~~~~i~~~t~g~g~Divid~~G  223 (332)
                      |||+||+|-+|...++.+...|.+|+++.++......... ..... ..|..+.+   .+.+...+..+|+||.+.+
T Consensus         1 ILItGasGfiG~~l~~~L~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~dl~~~~---~~~~~~~~~~~D~VihlAa   74 (235)
T pfam01370         1 ILVTGGTGFIGSALVRRLLQEGYEVIVLGRRRRSESLNTGRIRFRFHEGDLTDPD---ALERLLAEVQPDAVIHLAA   74 (235)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCEEEEEECCCHH---HHHHHHHHCCCCEEEECCC
T ss_conf             7997289799999999999787989999899730122211467659996588999---9999985389989998977


No 252
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated
Probab=93.39  E-value=0.018  Score=35.49  Aligned_cols=100  Identities=18%  Similarity=0.216  Sum_probs=64.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222221134444432222212222-222211122322111111----22332222222221111222222222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYF-GATVYTTAKSEEKCLACL----KLGAKHAINYLKEDFLEILQKETQGR  213 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~-G~~vi~~~~~~~~~~~~~----~lGa~~vi~~~~~~~~~~i~~~t~g~  213 (332)
                      ...++++++.+.=.|+  |.|..++..|+.. +.+|+++.++++..++.+    ++|++++-- -..+..+.+.+     
T Consensus        24 skL~l~~~~vvwDIGa--GsGsvsiEaa~~~p~~~V~AvE~~~~~~~~i~~N~~~fg~~nv~~-i~g~Ap~~l~~-----   95 (186)
T PRK08287         24 SKLELHRAKHLIDVGA--GTGSVSIEAALQFPSLQVTAIERNPAALRLIKENRQRFGCGNIDI-IPGEAPITLTG-----   95 (186)
T ss_pred             HHCCCCCCCEEEEECC--CCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEE-EECCCCHHCCC-----
T ss_conf             9719999999999578--877899999997899889999379899999999899729998799-93778110357-----


Q ss_pred             CCCCCCCCC-CC---CCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             111222211-11---1122222112234530479833
Q gi|254780290|r  214 GIDIILDMV-GA---EYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       214 g~Divid~~-G~---~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      ..|.||=-- |+   +.++.++..|+++|++|.-..+
T Consensus        96 ~pD~vFIGGsgg~l~~il~~~~~~L~~gGriVinavt  132 (186)
T PRK08287         96 KADAIFMGGSGGHLTAIIDWALGHLHPGGRLVLNFIL  132 (186)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCCCEEEEEEEE
T ss_conf             8984999747898899999999757999899998260


No 253
>PRK12935 acetoacetyl-CoA reductase; Provisional
Probab=93.34  E-value=0.006  Score=38.63  Aligned_cols=102  Identities=25%  Similarity=0.361  Sum_probs=58.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC-CCCC---CCCCCC---CCCCCCC----CCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122-322111-1112---233222---2222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK-SEEKCL-ACLK---LGAKHA---INYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~-~~~~~~-~~~~---lGa~~v---i~~~~~~----~~~~i~~~t~g  212 (332)
                      .|+++||+||++|+|.+.++.+...|++|+...+ +++..+ .+++   .|.+..   .|-++++    +.+++.+.. |
T Consensus         5 ~gKvalVTG~s~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~~~~~v~~~~~~~-G   83 (247)
T PRK12935          5 NGKVAIVTGGAKGIGKAITVALAQEGAKVVINYNSSKEAAENLVNELGKEGHDVYAVQADVSKVEDANRLVEEAVNHF-G   83 (247)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC-C
T ss_conf             969899917276899999999998799899976999899999999998439958999857999999999999999983-9


Q ss_pred             CCCCCCCCCCCCC---C--------CC---------------CCCCCC--CCCCCCEEEEECCC
Q ss_conf             2111222211111---1--------22---------------222112--23453047983378
Q gi|254780290|r  213 RGIDIILDMVGAE---Y--------LN---------------QHLTLL--SKEGKLIIISFLGG  248 (332)
Q Consensus       213 ~g~Divid~~G~~---~--------~~---------------~~~~~l--~~~G~iv~~G~~~~  248 (332)
                       ++|+.+++.|..   .        |+               .+++.+  +.+|+++.++...+
T Consensus        84 -~iDiLVNNAGi~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IVnisS~~g  146 (247)
T PRK12935         84 -KVDILVNNAGITRDRTFKKLNREDWERVIDVNLSSVFNTTSAVLPYITEAEEGRIISISSIIG  146 (247)
T ss_pred             -CCCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH
T ss_conf             -998999899889999904499999999999976999999999768742279952899555464


No 254
>COG2910 Putative NADH-flavin reductase [General function prediction only]
Probab=93.32  E-value=0.015  Score=35.99  Aligned_cols=92  Identities=20%  Similarity=0.275  Sum_probs=59.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22211344444322222122222222111223221111112233--2222222221111222222222111222211111
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGA--KHAINYLKEDFLEILQKETQGRGIDIILDMVGAE  225 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa--~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~  225 (332)
                      +|.|+||+|-+|...++=|+.+|-.|++++|+++|....+..-+  ..++|...      +.+..  .|+|+||++.|..
T Consensus         2 KIaiIgAsG~~Gs~i~~EA~~RGHeVTAivRn~~K~~~~~~~~i~q~Difd~~~------~a~~l--~g~DaVIsA~~~~   73 (211)
T COG2910           2 KIAIIGASGKAGSRILKEALKRGHEVTAIVRNASKLAARQGVTILQKDIFDLTS------LASDL--AGHDAVISAFGAG   73 (211)
T ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEEECHHHCCCCCCCEEECCCCCCHHH------HHHHH--CCCCEEEEECCCC
T ss_conf             078995374567999999986798048998076766522353020002227456------67663--5876699721578


Q ss_pred             ---C-------CCCCCCCCCCC--CCCEEEEECC
Q ss_conf             ---1-------22222112234--5304798337
Q gi|254780290|r  226 ---Y-------LNQHLTLLSKE--GKLIIISFLG  247 (332)
Q Consensus       226 ---~-------~~~~~~~l~~~--G~iv~~G~~~  247 (332)
                         .       .+..+..++.-  -|+..+|..+
T Consensus        74 ~~~~~~~~~k~~~~li~~l~~agv~RllVVGGAG  107 (211)
T COG2910          74 ASDNDELHSKSIEALIEALKGAGVPRLLVVGGAG  107 (211)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             8871577888999999998615970599984742


No 255
>TIGR01289 LPOR light-dependent protochlorophyllide reductase; InterPro: IPR005979    This family contains the light-dependent, NADPH-dependent form of protochlorophyllide reductase (1.3.1.33 from EC) which catalyses the reaction  chlorophyllide A + NADP+ = protochlorophyllide + NADPH.  The enzyme belongs to the short chain alcohol dehydrogenase family. ; GO: 0016630 protochlorophyllide reductase activity, 0015995 chlorophyll biosynthetic process, 0019685 photosynthesis dark reaction, 0009507 chloroplast.
Probab=93.32  E-value=0.012  Score=36.54  Aligned_cols=46  Identities=33%  Similarity=0.343  Sum_probs=38.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC-CCCCCCC
Q ss_conf             2222211344444322222122222-22211122322111-1112233
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKCL-ACLKLGA  191 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G-~~vi~~~~~~~~~~-~~~~lGa  191 (332)
                      ..+|+|+||++|+|+.+.+-+-..| .|||..||+=+|.+ .++++|.
T Consensus         3 K~tviITGASSG~GL~~AKAL~~~G~WHV~MACR~l~Ka~~aA~~~G~   50 (321)
T TIGR01289         3 KPTVIITGASSGLGLYAAKALAETGKWHVVMACRDLLKAEKAAKSLGM   50 (321)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHCCC
T ss_conf             870788637313578999999863980899814461688999984388


No 256
>PRK12938 acetyacetyl-CoA reductase; Provisional
Probab=93.27  E-value=0.0067  Score=38.31  Aligned_cols=177  Identities=17%  Similarity=0.192  Sum_probs=87.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC----CCCCCCCCCCCC---CCCCCC----CCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112-232211----111122332222---222221----11122222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTA-KSEEKC----LACLKLGAKHAI---NYLKED----FLEILQKETQG  212 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~-~~~~~~----~~~~~lGa~~vi---~~~~~~----~~~~i~~~t~g  212 (332)
                      .++.+||+||++++|.+.++-+...|++|+..+ ++.++.    +..+++|.+...   |-++++    +.+++.+..+ 
T Consensus         2 ~~KvalVTGgs~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~i~~~~g-   80 (246)
T PRK12938          2 SQRIAYVTGGMGGIGTSICQRLHKDGFKVVAGCGPNSPRRVKWLEDQKALGFDFIASEGNVGDWDSTKAAFDKVKAEVG-   80 (246)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC-
T ss_conf             5098999185869999999999987998999479981789999999984599789996787999999999999999759-


Q ss_pred             CCCCCCCCCCCCC---CC--------C---------------CCCCCCC--CCCCCEEEEECCCCCCCCCC---------
Q ss_conf             2111222211111---12--------2---------------2221122--34530479833787543222---------
Q gi|254780290|r  213 RGIDIILDMVGAE---YL--------N---------------QHLTLLS--KEGKLIIISFLGGNIATEIN---------  255 (332)
Q Consensus       213 ~g~Divid~~G~~---~~--------~---------------~~~~~l~--~~G~iv~~G~~~~~~~~~~~---------  255 (332)
                       .+|+.+++.|..   .+        +               .+++.|+  .+|+++.++...+.....-.         
T Consensus        81 -~idiLVNNAG~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaa  159 (246)
T PRK12938         81 -EIDVLVNNAGITRDVVFRKMTREDWTAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKGQFGQTNYSTAKAG  159 (246)
T ss_pred             -CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEHHHCCCCCCCHHHHHHHHH
T ss_conf             -9989998988899988034999999999999856399999999986103288189998336646688886377999999


Q ss_pred             ---C-----CHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCC---C
Q ss_conf             ---4-----3343053216777512400011378999999999999986983102124741899999999998299---8
Q gi|254780290|r  256 ---L-----NPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE---H  324 (332)
Q Consensus       256 ---~-----~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~---~  324 (332)
                         +     .++-.+++++....-+.. +..   ..+.+..+..+.+.+.  .|. .+.-.-+|+..+...|.+.+   .
T Consensus       160 l~~ltk~lA~Ela~~gIrVN~VaPG~i-~T~---~~~~~~~~~~~~~~~~--~Pl-~R~g~p~diA~~v~fL~S~~a~yi  232 (246)
T PRK12938        160 IHGFTMSLAQEVATKGVTVNTVSPGYI-GTD---MVKAIRPDVLEKIVAT--IPV-RRLGSPEEIGSIVAWLASEESGFS  232 (246)
T ss_pred             HHHHHHHHHHHHHHHCEEEEEEEECCC-CCC---CHHHCCHHHHHHHHHC--CCC-CCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             999999999996043989999966879-870---3011299999999846--998-898499999999999948143596


Q ss_pred             CCEEEE
Q ss_conf             132898
Q gi|254780290|r  325 IGKIIL  330 (332)
Q Consensus       325 ~GKvVi  330 (332)
                      +|-++.
T Consensus       233 TG~~i~  238 (246)
T PRK12938        233 TGADFS  238 (246)
T ss_pred             CCCEEE
T ss_conf             487288


No 257
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional
Probab=93.20  E-value=0.0065  Score=38.39  Aligned_cols=78  Identities=15%  Similarity=0.219  Sum_probs=47.4

Q ss_pred             CCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCC--CCCCCCC----CCCCCCCCC
Q ss_conf             2222222113--444443222221222222221112232211----111122332222--2222211----112222222
Q gi|254780290|r  144 RSGQTVLIHG--GSSGIGTTAIQLASYFGATVYTTAKSEEKC----LACLKLGAKHAI--NYLKEDF----LEILQKETQ  211 (332)
Q Consensus       144 ~~g~~vlV~g--a~g~vG~~a~qla~~~G~~vi~~~~~~~~~----~~~~~lGa~~vi--~~~~~~~----~~~i~~~t~  211 (332)
                      -.|+++||+|  ++.++|....+-+...|++|+.+..+++..    ++++++|.+.++  |-++++-    .+++.+..+
T Consensus         4 L~GK~~lVTG~a~~~GIG~aiA~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g~~~~~~~Dv~~~~~v~~~v~~~~~~~g   83 (260)
T PRK06997          4 LAGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSDLVFPCDVADDAQIDALFASLGTRWD   83 (260)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             99988999899887289999999999859999998088066999999998629847998379999999999999999849


Q ss_pred             CCCCCCCCCCCC
Q ss_conf             221112222111
Q gi|254780290|r  212 GRGIDIILDMVG  223 (332)
Q Consensus       212 g~g~Divid~~G  223 (332)
                        +.|+++++.|
T Consensus        84 --~iD~LVnNAG   93 (260)
T PRK06997         84 --GLDGLVHSIG   93 (260)
T ss_pred             --CCCEEEECCC
T ss_conf             --9898964477


No 258
>PRK06123 short chain dehydrogenase; Provisional
Probab=93.17  E-value=0.0078  Score=37.86  Aligned_cols=76  Identities=24%  Similarity=0.380  Sum_probs=46.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC----CCCCCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             2222211344444322222122222222111223-22111----1112233222---2222221----111222222222
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKS-EEKCL----ACLKLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~-~~~~~----~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
                      ++.+||+||++++|...++.+...|++|+.+.++ ++..+    .+++.|.+..   .|-++++    +.+.+.+.. | 
T Consensus         3 nKvalITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~-G-   80 (249)
T PRK06123          3 RKVMIITGASRGIGAATALLAAERGYAVCLNYLRNRDAAEAVVQAIRRQGGEALAVAADVADEADVLRLFEAVDREL-G-   80 (249)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH-C-
T ss_conf             98899968687999999999998799899980898789999999999649909999847999999999999999982-9-


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      .+|+.+++.|
T Consensus        81 ~iDiLVnNAG   90 (249)
T PRK06123         81 RLDALVNNAG   90 (249)
T ss_pred             CCCEEEECCC
T ss_conf             9878998885


No 259
>PRK08340 glucose-1-dehydrogenase; Provisional
Probab=93.12  E-value=0.009  Score=37.46  Aligned_cols=74  Identities=26%  Similarity=0.298  Sum_probs=47.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC--CCCCCCC----CCCCCCCCCCCCCCCC
Q ss_conf             222113444443222221222222221112232211111----12233222--2222221----1112222222221112
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHA--INYLKED----FLEILQKETQGRGIDI  217 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~v--i~~~~~~----~~~~i~~~t~g~g~Di  217 (332)
                      +|||+||++|+|.+.++-+...|++|+.+.+++++.+.+    ++.|--+.  .|-++++    +.++..+..+  ++|+
T Consensus         2 nVlITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~~~~~Dv~~~~~v~~~v~~~~~~~G--~iD~   79 (259)
T PRK08340          2 NVLVTASSRGIGFNVARELLKKGARVVISSRNEENLEKALKELKELGEVYAIKADLSDKDDLKNLVKEAWELLG--GIDA   79 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHC--CCCE
T ss_conf             89997587789999999999879999999799899999999987418879999636998999999999999859--9888


Q ss_pred             CCCCCC
Q ss_conf             222111
Q gi|254780290|r  218 ILDMVG  223 (332)
Q Consensus       218 vid~~G  223 (332)
                      .+++.|
T Consensus        80 LVnNAg   85 (259)
T PRK08340         80 LVWNAG   85 (259)
T ss_pred             EEECCC
T ss_conf             998576


No 260
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=93.11  E-value=0.014  Score=36.09  Aligned_cols=19  Identities=16%  Similarity=0.158  Sum_probs=10.0

Q ss_pred             HHHHHHHHHCCCCCCEEEE
Q ss_conf             9999999982998132898
Q gi|254780290|r  312 VAMAHDIMEKSEHIGKIIL  330 (332)
Q Consensus       312 i~~A~~~l~~g~~~GKvVi  330 (332)
                      ..+|.+...+--..|-+|+
T Consensus       439 l~~AV~~A~~~a~~GdvVL  457 (487)
T PRK03369        439 MTAAVAAARGLARPGDTVL  457 (487)
T ss_pred             HHHHHHHHHHHCCCCCEEE
T ss_conf             9999999997489999899


No 261
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family.
Probab=93.08  E-value=0.01  Score=37.12  Aligned_cols=104  Identities=19%  Similarity=0.276  Sum_probs=65.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             112222222222221134444432222212222--22221112232211111122----332222222221111222222
Q gi|254780290|r  137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYF--GATVYTTAKSEEKCLACLKL----GAKHAINYLKEDFLEILQKET  210 (332)
Q Consensus       137 l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~--G~~vi~~~~~~~~~~~~~~l----Ga~~vi~~~~~~~~~~i~~~t  210 (332)
                      +.+..++++|++||=.|  .|.|.++..+++..  ..+|++++-|++-++.+++.    |... ++....|..+ +. . 
T Consensus        39 ~v~~~~~~~g~~vLDl~--cGTG~~~~~l~~~~~~~~~v~gvD~S~~ML~~a~~k~~~~~~~~-i~~~~~da~~-lp-f-  112 (233)
T pfam01209        39 TMKCMGVKRGNKFLDVA--GGTGDWTFGLSDSAGSSGKVVGLDINENMLKEGEKKAKEEGKYN-IEFLQGNAEE-LP-F-  112 (233)
T ss_pred             HHHHCCCCCCCEEEEEC--CCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCC-CEEEEECCCC-CC-C-
T ss_conf             99861899999899825--40588999999984999749999699999999999998569998-3699821666-88-6-


Q ss_pred             CCCCCCCCCCCCCC-------CCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             22211122221111-------1122222112234530479833
Q gi|254780290|r  211 QGRGIDIILDMVGA-------EYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       211 ~g~g~Divid~~G~-------~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      ...-||+|.-+-|-       ..++...+.|+|||+++++-..
T Consensus       113 ~d~sfD~v~~~fglrn~~d~~~al~E~~RVLKPGG~l~ilefs  155 (233)
T pfam01209       113 EDDSFDIVTISFGLRNFPDYLKVLKEAFRVLKPGGRVVCLEFS  155 (233)
T ss_pred             CCCCCCHHHHHHHHHCCCCHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             6656573142101212588899999999872789789999788


No 262
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=93.05  E-value=0.007  Score=38.17  Aligned_cols=76  Identities=21%  Similarity=0.243  Sum_probs=48.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC----CCCCCCCCC---CCCCCCC----CCCCCCCCCCCC
Q ss_conf             222221134444432222212222222211122322-1111----112233222---2222221----111222222222
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE-KCLA----CLKLGAKHA---INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~-~~~~----~~~lGa~~v---i~~~~~~----~~~~i~~~t~g~  213 (332)
                      ++.+||+||++|+|.+.+.-+...|++|+.+.++.+ +.+.    +++.|.+..   .|-++.+    +.+++.+..+  
T Consensus         5 ~KValVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~fg--   82 (259)
T PRK12745          5 RPVALVTGGRRGIGLGIALALAAGGFDLAINDRPDAEKLAATQQELRALGVEVIFFPADVADLSAHEATLDAAQDAWG--   82 (259)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC--
T ss_conf             999999686789999999999987998999979866789999999984499489998468999999999999999829--


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      ++|+.+++.|
T Consensus        83 ~iDiLVNNAG   92 (259)
T PRK12745         83 RIDCLVNNAG   92 (259)
T ss_pred             CCCEEEECCC
T ss_conf             9889998475


No 263
>PRK08655 prephenate dehydrogenase; Provisional
Probab=92.94  E-value=0.015  Score=36.04  Aligned_cols=24  Identities=17%  Similarity=0.412  Sum_probs=14.3

Q ss_pred             CCCCCCEEEEEEEEEEECHHHHHH
Q ss_conf             877886289999999827878999
Q gi|254780290|r   29 PQPQKEEILIKVEAIGVNRPDVMQ   52 (332)
Q Consensus        29 P~~~~~~vlV~v~~~~in~~D~~~   52 (332)
                      |.+.++.+|+.+...=-.|...+.
T Consensus        80 P~l~~~~lL~DitSvK~~p~~aMl  103 (441)
T PRK08655         80 PHVKEGSLLMDVTSVKERPVEAMK  103 (441)
T ss_pred             CCCCCCCEEEECCCCCHHHHHHHH
T ss_conf             248999699983104177999999


No 264
>pfam01113 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihydrodipicolinate reductase (DapB) reduces the alpha,beta-unsaturated cyclic imine, dihydro-dipicolinate. This reaction is the second committed step in the biosynthesis of L-lysine and its precursor meso-diaminopimelate, which are critical for both protein and cell wall biosynthesis. The N-terminal domain of DapB binds the dinucleotide NADPH.
Probab=92.81  E-value=0.023  Score=34.79  Aligned_cols=97  Identities=20%  Similarity=0.183  Sum_probs=55.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222113444443222221222-2222211122322111111223322222222211112222222221112222111111
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASY-FGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEY  226 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~-~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~~  226 (332)
                      +|+|+|++|-+|+..++.+.. .++++++...++.+....+..|.-  ...............  -..+|+++|.+-.+.
T Consensus         2 kV~i~Ga~GrMG~~i~~~i~~~~~~~lv~~~~~~~~~~~~~d~~~~--~~~~~~~~~~~~~~~--~~~~DVvIDFS~p~~   77 (122)
T pfam01113         2 KVAVVGASGRMGRELIKAILEAPDFELVAAVDRPGSSLLGSDAGEL--AGPLGVPVTDDLEEV--LADADVLIDFTTPEA   77 (122)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCC--CCCCCCEECCCHHHH--CCCCCEEEEECCHHH
T ss_conf             8999889887899999999858996899999438961225431001--467871112447775--157888999068789


Q ss_pred             CCCCCCCCCCCCCCEEEEECCC
Q ss_conf             2222211223453047983378
Q gi|254780290|r  227 LNQHLTLLSKEGKLIIISFLGG  248 (332)
Q Consensus       227 ~~~~~~~l~~~G~iv~~G~~~~  248 (332)
                      ....++.....|.-+.+|.++-
T Consensus        78 ~~~~~~~~~~~~~~~ViGTTG~   99 (122)
T pfam01113        78 TLENLELALKHGKPLVIGTTGF   99 (122)
T ss_pred             HHHHHHHHHHCCCCEEEECCCC
T ss_conf             9999999996799889989999


No 265
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional
Probab=92.63  E-value=0.008  Score=37.81  Aligned_cols=78  Identities=21%  Similarity=0.227  Sum_probs=44.2

Q ss_pred             CCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCC--CCCCCC----CCCCCCCCCC
Q ss_conf             2222222113444--443222221222222221112232211----111122332222--222221----1112222222
Q gi|254780290|r  144 RSGQTVLIHGGSS--GIGTTAIQLASYFGATVYTTAKSEEKC----LACLKLGAKHAI--NYLKED----FLEILQKETQ  211 (332)
Q Consensus       144 ~~g~~vlV~ga~g--~vG~~a~qla~~~G~~vi~~~~~~~~~----~~~~~lGa~~vi--~~~~~~----~~~~i~~~t~  211 (332)
                      -.|+++||+||++  |+|....+-+...|++|+.+.++++..    ++..++|...++  |-++++    +.+++.+..+
T Consensus         4 L~GK~alVTGaa~~~GiG~aiA~~la~~GA~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~g   83 (262)
T PRK07984          4 LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDAMFAELGKVWP   83 (262)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             89987999899997259999999999879999998277789999999997549828998889999999999999999838


Q ss_pred             CCCCCCCCCCCC
Q ss_conf             221112222111
Q gi|254780290|r  212 GRGIDIILDMVG  223 (332)
Q Consensus       212 g~g~Divid~~G  223 (332)
                        ++|+++++.|
T Consensus        84 --~iD~lVnnag   93 (262)
T PRK07984         84 --KFDGFVHSIG   93 (262)
T ss_pred             --CCCEEEEEEC
T ss_conf             --7788999502


No 266
>KOG1201 consensus
Probab=92.61  E-value=0.014  Score=36.25  Aligned_cols=104  Identities=26%  Similarity=0.396  Sum_probs=58.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCC-C-CCCCCCCC-CC---CCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221----11111223-3-22222222-21---1112222222221
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK----CLACLKLG-A-KHAINYLK-ED---FLEILQKETQGRG  214 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~----~~~~~~lG-a-~~vi~~~~-~~---~~~~i~~~t~g~g  214 (332)
                      .|+.|||+||++|+|.+.++=...+|++++..+.+.+.    .+.+++.| + ..+.|-++ ++   ..+++++..+  .
T Consensus        37 ~g~~vLITGgg~GlGr~ialefa~rg~~~vl~Din~~~~~etv~~~~~~g~~~~y~cdis~~eei~~~a~~Vk~e~G--~  114 (300)
T KOG1201          37 SGEIVLITGGGSGLGRLIALEFAKRGAKLVLWDINKQGNEETVKEIRKIGEAKAYTCDISDREEIYRLAKKVKKEVG--D  114 (300)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHCC--C
T ss_conf             69889996898607899999999707848999556512399999998448525899558988999999999998619--9


Q ss_pred             CCCCCCCCCC----CCCCCC----------------------CCC-C-CCCCCCEEEEECCCCC
Q ss_conf             1122221111----112222----------------------211-2-2345304798337875
Q gi|254780290|r  215 IDIILDMVGA----EYLNQH----------------------LTL-L-SKEGKLIIISFLGGNI  250 (332)
Q Consensus       215 ~Divid~~G~----~~~~~~----------------------~~~-l-~~~G~iv~~G~~~~~~  250 (332)
                      +|++++..|-    +.++..                      +.. + +.+|++|+++...|..
T Consensus       115 V~ILVNNAGI~~~~~ll~~~d~ei~k~~~vN~~~~f~t~kaFLP~M~~~~~GHIV~IaS~aG~~  178 (300)
T KOG1201         115 VDILVNNAGIVTGKKLLDCSDEEIQKTFDVNTIAHFWTTKAFLPKMLENNNGHIVTIASVAGLF  178 (300)
T ss_pred             CEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEHHHHCCC
T ss_conf             5499836642448875679989999999876689999999873888745796399835533135


No 267
>PRK06924 short chain dehydrogenase; Provisional
Probab=92.54  E-value=0.019  Score=35.34  Aligned_cols=37  Identities=27%  Similarity=0.379  Sum_probs=31.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222113444443222221222222221112232211
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC  183 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~  183 (332)
                      +++||+||++|+|.+.++.+...|++|+.+++++++.
T Consensus         2 K~alITGas~GIG~aiA~~la~~G~~V~~~~r~~~~~   38 (251)
T PRK06924          2 RYVIITGTSKGLGEAIATQLLEKGTSVISISRRENKE   38 (251)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHH
T ss_conf             9999929874999999999998799999997982278


No 268
>pfam08659 KR KR domain. This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
Probab=92.48  E-value=0.0085  Score=37.60  Aligned_cols=74  Identities=20%  Similarity=0.248  Sum_probs=42.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC-------CCCCCCC---CCCCCCCCC----CCCCCCCCCC
Q ss_conf             2221134444432222212222222-21112232211111-------1223322---222222211----1122222222
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLAC-------LKLGAKH---AINYLKEDF----LEILQKETQG  212 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~~~~~~~~-------~~lGa~~---vi~~~~~~~----~~~i~~~t~g  212 (332)
                      ++||+||++++|...++.+...|++ ++.+.+++.+.+.+       ++.|...   ..|-++++-    .+++.+..  
T Consensus         2 tvlITGas~GIG~aia~~la~~Ga~~vvl~~r~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~--   79 (181)
T pfam08659         2 TYLVTGGLGGLGLELARWLAERGARHLVLLSRSGAPDPEAEALLAELEARGAEVTVVACDVSDRDAVAALLAEIRADG--   79 (181)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHC--
T ss_conf             899968787899999999998799789998689766299999999999659969999756899999998886579873--


Q ss_pred             CCCCCCCCCCC
Q ss_conf             21112222111
Q gi|254780290|r  213 RGIDIILDMVG  223 (332)
Q Consensus       213 ~g~Divid~~G  223 (332)
                      .++|.++++.|
T Consensus        80 g~id~lvnnAG   90 (181)
T pfam08659        80 PPLRGVIHAAG   90 (181)
T ss_pred             CCEEEEEEECC
T ss_conf             98489995446


No 269
>smart00828 PKS_MT Methyltransferase  in polyketide synthase (PKS) enzymes.
Probab=92.48  E-value=0.015  Score=36.03  Aligned_cols=94  Identities=20%  Similarity=0.274  Sum_probs=59.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22211344444322222122222-222111223221111112----2332222222221111222222222111222211
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQGRGIDIILDMV  222 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G-~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~  222 (332)
                      +||=.|  .|.|..++.+|+... ++|++++-|++..+.+++    .|.+.-+.....|..+    +.....||+|+.+-
T Consensus         2 rVLDiG--CG~G~~~~~LA~~~p~~~v~GvDiS~~~ie~Ar~r~~~~gl~~rv~~~~~Da~~----lpf~d~FD~V~s~e   75 (224)
T smart00828        2 RVLDFG--CGYGSDLIDLAERHPHLQLHGYTISPEQAEVGRERIRALGLQGRIRIFYRDSAK----DPFPDTYDLVFGFE   75 (224)
T ss_pred             EEEEEE--CCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCHHC----CCCCCCCCEEEHHH
T ss_conf             089983--668888999999779988999979999999999999972998651478521103----99999835676853


Q ss_pred             C-------CCCCCCCCCCCCCCCCCEEEEECC
Q ss_conf             1-------111222221122345304798337
Q gi|254780290|r  223 G-------AEYLNQHLTLLSKEGKLIIISFLG  247 (332)
Q Consensus       223 G-------~~~~~~~~~~l~~~G~iv~~G~~~  247 (332)
                      .       ...+....+.|+|||+++..-...
T Consensus        76 vl~Hi~D~~~~l~ei~RvLKPGG~lviaD~~~  107 (224)
T smart00828       76 VIHHIKDKMDLFSNISRHLKDGGHLVLADFIA  107 (224)
T ss_pred             HHHCCCCHHHHHHHHHHHCCCCEEEEEEEEEC
T ss_conf             57653999999999998717984999998533


No 270
>pfam00106 adh_short short chain dehydrogenase. This family contains a wide variety of dehydrogenases.
Probab=92.38  E-value=0.013  Score=36.38  Aligned_cols=76  Identities=24%  Similarity=0.304  Sum_probs=40.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC--C-CCC---CCCCCCCC---CCCCCCCC----CCCCCCCCCC
Q ss_conf             2222113444443222221222222221112-23221--1-111---12233222---22222211----1122222222
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTA-KSEEK--C-LAC---LKLGAKHA---INYLKEDF----LEILQKETQG  212 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~-~~~~~--~-~~~---~~lGa~~v---i~~~~~~~----~~~i~~~t~g  212 (332)
                      .++||+||++|+|...++.+...|++++..+ ++...  . +.+   ++.|.+..   .|-++++-    .+.+.+..  
T Consensus         1 ~T~lITGas~GIG~aia~~la~~Ga~~vv~~~r~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~--   78 (167)
T pfam00106         1 GTVLITGGTGGLGLALARWLAAEGARHLVLVSRRGDAPGAAELVAELEALGAEVTVAACDVADRDALAALLAALPAAL--   78 (167)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHC--
T ss_conf             989998978789999999999879948999659967689999999999559859999846999999999999999975--


Q ss_pred             CCCCCCCCCCCC
Q ss_conf             211122221111
Q gi|254780290|r  213 RGIDIILDMVGA  224 (332)
Q Consensus       213 ~g~Divid~~G~  224 (332)
                      .++|+++++.|.
T Consensus        79 g~iD~linnAG~   90 (167)
T pfam00106        79 GPLDGVVHNAGV   90 (167)
T ss_pred             CCCCEEEECCCC
T ss_conf             997399988712


No 271
>PRK09134 short chain dehydrogenase; Provisional
Probab=92.36  E-value=0.0087  Score=37.54  Aligned_cols=79  Identities=16%  Similarity=0.222  Sum_probs=47.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC----CCCCCCCC---CCCCCCCC----CCCCCCCCC
Q ss_conf             222222211344444322222122222222111-2232211111----12233222---22222211----112222222
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTT-AKSEEKCLAC----LKLGAKHA---INYLKEDF----LEILQKETQ  211 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~-~~~~~~~~~~----~~lGa~~v---i~~~~~~~----~~~i~~~t~  211 (332)
                      ..++++||+||++++|.+.++-+...|++|+.. .++.++.+.+    ++.|....   .|-++++-    .+++.+.. 
T Consensus         7 ~~~KvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~i~~~g~~~~~~~~Dl~~~~~~~~~v~~~~~~~-   85 (256)
T PRK09134          7 AAPRAALVTGAARRIGRAIALDLAAHGFDVAVHYNRSRDEAEALAAEIRALGRRAVALQADLADEAQVRALVARASAAL-   85 (256)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH-
T ss_conf             9999799948867899999999998799899984999899999999999649918999755899999999999999982-


Q ss_pred             CCCCCCCCCCCCC
Q ss_conf             2211122221111
Q gi|254780290|r  212 GRGIDIILDMVGA  224 (332)
Q Consensus       212 g~g~Divid~~G~  224 (332)
                      | .+|+.+++.|.
T Consensus        86 G-~iDiLVnNAg~   97 (256)
T PRK09134         86 G-PITLLVNNASL   97 (256)
T ss_pred             C-CCCEEEECCCC
T ss_conf             9-98789988711


No 272
>PRK00048 dihydrodipicolinate reductase; Provisional
Probab=92.28  E-value=0.028  Score=34.17  Aligned_cols=29  Identities=17%  Similarity=0.209  Sum_probs=14.0

Q ss_pred             CCCCCCCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             2221134444432222212-2222222111
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLA-SYFGATVYTT  176 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla-~~~G~~vi~~  176 (332)
                      +|.|.|++|-+|...++.+ +..++++++.
T Consensus         4 kI~i~Ga~GrMG~~i~~~i~~~~~~~l~~~   33 (265)
T PRK00048          4 KVGVAGASGRMGRELIEAVEAAEDLELVAA   33 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEE
T ss_conf             999988888779999999986899799999


No 273
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA). This family consists of several Ribosomal protein L11 methyltransferase (EC:2.1.1.-) sequences.
Probab=92.25  E-value=0.015  Score=36.02  Aligned_cols=144  Identities=20%  Similarity=0.215  Sum_probs=77.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222333322112233333221111111222222232221222222333222111222-2222222221134444432222
Q gi|254780290|r   85 WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTA-NLRSGQTVLIHGGSSGIGTTAI  163 (332)
Q Consensus        85 ~~~GdrV~~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~-~~~~g~~vlV~ga~g~vG~~a~  163 (332)
                      +++|+|.+-..   +|-+|- .+....+.+..++.|=...     .-|...+|.-.. -.++|++||=.| ||+ |.+++
T Consensus       108 ~~ig~~~~I~P---sW~~~~-~~~~~~I~idPGmAFGTG~-----H~TT~lcl~~l~~~~~~~~~vlD~G-cGS-GILaI  176 (294)
T pfam06325       108 VRIGERLTIVP---SWEDYP-EPDAVNIELDPGMAFGTGT-----HPTTALCLEALESLVKPGETVLDVG-CGS-GILAI  176 (294)
T ss_pred             EEECCEEEEEC---CCCCCC-CCCCEEEEECCCCCCCCCC-----CHHHHHHHHHHHHHCCCCCEEEEEC-CCH-HHHHH
T ss_conf             79758299968---987799-9763589866643456777-----7579999999986503698678505-650-89999


Q ss_pred             CCCCCCCC-CCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCC
Q ss_conf             21222222-221112232211111122----33222222222111122222222211122221111----1122222112
Q gi|254780290|r  164 QLASYFGA-TVYTTAKSEEKCLACLKL----GAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA----EYLNQHLTLL  234 (332)
Q Consensus       164 qla~~~G~-~vi~~~~~~~~~~~~~~l----Ga~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~----~~~~~~~~~l  234 (332)
                      - |..+|+ +|++++..+.-.+.+++.    +.+..+       ............+|+|+-.+-.    .......+.+
T Consensus       177 a-A~klGa~~v~a~DiDp~Av~~a~eN~~~N~v~~~~-------~~~~~~~~~~~~~DlIvANIla~~L~~l~~~~~~~l  248 (294)
T pfam06325       177 A-ALKLGAKKVVGVDIDPVAVRAAKENAELNGVEAQL-------EVYLPGDLPEGKADVVVANILADPLIELAPDIYALV  248 (294)
T ss_pred             H-HHHCCCCCEEEEECCHHHHHHHHHHHHHCCCCCCE-------EEECCCCCCCCCCCEEEEHHCHHHHHHHHHHHHHHH
T ss_conf             9-99759996899988899999999999976998317-------996443155664578984108999999999999973


Q ss_pred             CCCCCCEEEEECC
Q ss_conf             2345304798337
Q gi|254780290|r  235 SKEGKLIIISFLG  247 (332)
Q Consensus       235 ~~~G~iv~~G~~~  247 (332)
                      +++|+++.-|...
T Consensus       249 ~~~G~lilSGil~  261 (294)
T pfam06325       249 KPGGYLILSGILE  261 (294)
T ss_pred             CCCCEEEECCCCH
T ss_conf             8998999917828


No 274
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis]
Probab=92.12  E-value=0.036  Score=33.50  Aligned_cols=97  Identities=25%  Similarity=0.328  Sum_probs=54.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCC----CCCCCCCC--CCCCCCCCCCCCCCC
Q ss_conf             2222222222221134444432222212222---22221112232211111----12233222--222222111122222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYF---GATVYTTAKSEEKCLAC----LKLGAKHA--INYLKEDFLEILQKE  209 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~---G~~vi~~~~~~~~~~~~----~~lGa~~v--i~~~~~~~~~~i~~~  209 (332)
                      ...+.++|++||=.  |.+-|--+.++|..+   |..|++.+.++.|.+.+    +++|+..+  ++..+..+.    +.
T Consensus       150 ~~L~p~pge~VlD~--cAAPGGKTthla~~~~~~~~iV~A~D~~~~Rl~~l~~nl~RlG~~nv~~~~~d~~~~~----~~  223 (355)
T COG0144         150 LVLDPKPGERVLDL--CAAPGGKTTHLAELMENEGAIVVAVDVSPKRLKRLRENLKRLGVRNVIVVNKDARRLA----EL  223 (355)
T ss_pred             HHCCCCCCCEEEEC--CCCCCHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC----CC
T ss_conf             97199997968880--7999769999999668998769974498789999999999719983489951330143----11


Q ss_pred             CCCC-CCCCCC-C--CCCCCCC--------------------------CCCCCCCCCCCCCE
Q ss_conf             2222-111222-2--1111112--------------------------22221122345304
Q gi|254780290|r  210 TQGR-GIDIIL-D--MVGAEYL--------------------------NQHLTLLSKEGKLI  241 (332)
Q Consensus       210 t~g~-g~Divi-d--~~G~~~~--------------------------~~~~~~l~~~G~iv  241 (332)
                      .... .||.|+ |  |+|..++                          ..+++++++||+++
T Consensus       224 ~~~~~~fD~iLlDaPCSg~G~irr~Pd~~~~~~~~~i~~l~~lQ~~iL~~a~~~lk~GG~LV  285 (355)
T COG0144         224 LPGGEKFDRILLDAPCSGTGVIRRDPDVKWRRTPEDIAELAKLQKEILAAALKLLKPGGVLV  285 (355)
T ss_pred             CCCCCCCCEEEECCCCCCCEEECCCCCHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             34557778599879998771133581232038999999999999999999998448798899


No 275
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=92.05  E-value=0.028  Score=34.14  Aligned_cols=70  Identities=19%  Similarity=0.276  Sum_probs=46.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222113444443222221222222221112232211111122332222-2222211112222222221112222111
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI-NYLKEDFLEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi-~~~~~~~~~~i~~~t~g~g~Divid~~G  223 (332)
                      ++||+||+|.+|...++-+...|.+|.+.+|++++..... .+++.+. |+.+.+.   +..  ...|+|.++-+.+
T Consensus         2 ~ilV~GatG~~G~~~~~~L~~~~~~v~~~~r~~~~~~~~~-~~v~~~~~d~~~~~~---l~~--~~~G~~~~~~i~~   72 (275)
T COG0702           2 KILVTGATGFVGGAVVRELLARGHEVRAAVRNPEAAAALA-GGVEVVLGDLRDPKS---LVA--GAKGVDGVLLISG   72 (275)
T ss_pred             CEEEECCCCCHHHHHHHHHHHCCCEEEEECCCCHHHHHCC-CCCEEECCCCCCCHH---HHH--HHCCCEEEEEECC
T ss_conf             3899867775799999999975986999736822111103-785288456416077---999--8489417999525


No 276
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed
Probab=92.05  E-value=0.023  Score=34.80  Aligned_cols=99  Identities=17%  Similarity=0.177  Sum_probs=55.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC-CCCCCCCC-CCCCCCCCCCCCCCCCCCC
Q ss_conf             111222222222222113444443222221222222-22111223221111-11223322-2222222111122222222
Q gi|254780290|r  136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLA-CLKLGAKH-AINYLKEDFLEILQKETQG  212 (332)
Q Consensus       136 ~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~-~~~lGa~~-vi~~~~~~~~~~i~~~t~g  212 (332)
                      +|.+.....++++++|.| +||.+.+++.-+...|+ +++.+.|++++.+. +++++... ++.+.      .+...  .
T Consensus       112 ~l~~~~~~~~~k~vlIlG-aGGaarai~~al~~~g~~~i~i~nR~~~~a~~l~~~~~~~~~~~~~~------~~~~~--~  182 (275)
T PRK00258        112 DLERLGLDLKGKRILLLG-AGGAARAVILPLLELGVAEITIVNRTVERAEELAELFGEGVQALGLD------ELAGE--L  182 (275)
T ss_pred             HHHHHCCCCCCCEEEEEC-CCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCCCCEEEHH------HHHHC--C
T ss_conf             999848785687599988-87107999999997699989999589999999999835676275378------75430--4


Q ss_pred             CCCCCCCCCCCCCC----CCCCCCCCCCCCCCEEE
Q ss_conf             21112222111111----22222112234530479
Q gi|254780290|r  213 RGIDIILDMVGAEY----LNQHLTLLSKEGKLIII  243 (332)
Q Consensus       213 ~g~Divid~~G~~~----~~~~~~~l~~~G~iv~~  243 (332)
                      ..+|++++|+....    ....++.+++...+..+
T Consensus       183 ~~~diiInaTp~Gm~~~~~~~~~~~~~~~~~v~D~  217 (275)
T PRK00258        183 ADFDLIINTTSAGMSGELPPLPASLLRPGTVVYDM  217 (275)
T ss_pred             CCCCEEEECCCCCCCCCCCHHHHHHCCCCCEEEEE
T ss_conf             45777996577777788651138764888669986


No 277
>PRK10901 16S rRNA methyltransferase B; Provisional
Probab=91.99  E-value=0.027  Score=34.26  Aligned_cols=98  Identities=17%  Similarity=0.175  Sum_probs=54.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222221134444432222212222-222211122322111111----22332222222221111222222222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYF-GATVYTTAKSEEKCLACL----KLGAKHAINYLKEDFLEILQKETQGR  213 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~-G~~vi~~~~~~~~~~~~~----~lGa~~vi~~~~~~~~~~i~~~t~g~  213 (332)
                      .....++|++||  -+|.+-|-=+.++|... +.+|++.+.++.|.+.++    ++|....+...+  .. ...+.....
T Consensus       239 ~ll~p~~g~~VL--D~CAaPGGKt~~la~~~~~~~v~A~D~~~~Rl~~l~~n~~Rlg~~~~v~~~d--~~-~~~~~~~~~  313 (428)
T PRK10901        239 TLLAPQNGEHIL--DLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRLGMKATVKQGD--GR-YPSQWCGEQ  313 (428)
T ss_pred             HHCCCCCCCEEE--EECCCCCHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHCCCCEEEEECC--CC-CHHHHCCCC
T ss_conf             864988898798--7168876689999996458928999698889999999999759973999776--55-723313445


Q ss_pred             CCCCCC-C--CCCCCC--------------------------CCCCCCCCCCCCCCE
Q ss_conf             111222-2--111111--------------------------222221122345304
Q gi|254780290|r  214 GIDIIL-D--MVGAEY--------------------------LNQHLTLLSKEGKLI  241 (332)
Q Consensus       214 g~Divi-d--~~G~~~--------------------------~~~~~~~l~~~G~iv  241 (332)
                      .||.|+ |  |+|..+                          ++.+++++++||+++
T Consensus       314 ~fD~ILlDaPCSg~G~lrR~Pdikw~~~~~di~~l~~lQ~~iL~~a~~~lk~gG~Lv  370 (428)
T PRK10901        314 QFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQSEILDAIWPHLKSGGTLV  370 (428)
T ss_pred             CCCEEEECCCCCCCEEECCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             678799758988872444685421128999999999999999999998668898899


No 278
>PRK07023 short chain dehydrogenase; Provisional
Probab=91.98  E-value=0.025  Score=34.55  Aligned_cols=37  Identities=19%  Similarity=0.296  Sum_probs=31.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222211344444322222122222222111223221
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK  182 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~  182 (332)
                      +.++||+||++|+|.+.++.+...|++|+.++++.++
T Consensus         1 ~~rAlITGas~GIG~aiA~~la~~G~~Vi~~~r~~~~   37 (243)
T PRK07023          1 DVRAIVTGHSRGLGAALAEQLLQPGIAVLGVSRSRHP   37 (243)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCH
T ss_conf             9999992876299999999999879999999799789


No 279
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only]
Probab=91.96  E-value=0.051  Score=32.46  Aligned_cols=32  Identities=25%  Similarity=0.252  Sum_probs=13.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             21134444432222212222222211122322
Q gi|254780290|r  150 LIHGGSSGIGTTAIQLASYFGATVYTTAKSEE  181 (332)
Q Consensus       150 lV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~  181 (332)
                      +|+||+|-+|...++.++..|-+|+.++|++.
T Consensus         2 liTGgTGlIG~~L~~~L~~~gh~v~iltR~~~   33 (297)
T COG1090           2 LITGGTGLIGRALTARLRKGGHQVTILTRRPP   33 (297)
T ss_pred             EEECCCCCHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             57356650168999999848986999974785


No 280
>pfam08241 Methyltransf_11 Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
Probab=91.84  E-value=0.026  Score=34.45  Aligned_cols=82  Identities=21%  Similarity=0.250  Sum_probs=51.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-------CCCCCC
Q ss_conf             4432222212222222211122322111111223322222222211112222222221112222111-------111222
Q gi|254780290|r  157 GIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG-------AEYLNQ  229 (332)
Q Consensus       157 ~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G-------~~~~~~  229 (332)
                      |.|..+..+++..+.++++++.|++..+.+++...+.-+++...++.+.  .. ....||+|+..-.       ...++.
T Consensus         6 G~G~~~~~l~~~~~~~v~giD~s~~~i~~a~~~~~~~~~~~~~~d~~~~--~~-~~~~fD~I~~~~~l~~~~~~~~~l~~   82 (95)
T pfam08241         6 GTGLLTEALARLPGAQVTGVDLSPEMLALARKRAQEDGLTFVVGDAEDL--PF-PDESFDVVVSSLVLHHLPDPERALRE   82 (95)
T ss_pred             CCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCCCEEEEECCCCC--CC-CCCCCCEEEECCCHHHCCCHHHHHHH
T ss_conf             4999999998457999999949789987766310266947998033246--75-54568599983306646899999999


Q ss_pred             CCCCCCCCCCCE
Q ss_conf             221122345304
Q gi|254780290|r  230 HLTLLSKEGKLI  241 (332)
Q Consensus       230 ~~~~l~~~G~iv  241 (332)
                      +.+.|+|||+++
T Consensus        83 ~~r~LkpgG~l~   94 (95)
T pfam08241        83 IARVLKPGGKLV   94 (95)
T ss_pred             HHHHCCCCEEEE
T ss_conf             998778694997


No 281
>TIGR01139 cysK cysteine synthase A; InterPro: IPR005859    This model discriminates cysteine synthase A (CysK) and cysteine synthase B (CysM) from cystathionine beta-synthase, a protein found primarily in eukaryotes and carrying a C-terminal CBS domain lacking from this protein. Bacterial proteins lacking the CBS domain but otherwise showing resemblance to cystathionine beta-synthases and considerable phylogenetic distance from known cysteine synthases were excluded.    Cysteine synthase (O-acetylserine (thiol)-lyase, 2.5.1.47 from EC) is the enzyme responsible for the formation of cysteine from O-acetyl-serine and hydrogen sulphide with the concomitant release of acetic acid. In bacteria such two forms of the enzyme are known (genes cysK and cysM). CysK differs from CysM in that it can also use sulphide instead of thiosulphate, to produce cysteine instead of cysteine thiosulphonate. ; GO: 0004124 cysteine synthase activity, 0006535 cysteine biosynthetic process from serine.
Probab=91.77  E-value=0.024  Score=34.64  Aligned_cols=187  Identities=18%  Similarity=0.200  Sum_probs=104.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCC----------------
Q ss_conf             122222222222211344444322222122222222111---2232211111122332222222----------------
Q gi|254780290|r  138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTT---AKSEEKCLACLKLGAKHAINYL----------------  198 (332)
Q Consensus       138 ~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~---~~~~~~~~~~~~lGa~~vi~~~----------------  198 (332)
                      .+.+.|++|+ .+|=.=+|.+|.+..++|-++|++.+.|   .=|.||+.+||.+||+-++-.-                
T Consensus        51 Ek~G~lk~G~-~IvEpTSGNTGIaLAmvAAArGYkliltMPetMS~ERr~lL~ayGAeLvLTpg~~GMkGAI~KA~Ei~~  129 (312)
T TIGR01139        51 EKRGLLKPGK-TIVEPTSGNTGIALAMVAAARGYKLILTMPETMSIERRKLLKAYGAELVLTPGAEGMKGAIAKAEEIAE  129 (312)
T ss_pred             HHCCCCCCCC-EEEECCCCCHHHHHHHHHHHHCCEEEEECCCCHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             8658868888-898237773269999999871894999867432689999998709658872812376667899999998


Q ss_pred             ----------------CCC-----CCCCCCCCCCCC-CCCCCCCCCC-CCCCCCCCCCC---CCCC-CCEEEEE------
Q ss_conf             ----------------221-----111222222222-1112222111-11122222112---2345-3047983------
Q gi|254780290|r  199 ----------------KED-----FLEILQKETQGR-GIDIILDMVG-AEYLNQHLTLL---SKEG-KLIIISF------  245 (332)
Q Consensus       199 ----------------~~~-----~~~~i~~~t~g~-g~Divid~~G-~~~~~~~~~~l---~~~G-~iv~~G~------  245 (332)
                                      +++     -..+|.+.++|+ .+|+.+=.+| |.++.=.-+.|   .+.| -+-.++.      
T Consensus       130 ~~Pn~y~m~~QF~NpANP~~Hr~TTg~EIw~d~dg~G~~D~FVaG~GTGGTITGvG~~LK~~~pkG~~~~~~AVEP~~SP  209 (312)
T TIGR01139       130 STPNSYFMLQQFENPANPEIHRKTTGPEIWRDTDGKGRLDAFVAGVGTGGTITGVGEVLKEKKPKGKDIKIVAVEPAESP  209 (312)
T ss_pred             HCCCCEEECCCCCCCCHHHHHHHCCHHHHHHHHCCCCCEEEEEEEECCCCHHHHHHHHHHCCCCCCCEEEEEEECCCCCH
T ss_conf             68792652245787221476162027899996278983117997323685154789987400789955899987277431


Q ss_pred             -CCCC---CCCCCCCCHHHCCCCEEEEEEECCC-HHCCHHHHHHHHHHHHHHHH--HCCCCCCCCEEEEEHHHHHHHHHH
Q ss_conf             -3787---5432224334305321677751240-00113789999999999999--869831021247418999999999
Q gi|254780290|r  246 -LGGN---IATEINLNPIISKRITITGSTLRRR-TDIAKQSIRDSLQLKIWPLL--NSHVIAPVIHTVLPLGKVAMAHDI  318 (332)
Q Consensus       246 -~~~~---~~~~~~~~~~~~~~~~i~g~~~~~~-~~~~~~~~~~~~~~~~~~~i--~~g~l~p~i~~~~~l~~i~~A~~~  318 (332)
                       .++.   ...+-.++.+.--..-|....+... .|.- -.+.++-...+.+.+  ++|.|.=    +-+=..+.-|++.
T Consensus       210 VLSggLAG~~ikpGpHKIQGiGAGFIP~~Ln~~v~D~v-i~V~~EeAi~~ARrLA~eEGiL~G----ISSGA~vaAAl~~  284 (312)
T TIGR01139       210 VLSGGLAGEEIKPGPHKIQGIGAGFIPKVLNRSVIDEV-ITVSDEEAIETARRLAKEEGILVG----ISSGAAVAAALKL  284 (312)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEE-EECCCHHHHHHHHHHHHHCCEEEC----CCHHHHHHHHHHH
T ss_conf             34433300102669496412797872633684136214-740755689999999986780101----5578999999999


Q ss_pred             HHCCCCCCEEEE
Q ss_conf             982998132898
Q gi|254780290|r  319 MEKSEHIGKIIL  330 (332)
Q Consensus       319 l~~g~~~GKvVi  330 (332)
                      -+.-++.||.||
T Consensus       285 Ak~~~n~dK~iV  296 (312)
T TIGR01139       285 AKRLENPDKLIV  296 (312)
T ss_pred             HHHHCCCCCEEE
T ss_conf             873248898899


No 282
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional
Probab=91.76  E-value=0.013  Score=36.41  Aligned_cols=80  Identities=16%  Similarity=0.196  Sum_probs=44.4

Q ss_pred             CCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCC--CCCCCCCCCCCCCCCCC--C
Q ss_conf             22222221134--44443222221222222221112232211111----122332222--22222111122222222--2
Q gi|254780290|r  144 RSGQTVLIHGG--SSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHAI--NYLKEDFLEILQKETQG--R  213 (332)
Q Consensus       144 ~~g~~vlV~ga--~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~vi--~~~~~~~~~~i~~~t~g--~  213 (332)
                      -.|+++||+||  +.++|....+.+...|++|+.+...++..+.+    .++|...++  |-++++-.+++.+.+..  .
T Consensus         4 L~gK~~lVTGa~~~~GIG~aia~~la~~Ga~v~~~~~~~~~~~~~~~~~~~~g~~~~~~~Dv~~~~~v~~~~~~~~~~~G   83 (261)
T PRK08690          4 LQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELDSELVFRCDVASDDEINQVFADLGKHWD   83 (261)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             99988999898786389999999999859999997376155999999998739808998899999999999999999968


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      ++|+.+++.|
T Consensus        84 ~iD~LVnnaG   93 (261)
T PRK08690         84 GLDGLVHSIG   93 (261)
T ss_pred             CCCEEEECCC
T ss_conf             9878975255


No 283
>TIGR01136 cysKM cysteine synthases; InterPro: IPR005856    This model discriminates cysteine synthases (both CysK and CysM) from cystathionine beta-synthase, a protein found primarily in eukaryotes and carrying a C-terminal CBS domain lacking from this protein. Bacterial proteins lacking the CBS domain but otherwise showing resemblance to cystathionine beta-synthases and considerable phylogenetic distance from known cysteine synthases were excluded.    Cysteine synthase (O-acetylserine (thiol)-lyase) is the enzyme responsible for the formation of cysteine from O-acetyl-serine and hydrogen sulphide with the concomitant release of acetic acid. In bacteria such two forms of the enzyme are known (genes cysK and cysM). CysM differs from CysK in that it can also use thiosulphate instead of sulphide, to produce cysteine thiosulphonate instead of cysteine. ; GO: 0004124 cysteine synthase activity, 0006535 cysteine biosynthetic process from serine.
Probab=91.74  E-value=0.024  Score=34.62  Aligned_cols=105  Identities=21%  Similarity=0.242  Sum_probs=69.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCC---------------
Q ss_conf             122222222222211344444322222122222222111---22322111111223322222222---------------
Q gi|254780290|r  138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTT---AKSEEKCLACLKLGAKHAINYLK---------------  199 (332)
Q Consensus       138 ~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~---~~~~~~~~~~~~lGa~~vi~~~~---------------  199 (332)
                      .+.+.|+||+ ++|=.=+|.+|.+..++|.++|++.+.|   .-|.||+.+++.+||+-++-...               
T Consensus        54 E~~G~lk~G~-~iiEaTSGNTGIaLAMvAAarGYkliL~MPetmS~ERr~~l~ayGA~L~LT~~~~GM~GAi~kA~el~~  132 (315)
T TIGR01136        54 EKRGLLKPGT-TIIEATSGNTGIALAMVAAARGYKLILTMPETMSLERRKLLKAYGAELILTPAEEGMKGAIDKAEELAA  132 (315)
T ss_pred             HHCCCCCCCC-EEEECCCCCHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             8658878888-898427784489999999861991899858871789999998709669883733575778999999998


Q ss_pred             -----------------CC-----CCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC---CCC-CCEEEE
Q ss_conf             -----------------21-----1112222222221112222111-111222221122---345-304798
Q gi|254780290|r  200 -----------------ED-----FLEILQKETQGRGIDIILDMVG-AEYLNQHLTLLS---KEG-KLIIIS  244 (332)
Q Consensus       200 -----------------~~-----~~~~i~~~t~g~g~Divid~~G-~~~~~~~~~~l~---~~G-~iv~~G  244 (332)
                                       ++     -..+|.+.|+|+ +|+.+=.+| +.++-=.-+.||   +.| -+-.++
T Consensus       133 ~~p~~~~~l~QF~NpaNp~~H~~TTGpEIw~dt~G~-id~FVaG~GTGGTItGvgr~LK~~~pkG~~i~i~a  203 (315)
T TIGR01136       133 ETPNKYVMLDQFENPANPEAHRKTTGPEIWRDTDGR-IDHFVAGVGTGGTITGVGRVLKEQNPKGKNIQIVA  203 (315)
T ss_pred             HCCCCEEECCCCCCCCHHHHHHCCCHHHHHHHCCCC-EEEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             588962103325885214762305657999732892-35899711567511168989863268996179999


No 284
>KOG1210 consensus
Probab=91.71  E-value=0.021  Score=35.02  Aligned_cols=80  Identities=30%  Similarity=0.365  Sum_probs=52.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC---CCCCCCCC-----C----CCCCCC
Q ss_conf             222222221134444432222212222222211122322111111-2233222---22222211-----1----122222
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-KLGAKHA---INYLKEDF-----L----EILQKE  209 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~lGa~~v---i~~~~~~~-----~----~~i~~~  209 (332)
                      .++...++|+|+++++|++....++..|++|..++++.+|++.++ +++....   +.+...|.     .    +.++++
T Consensus        30 ~k~~~hi~itggS~glgl~la~e~~~~ga~Vti~ar~~~kl~~a~~~l~l~~~~~~v~~~S~d~~~Y~~v~~~~~~l~~~  109 (331)
T KOG1210          30 PKPRRHILITGGSSGLGLALALECKREGADVTITARSGKKLLEAKAELELLTQVEDVSYKSVDVIDYDSVSKVIEELRDL  109 (331)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHC
T ss_conf             67662699816841566899999997037429994648789998743114443530367535530289999887632330


Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             222211122221111
Q gi|254780290|r  210 TQGRGIDIILDMVGA  224 (332)
Q Consensus       210 t~g~g~Divid~~G~  224 (332)
                      -.  .+|..|.|.|.
T Consensus       110 ~~--~~d~l~~cAG~  122 (331)
T KOG1210         110 EG--PIDNLFCCAGV  122 (331)
T ss_pred             CC--CCCEEEEECCC
T ss_conf             48--95027870676


No 285
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated
Probab=91.62  E-value=0.013  Score=36.39  Aligned_cols=179  Identities=18%  Similarity=0.280  Sum_probs=82.4

Q ss_pred             CCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCC----CCCCCC--CCCCCCC----CCCCCCCC
Q ss_conf             222222113444--443222221222222221112232211---11112----233222--2222221----11122222
Q gi|254780290|r  145 SGQTVLIHGGSS--GIGTTAIQLASYFGATVYTTAKSEEKC---LACLK----LGAKHA--INYLKED----FLEILQKE  209 (332)
Q Consensus       145 ~g~~vlV~ga~g--~vG~~a~qla~~~G~~vi~~~~~~~~~---~~~~~----lGa~~v--i~~~~~~----~~~~i~~~  209 (332)
                      .|+++||+||+|  ++|....+-+...|++|+.+..+.++.   +.+++    .+....  .|-++++    +.+++.+.
T Consensus         6 ~GK~alVTGaag~~GiG~aia~~la~~GA~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~   85 (259)
T PRK07370          6 TGKKALVTGIANNRSIAWGIAQQLHAAGAELGITYLPDEKGRFEKKVRELTEPLNPSLFLPCNVQDDAQIEEVFETIKQK   85 (259)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             99989997989985799999999998699999994787013589999999841286489991289999999999999998


Q ss_pred             CCCCCCCCCCCCCCC--------CC-------C---------------CCCCCCCCCCCCCEEEEECCCCCCCC-CC---
Q ss_conf             222211122221111--------11-------2---------------22221122345304798337875432-22---
Q gi|254780290|r  210 TQGRGIDIILDMVGA--------EY-------L---------------NQHLTLLSKEGKLIIISFLGGNIATE-IN---  255 (332)
Q Consensus       210 t~g~g~Divid~~G~--------~~-------~---------------~~~~~~l~~~G~iv~~G~~~~~~~~~-~~---  255 (332)
                      . | ++|+.+++.|.        +.       |               +...++++.+|+++.++...+....+ ..   
T Consensus        86 ~-G-~iDilVnna~~~~~~~~~~~~~~~~~~~~~~~~~vn~~~~~~~~~~~~~~~~~~g~Ii~iss~~~~~~~~~~~~y~  163 (259)
T PRK07370         86 W-G-QLDILVHCLAFAGKEELSGDFSATSREGFARALEISAYSLAPLCRAAKPLMSEGGSIVTLTYLGGVRAIPNYNVMG  163 (259)
T ss_pred             H-C-CCCEEEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCHH
T ss_conf             5-8-9877986301146433679925599999999999987999999999988604588531278741354678852058


Q ss_pred             -------------CCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC
Q ss_conf             -------------4334305321677751240001137899999999999998698310212474189999999999829
Q gi|254780290|r  256 -------------LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS  322 (332)
Q Consensus       256 -------------~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g  322 (332)
                                   ..++-.+++++....-+...-..... .... .+..+.+.+.  .| ..+.-.-+|+..+.-.|.+-
T Consensus       164 asKaal~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~-~~~~-~~~~~~~~~~--~P-l~R~g~peeiA~~v~FL~Sd  238 (259)
T PRK07370        164 VAKAALEASVRYLAAELGPENIRVNAISAGPIRTLASSA-VGGI-LDMIHHVEEK--AP-LRRTVTQTEVGNTAAFLLSD  238 (259)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHC-CCCC-HHHHHHHHHC--CC-CCCCCCHHHHHHHHHHHHCC
T ss_conf             899999999999999837188799998636685512220-3672-9999999857--99-89993999999999999584


Q ss_pred             ---CCCCEEEE
Q ss_conf             ---98132898
Q gi|254780290|r  323 ---EHIGKIIL  330 (332)
Q Consensus       323 ---~~~GKvVi  330 (332)
                         -.+|-++.
T Consensus       239 ~s~~iTG~~i~  249 (259)
T PRK07370        239 LASGITGQTIY  249 (259)
T ss_pred             HHCCCCCCEEE
T ss_conf             52574387189


No 286
>PRK07069 short chain dehydrogenase; Validated
Probab=91.53  E-value=0.017  Score=35.58  Aligned_cols=100  Identities=19%  Similarity=0.281  Sum_probs=58.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC----C-CCCCCCCC----CCCCCCC----CCCCCCCCCCCC
Q ss_conf             222113444443222221222222221112232211-11----1-12233222----2222221----111222222222
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC-LA----C-LKLGAKHA----INYLKED----FLEILQKETQGR  213 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~-~~----~-~~lGa~~v----i~~~~~~----~~~~i~~~t~g~  213 (332)
                      +.||+||++|+|...++.+...|++|+.+.++.++. +.    + ...|...+    .|-++.+    +.++..+..+  
T Consensus         1 ~AlVTGgs~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~v~~~v~~~~~~~G--   78 (251)
T PRK07069          1 RAFITGAAGGLGRAIARRMAEQGARVFLTDINDAAALDAFAAEINAAHGEGVAFAAVQDVTDEAQWQALLAQAADAMG--   78 (251)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCC--
T ss_conf             979985578899999999998699999996894358999999998615996399995779999999999999999829--


Q ss_pred             CCCCCCCCCCC----CC-------CC---------------CCCCCCCC--CCCCEEEEECCCC
Q ss_conf             11122221111----11-------22---------------22211223--4530479833787
Q gi|254780290|r  214 GIDIILDMVGA----EY-------LN---------------QHLTLLSK--EGKLIIISFLGGN  249 (332)
Q Consensus       214 g~Divid~~G~----~~-------~~---------------~~~~~l~~--~G~iv~~G~~~~~  249 (332)
                      ++|+.+++.|.    ..       |+               .+++.|+.  +|+++.++...+.
T Consensus        79 ~iDilVNnAGi~~~~~~~~~~~~~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~  142 (251)
T PRK07069         79 GLSVLVNNAGVGSFGAIEQIELDEWRRVMAINVESIVLGCKHALPYLRASQPASIVNISSVAAF  142 (251)
T ss_pred             CCCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC
T ss_conf             9989998999999999034999999999999978999999999999996699789992867545


No 287
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism]
Probab=91.43  E-value=0.053  Score=32.37  Aligned_cols=96  Identities=19%  Similarity=0.296  Sum_probs=67.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222113444443222221222222221112232211111122-332-2222222211112222222221112222
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKL-GAK-HAINYLKEDFLEILQKETQGRGIDIILD  220 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~l-Ga~-~vi~~~~~~~~~~i~~~t~g~g~Divid  220 (332)
                      +.++ +|.|+| .|-+|.-+.++|.-+|++|...+.|.+|+..+..+ +-. ++..++..++.+.+.+      .|++|.
T Consensus       166 V~~~-kv~iiG-GGvvgtnaAkiA~glgA~Vtild~n~~rl~~ldd~f~~rv~~~~st~~~iee~v~~------aDlvIg  237 (371)
T COG0686         166 VLPA-KVVVLG-GGVVGTNAAKIAIGLGADVTILDLNIDRLRQLDDLFGGRVHTLYSTPSNIEEAVKK------ADLVIG  237 (371)
T ss_pred             CCCC-CEEEEC-CCCCCCHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCEEEEEECCHHHHHHHHHH------CCEEEE
T ss_conf             8776-089987-76124069999723687069995277887640676576669997589999987431------267988


Q ss_pred             CC---CCC----CCCCCCCCCCCCCCCEEEEEC
Q ss_conf             11---111----122222112234530479833
Q gi|254780290|r  221 MV---GAE----YLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       221 ~~---G~~----~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      .+   |.+    ..+..++.|++|+.++.+..-
T Consensus       238 aVLIpgakaPkLvt~e~vk~MkpGsVivDVAiD  270 (371)
T COG0686         238 AVLIPGAKAPKLVTREMVKQMKPGSVIVDVAID  270 (371)
T ss_pred             EEEECCCCCCEEHHHHHHHHCCCCCEEEEEEEC
T ss_conf             888458878601069999744798589999874


No 288
>KOG1208 consensus
Probab=91.37  E-value=0.027  Score=34.25  Aligned_cols=43  Identities=30%  Similarity=0.435  Sum_probs=35.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL  187 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~  187 (332)
                      .+.+++|+||++|+|..++.-+...|++|+.++|+.++.+.++
T Consensus        34 ~~~~~vVTGansGIG~eta~~La~~Ga~Vv~~~R~~~~~~~~~   76 (314)
T KOG1208          34 SGKVALVTGATSGIGFETARELALRGAHVVLACRNEERGEEAK   76 (314)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHH
T ss_conf             7877999589884379999999957998999847778899999


No 289
>TIGR01318 gltD_gamma_fam glutamate synthase, small subunit; InterPro: IPR006006    One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1.4.1.13 from EC) which transfers the amide group of glutamine to 2-oxoglutarate to yield two molecules of glutamate.  2 L-glutamate + NADP^+ = L-glutamine + 2-oxoglutarate + NADPH + H^+.    This model describes both glutatate synthase small subunit and closely related paralogs of unknown function from a number of gamma and alpha subdivision Proteobacteria, including Escherichia coli. ; GO: 0016639 oxidoreductase activity acting on the CH-NH2 group of donors NAD or NADP as acceptor, 0006537 glutamate biosynthetic process.
Probab=91.37  E-value=0.073  Score=31.42  Aligned_cols=51  Identities=22%  Similarity=0.375  Sum_probs=26.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC--------CCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222-2211122322--------111111223322222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEE--------KCLACLKLGAKHAIN  196 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~--------~~~~~~~lGa~~vi~  196 (332)
                      .|++|+|.|| |=++.=-+.=|-.+|| +|+.+-|.+|        ...-+||=|++--||
T Consensus       291 ~Gk~VVVLGG-GDTaMDCvRTaiR~GA~~VTC~YRRDE~nMPGSrrEV~NAREEGV~F~Fn  350 (480)
T TIGR01318       291 EGKRVVVLGG-GDTAMDCVRTAIRLGAKKVTCAYRRDEANMPGSRREVANAREEGVEFLFN  350 (480)
T ss_pred             CCCEEEEECC-CCCHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHCCCHHCCCEEEEE
T ss_conf             7766898588-87525788999981776131266536778787755526611117113210


No 290
>PRK06940 short chain dehydrogenase; Provisional
Probab=91.25  E-value=0.015  Score=36.06  Aligned_cols=77  Identities=17%  Similarity=0.224  Sum_probs=45.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC---CCCCCCCCCCCCCCCCCC-CCCCCCC
Q ss_conf             2222113444443222221222222221112232211111----1223322---222222211112222222-2211122
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKH---AINYLKEDFLEILQKETQ-GRGIDII  218 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~---vi~~~~~~~~~~i~~~t~-g~g~Div  218 (332)
                      .+|+|++|++|+|.+..+.+ +.|++|+.+.+++++.+.+    ++.|.+.   ..|-++++-.+.+.+... -.++|+.
T Consensus         5 ~kV~v~tGa~GIG~aiA~~l-a~Ga~vvi~~~~~~~l~~~~~~l~~~g~~~~~~~~Dvs~~~~v~~l~~~~~~~G~idiL   83 (277)
T PRK06940          5 KEVVVVIGAGGMGQAIARRV-GSGKTVLLADYNEENLQAVARTLREAGFDVITQQVDVSSRESVKALAQTAATLGAVTGL   83 (277)
T ss_pred             CCEEEECCCCHHHHHHHHHH-HHCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             92999978169999999999-81998999989889999999998722882999982579989999999999986998799


Q ss_pred             CCCCCC
Q ss_conf             221111
Q gi|254780290|r  219 LDMVGA  224 (332)
Q Consensus       219 id~~G~  224 (332)
                      +++.|.
T Consensus        84 VnnAG~   89 (277)
T PRK06940         84 VHTAGV   89 (277)
T ss_pred             EECCCC
T ss_conf             988867


No 291
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF; InterPro: IPR012731    Members of the HesA/MoeB/ThiF family of proteins (IPR000594 from INTERPRO) include a number of members encoded in the midst of thiamine biosynthetic operons. This mix of known and putative ThiF proteins shows a deep split in phylogenetic trees. The Escherichia coli ThiF and MoeB proteins are seemingly more closely related than the E. coli ThiF and Campylobacter (for example) ThiF. This entry represents the more widely distributed clade of ThiF proteins as found in E. coli..
Probab=91.19  E-value=0.028  Score=34.18  Aligned_cols=32  Identities=28%  Similarity=0.425  Sum_probs=26.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC
Q ss_conf             22222113444443222221222222-2211122
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAK  178 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~  178 (332)
                      +.+|||+| +|+.|..+++++-..|. ++..++.
T Consensus        21 ~s~VLiiG-aGgLGs~~~~~LA~AGVG~i~i~D~   53 (210)
T TIGR02356        21 ASHVLIIG-AGGLGSPAALYLAAAGVGTITIVDD   53 (210)
T ss_pred             HCCEEEEE-ECHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             08659997-2614568999998288837899851


No 292
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional
Probab=91.10  E-value=0.027  Score=34.33  Aligned_cols=39  Identities=21%  Similarity=0.159  Sum_probs=30.4

Q ss_pred             CCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444--443222221222222221112232211
Q gi|254780290|r  145 SGQTVLIHGGSS--GIGTTAIQLASYFGATVYTTAKSEEKC  183 (332)
Q Consensus       145 ~g~~vlV~ga~g--~vG~~a~qla~~~G~~vi~~~~~~~~~  183 (332)
                      .|+++||+||+|  |+|......+...|++|+.+.++++..
T Consensus         5 ~gK~~lVTGaag~rGIG~aiA~~la~~Ga~Vvi~~~~~~~~   45 (256)
T PRK08594          5 EGKTYVVMGVANKRSIAWGIARSLHNAGAKLVFTYAGERLE   45 (256)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCHHH
T ss_conf             99889998999996399999999998799999974880669


No 293
>COG2521 Predicted archaeal methyltransferase [General function prediction only]
Probab=90.94  E-value=0.047  Score=32.69  Aligned_cols=115  Identities=24%  Similarity=0.293  Sum_probs=63.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222222113444443222221222222-221112232211111122----33-2222222221111222222222
Q gi|254780290|r  140 TANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKL----GA-KHAINYLKEDFLEILQKETQGR  213 (332)
Q Consensus       140 ~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~l----Ga-~~vi~~~~~~~~~~i~~~t~g~  213 (332)
                      ..+++.|++||=+  |+|.|..|+. |...|+ +|+.+..+++-+++++-.    +. +..|.---.|..+.++.. ...
T Consensus       129 ~V~~~~G~rVLDt--C~GLGYtAi~-a~~rGA~~VitvEkdp~VLeLa~lNPwSr~l~~~~i~iilGD~~e~V~~~-~D~  204 (287)
T COG2521         129 LVKVKRGERVLDT--CTGLGYTAIE-ALERGAIHVITVEKDPNVLELAKLNPWSRELFEIAIKIILGDAYEVVKDF-DDE  204 (287)
T ss_pred             EECCCCCCEEEEE--CCCCCHHHHH-HHHCCCCEEEEEEECCCEEEEECCCCCCCCCCCCCCEEECCCHHHHHHCC-CCC
T ss_conf             4443668784432--4671389999-98758748999960877277413588984202003178616599997418-865


Q ss_pred             CCCCCC-CCC-----C----CCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCH
Q ss_conf             111222-211-----1----11122222112234530479833787543222433
Q gi|254780290|r  214 GIDIIL-DMV-----G----AEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNP  258 (332)
Q Consensus       214 g~Divi-d~~-----G----~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~  258 (332)
                      .||++| |..     |    -...++.++.|++||++..+-...+...-..|+..
T Consensus       205 sfDaIiHDPPRfS~AgeLYseefY~El~RiLkrgGrlFHYvG~Pg~ryrG~d~~~  259 (287)
T COG2521         205 SFDAIIHDPPRFSLAGELYSEEFYRELYRILKRGGRLFHYVGNPGKRYRGLDLPK  259 (287)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCHHH
T ss_conf             3016860797331023576899999999970769807997279874024677147


No 294
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities . Apart from the ubiquinone/menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the ubiE gene of Escherichia coli), the ubiquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the COQ5 gene of Saccharomyces cerevisiae) and the menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the MENH gene of Bacillus subtilis), this family also includes methyltransferases involved in biotin and sterol biosynthesis and in phosphatidylethanolamine methylation.; GO: 0008168 methyltransferase activity.
Probab=90.94  E-value=0.038  Score=33.30  Aligned_cols=117  Identities=25%  Similarity=0.233  Sum_probs=67.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC----------CCCCCCCCCCCCCCCCCCCC-CCC-CCCCCCCCCCC-CCCCC
Q ss_conf             2222222211344444322222122222----------22211122322111111223-322-22222221111-22222
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFG----------ATVYTTAKSEEKCLACLKLG-AKH-AINYLKEDFLE-ILQKE  209 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G----------~~vi~~~~~~~~~~~~~~lG-a~~-vi~~~~~~~~~-~i~~~  209 (332)
                      .+++++||=.  |+|+|=+|++++|..|          ++|++++.|++=++.+++-. ..+ .+....-.|.+ ...++
T Consensus        41 ~k~~~~~LDv--A~GTGD~a~~~~k~~~~~~~a~~~~~~~vtg~D~S~~ML~~a~kk~~~~~r~~~~~~~~f~~~dA~~L  118 (242)
T TIGR01934        41 GKKGQKVLDV--ACGTGDLAIELAKKAGKVGKAAETERAKVTGVDFSEEMLEVAKKKAPNEERKALSANVSFIEADAEAL  118 (242)
T ss_pred             CCCCCCEEEE--ECCHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCHHEECHHHCC
T ss_conf             8888977887--23839999999863575553357763378987079889999987413420033321642110005508


Q ss_pred             CCCCCCCCCCCCCC-----------CCCCCCCCCCCCCCCCCEEEEECCCCCCCCC-CCCHHHCCCC
Q ss_conf             22221112222111-----------1112222211223453047983378754322-2433430532
Q gi|254780290|r  210 TQGRGIDIILDMVG-----------AEYLNQHLTLLSKEGKLIIISFLGGNIATEI-NLNPIISKRI  264 (332)
Q Consensus       210 t~g~g~Divid~~G-----------~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~-~~~~~~~~~~  264 (332)
                      --   -|-.||++.           ...++..++.|+|||+++++-.........+ +...++.+++
T Consensus       119 PF---~D~sFD~~TiaFGlRN~~d~~~aL~E~~RVLKpgG~l~iLEf~~P~~~~~~~~~Y~~Y~~~v  182 (242)
T TIGR01934       119 PF---EDNSFDAVTIAFGLRNVTDIQKALREMYRVLKPGGRLVILEFSKPANGAFLKKFYKFYLKNV  182 (242)
T ss_pred             CC---CCCCEEEEEEECCCCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCH
T ss_conf             79---98624446640255474686789877311018898799840786764168899999885000


No 295
>pfam00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain.
Probab=90.88  E-value=0.042  Score=33.01  Aligned_cols=109  Identities=16%  Similarity=0.259  Sum_probs=70.1

Q ss_pred             CCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             221112222-2222222211344444322222122222222111223221111112233222222222111122222222
Q gi|254780290|r  134 WANLFQTAN-LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQG  212 (332)
Q Consensus       134 ~~~l~~~~~-~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g  212 (332)
                      +.++.+.-+ +-+|++++|.| =|-+|.-..+-++.+|++|+++...|-+.-.+.--|...      ....+.+.     
T Consensus        10 ~d~i~r~tn~llaGk~vvV~G-YG~~GkGvA~~~rg~Ga~V~V~EvDPi~aleA~mdGf~V------~~~~ea~~-----   77 (162)
T pfam00670        10 IDGIKRATDVMIAGKVAVVCG-YGDVGKGCAASLKGQGARVIVTEIDPICALQAAMEGFQV------VTLEEVVK-----   77 (162)
T ss_pred             HHHHHHHHCCEECCCEEEEEC-CCCCCHHHHHHHHCCCCEEEEEECCCHHHHHHHHCCCCC------CCHHHHHH-----
T ss_conf             999988617657487899967-876677799986229998999947930699998649954------78889860-----


Q ss_pred             CCCCCCCCCCCC-CCC-CCCCCCCCCCCCCEEEEECCCCCCCCCCCCHH
Q ss_conf             211122221111-112-22221122345304798337875432224334
Q gi|254780290|r  213 RGIDIILDMVGA-EYL-NQHLTLLSKEGKLIIISFLGGNIATEINLNPI  259 (332)
Q Consensus       213 ~g~Divid~~G~-~~~-~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~  259 (332)
                       -.|+++.++|. +.+ ...++.|+.+..++.+|..    ..+++...+
T Consensus        78 -~aDi~VTaTG~~~vi~~eh~~~mKdgaIlaN~GHf----d~EIdv~~L  121 (162)
T pfam00670        78 -KADIFVTTTGNKDIITGEHMAKMKNDAIVCNIGHF----DNEIDVAWL  121 (162)
T ss_pred             -CCCEEEECCCCCCCCCHHHHHHHCCCEEEECCCCC----CCEEEHHHH
T ss_conf             -49999992489774739999984488699877756----522728888


No 296
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase. Shikimate dehydrogenase (DH) is an amino acid DH family member. Shikimate pathway links metabolism of carbohydrates to de novo biosynthesis of aromatic amino acids, quinones and folate. It is essential in plants, bacteria, and fungi but absent in mammals, thus making enzymes involved in this pathway ideal targets for broad spectrum antibiotics and herbicides. Shikimate DH catalyzes the reduction of 3-hydroshikimate to shikimate using the cofactor NADH. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann
Probab=90.85  E-value=0.023  Score=34.72  Aligned_cols=81  Identities=21%  Similarity=0.232  Sum_probs=48.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             111222222222222113444443222221222222-221112232211111-122332222222221111222222222
Q gi|254780290|r  136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLAC-LKLGAKHAINYLKEDFLEILQKETQGR  213 (332)
Q Consensus       136 ~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~-~~lGa~~vi~~~~~~~~~~i~~~t~g~  213 (332)
                      +|.+..--..++++||.| +||.+.+++.-+...|+ +++.+.|+.+|.+.+ +.++.... .....+..+.      ..
T Consensus         9 ~l~~~~~~~~~k~vlIlG-aGGaarai~~aL~~~g~~~I~i~nR~~~r~~~l~~~~~~~~~-~~~~~~~~~~------~~   80 (155)
T cd01065           9 ALEEAGIELKGKKVLILG-AGGAARAVAYALAELGAAKIVIVNRTLEKAKALAERFGELGI-AIAYLDLEEL------LA   80 (155)
T ss_pred             HHHHCCCCCCCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCC-CEEECCHHHH------HC
T ss_conf             999729985799999986-758999999999971998228860899999999998501366-4010453443------15


Q ss_pred             CCCCCCCCCCC
Q ss_conf             11122221111
Q gi|254780290|r  214 GIDIILDMVGA  224 (332)
Q Consensus       214 g~Divid~~G~  224 (332)
                      .+|++++|+..
T Consensus        81 ~~dliIN~tp~   91 (155)
T cd01065          81 EADLIINTTPV   91 (155)
T ss_pred             CCCEEEECCCC
T ss_conf             68879876778


No 297
>pfam02475 Met_10 Met-10+ like-protein. The methionine-10 mutant allele of N. crassa codes for a protein of unknown function. However, homologous proteins have been found in yeast suggesting this protein may be involved in methionine biosynthesis, transport and/or utilisation.
Probab=90.84  E-value=0.034  Score=33.62  Aligned_cols=93  Identities=18%  Similarity=0.246  Sum_probs=60.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222221134444432222212222-2222111223221111112----2332222222221111222222222111
Q gi|254780290|r  142 NLRSGQTVLIHGGSSGIGTTAIQLASYF-GATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQGRGID  216 (332)
Q Consensus       142 ~~~~g~~vlV~ga~g~vG~~a~qla~~~-G~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~g~g~D  216 (332)
                      .+++|++|+-.  -.|+|-+++.+|+.. ..+|++++-|+...+++++    .+.+..+..-+.|..+.+    ....+|
T Consensus        97 ~~~~ge~VlD~--faGvG~f~l~~ak~~~~~~V~a~DlNp~a~~~l~~N~~lN~v~~~i~~~~gD~~~~~----~~~~~D  170 (199)
T pfam02475        97 LVKEGEVVVDM--FAGIGPFSIPIAKHSKAKRVYAVELNPEAVKYLKENIKLNKVEGVISPILGDVRDVI----LEGVAD  170 (199)
T ss_pred             HCCCCCEEEEC--CCCCCHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHC----CCCCCC
T ss_conf             44899889981--688657789986407864899982899999999999998099983699928787860----467400


Q ss_pred             CCCC-CCC--CCCCCCCCCCCCCCCCC
Q ss_conf             2222-111--11122222112234530
Q gi|254780290|r  217 IILD-MVG--AEYLNQHLTLLSKEGKL  240 (332)
Q Consensus       217 ivid-~~G--~~~~~~~~~~l~~~G~i  240 (332)
                      .|+- ...  .+.+..++++++++|.+
T Consensus       171 rvimnlP~~a~~fL~~A~~~lk~gg~i  197 (199)
T pfam02475       171 RVIMNLPKSAHEFLDKALRAVKDGGVI  197 (199)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCCEE
T ss_conf             999489731699999999985589898


No 298
>PRK00536 speE spermidine synthase; Provisional
Probab=90.80  E-value=0.027  Score=34.29  Aligned_cols=93  Identities=17%  Similarity=0.079  Sum_probs=54.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C-CCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             2222113444443222221222222221112232211111122-3-32222222221111222222222111222-2111
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKL-G-AKHAINYLKEDFLEILQKETQGRGIDIIL-DMVG  223 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~l-G-a~~vi~~~~~~~~~~i~~~t~g~g~Divi-d~~G  223 (332)
                      ++|||+|  ||-|-.+=.++|+. .+|..+...+.=.+.++++ . ....++...-.......+.+. +.+|+|| |+.-
T Consensus        74 k~VLIIG--GGDGG~~REvlKH~-~~v~~VEID~~Vv~~sk~ylP~~~~~~~dpr~~~~~~~~~~~~-~~fDvIIvDsl~  149 (262)
T PRK00536         74 KEVLIVD--GFDLELAHQLFKYD-THVDFVQADEKILDSFISFFPHFHEVKNNKNFTHAKQLLDLDI-KKYDLIICLQEP  149 (262)
T ss_pred             CEEEEEC--CCCHHHHHHHHCCC-CEEEEEEECHHHHHHHHHHCHHHHHHHCCCCEEHHHHHHHHCC-CCCCEEEECCCC
T ss_conf             8799986--87559999987289-7669999678999999997856565413996113999876154-766889988999


Q ss_pred             C-CCCCCCCCCCCCCCCCEEE
Q ss_conf             1-1122222112234530479
Q gi|254780290|r  224 A-EYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       224 ~-~~~~~~~~~l~~~G~iv~~  243 (332)
                      . ...+.+.++|+++|.+++-
T Consensus       150 ~~~~~~~l~~~L~~~Gi~v~Q  170 (262)
T PRK00536        150 DIHKIDGLKRMLKEDGVFISV  170 (262)
T ss_pred             CCCHHHHHHHHHCCCCEEEEC
T ss_conf             805499999985899899983


No 299
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
Probab=90.80  E-value=0.021  Score=35.05  Aligned_cols=77  Identities=19%  Similarity=0.206  Sum_probs=42.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC-------CCCCCCCCCCC---CCCCCCCCCCCCCCCCC--CCC
Q ss_conf             222113444443222221222222-221112232211-------11112233222---22222211112222222--221
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKC-------LACLKLGAKHA---INYLKEDFLEILQKETQ--GRG  214 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~-------~~~~~lGa~~v---i~~~~~~~~~~i~~~t~--g~g  214 (332)
                      ++||+||++++|....+.+...|+ +|+.+.|++...       +.+++.|.+..   .|-++++-.+.+.+...  ..+
T Consensus         2 tvlVTGas~GIG~~~a~~la~~Ga~~vvl~~R~~~~~~~~~~~~~~~~~~g~~v~~~~~Dv~~~~~~~~~v~~~~~~~g~   81 (180)
T smart00822        2 TYLITGGLGGLGLELARWLAERGARHLVLLSRSGPDAPGAAELLAELEALGAEVTVVACDVADRAALAAALAAIPARLGP   81 (180)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             99997878799999999999879988999868987818899999999956996999980268867766677767997398


Q ss_pred             CCCCCCCCCC
Q ss_conf             1122221111
Q gi|254780290|r  215 IDIILDMVGA  224 (332)
Q Consensus       215 ~Divid~~G~  224 (332)
                      +|.++++.|.
T Consensus        82 id~lvn~AG~   91 (180)
T smart00822       82 LRGVIHAAGV   91 (180)
T ss_pred             EEEEEEECCC
T ss_conf             3799942466


No 300
>PRK13243 glyoxylate reductase; Reviewed
Probab=90.76  E-value=0.22  Score=28.25  Aligned_cols=86  Identities=24%  Similarity=0.343  Sum_probs=51.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-
Q ss_conf             2222221134444432222212222222211122322111111223322222222211112222222221112222111-
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG-  223 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G-  223 (332)
                      .|.++.|.| .|.+|....++|+.+|++|++..+... .+..+++|++.+      ++.+-+.+      .|++.-++- 
T Consensus       149 ~gktlGIiG-~G~IG~~vak~~~~fgm~V~~~d~~~~-~~~~~~~~~~~~------~l~ell~~------sDiIslh~Pl  214 (333)
T PRK13243        149 YGKTIGIVG-FGRIGQAIARRAKGFGMRILYYSRTRK-PEVEKELGAEYR------PLEDLLRE------SDFVVLAVPL  214 (333)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECCCCC-HHHHHHCCCEEE------CHHHHHHH------CCEEEECCCC
T ss_conf             788999979-256689999999976999999899898-667876096881------19997421------6526642558


Q ss_pred             -CC---CC-CCCCCCCCCCCCCEEEE
Q ss_conf             -11---12-22221122345304798
Q gi|254780290|r  224 -AE---YL-NQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       224 -~~---~~-~~~~~~l~~~G~iv~~G  244 (332)
                       .+   .+ +..++.|++++.++.++
T Consensus       215 t~eT~~li~~~~~~~MK~~a~lIN~a  240 (333)
T PRK13243        215 TKETYHMINEERLKLMKKTAILVNIA  240 (333)
T ss_pred             CCCCCCCCCHHHHHHCCCCEEEEECC
T ss_conf             60134613699997179981999858


No 301
>TIGR01138 cysM cysteine synthase B; InterPro: IPR005858    Cysteine synthase B (O-acetylserine (thiol)-lyase, 2.5.1.47 from EC) is the enzyme responsible for the formation of cysteine from O-acetyl-serine and hydrogen sulphide with the concomitant release of acetic acid. In bacteria such two forms of the enzyme are known (genes cysK and cysM). CysM differs from CysK (IPR005859 from INTERPRO) in that it can also use thiosulphate instead of sulphide, to produce cysteine thiosulphonate instead of cysteine. ; GO: 0004124 cysteine synthase activity, 0006535 cysteine biosynthetic process from serine.
Probab=90.59  E-value=0.12  Score=30.06  Aligned_cols=130  Identities=20%  Similarity=0.231  Sum_probs=72.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCC------CCCCCCCC
Q ss_conf             1222222222222113444443222221222222221112---23221111112233222222222------11112222
Q gi|254780290|r  138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTA---KSEEKCLACLKLGAKHAINYLKE------DFLEILQK  208 (332)
Q Consensus       138 ~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~---~~~~~~~~~~~lGa~~vi~~~~~------~~~~~i~~  208 (332)
                      ..++.+++|+ +||-+-+|.+|.+...++..+|.++.-+-   .+++|....+.+||+-++-...+      +|..++.+
T Consensus        54 ~~RG~Ik~G~-vlI~ATSGNTGIALAM~aA~~G~~~~L~MP~N~s~ERk~~~~AyGA~L~L~~~~~G~~GA~~l~~~l~~  132 (300)
T TIGR01138        54 EKRGEIKPGD-VLIEATSGNTGIALAMVAALKGYKMELLMPDNVSEERKAAMKAYGAELILVDKEEGMEGARDLARELVQ  132 (300)
T ss_pred             HHCCCCCCCC-EEEECCCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             8558856888-789716886789999999855942899778774579999998629548984423561568999999997


Q ss_pred             CCCCCCCCCCCCCCC-CCCCCCCCCCCC------CCCCCEEEEECCCCCCCCC---CCCHHHCCCCEEEEEE
Q ss_conf             222221112222111-111222221122------3453047983378754322---2433430532167775
Q gi|254780290|r  209 ETQGRGIDIILDMVG-AEYLNQHLTLLS------KEGKLIIISFLGGNIATEI---NLNPIISKRITITGST  270 (332)
Q Consensus       209 ~t~g~g~Divid~~G-~~~~~~~~~~l~------~~G~iv~~G~~~~~~~~~~---~~~~~~~~~~~i~g~~  270 (332)
                      ...++  -+++|-.. ++.++..+....      .+|++..+-..-|.-.+-+   .......+++++.|..
T Consensus       133 ~~~~K--yv~LDQf~Np~Np~AHy~sTG~EIW~QT~G~ITHFVss~GT~GTI~G~sR~lk~~~~~v~ivGlQ  202 (300)
T TIGR01138       133 KGEGK--YVLLDQFNNPDNPKAHYYSTGPEIWQQTGGRITHFVSSMGTTGTIMGVSRYLKEQNPNVQIVGLQ  202 (300)
T ss_pred             HCCCC--EEEEEECCCCCCCCCCEEECCCHHEECCCCEEEEEEECCCCCCEEECCEEEEEECCCCEEEEEEC
T ss_conf             37985--69974056988864553316800000589728898723688841431032332218852699712


No 302
>TIGR01035 hemA glutamyl-tRNA reductase; InterPro: IPR000343   Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway . The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including vitamin B12, haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin .   The first stage in tetrapyrrole synthesis is the synthesis of 5-aminoaevulinic acid ALA via two possible routes: (1) condensation of succinyl CoA and glycine (C4 pathway) using ALA synthase (2.3.1.37 from EC), or (2) decarboxylation of glutamate (C5 pathway) via three different enzymes, glutamyl-tRNA synthetase (6.1.1.17 from EC) to charge a tRNA with glutamate, glutamyl-tRNA reductase (1.2.1.70 from EC) to reduce glutamyl-tRNA to glutamate-1-semialdehyde (GSA), and GSA aminotransferase (5.4.3.8 from EC) to catalyse a transamination reaction to produce ALA.   The second stage is to convert ALA to uroporphyrinogen III, the first macrocyclic tetrapyrrolic structure in the pathway. This is achieved by the action of three enzymes in one common pathway: porphobilinogen (PBG) synthase (or ALA dehydratase, 4.2.1.24 from EC) to condense two ALA molecules to generate porphobilinogen; hydroxymethylbilane synthase (or PBG deaminase, 2.5.1.61 from EC) to polymerise four PBG molecules into preuroporphyrinogen (tetrapyrrole structure); and uroporphyrinogen III synthase (4.2.1.75 from EC) to link two pyrrole units together (rings A and D) to yield uroporphyrinogen III.   Uroporphyrinogen III is the first branch point of the pathway. To synthesise cobalamin (vitamin B12), sirohaem, and coenzyme F430, uroporphyrinogen III needs to be converted into precorrin-2 by the action of uroporphyrinogen III methyltransferase (2.1.1.107 from EC). To synthesise haem and chlorophyll, uroporphyrinogen III needs to be decarboxylated into coproporphyrinogen III by the action of uroporphyrinogen III decarboxylase (4.1.1.37 from EC) .   This entry represents glutamyl-tRNA reductase (1.2.1.70 from EC), which reduces glutamyl-tRNA to glutamate-1-semialdehyde during the first stage of tetrapyrrole biosynthesis by the C5 pathway , . This enzyme required NADPH as a coenzyme.; GO: 0008883 glutamyl-tRNA reductase activity, 0050661 NADP binding, 0033014 tetrapyrrole biosynthetic process.
Probab=90.38  E-value=0.032  Score=33.85  Aligned_cols=74  Identities=24%  Similarity=0.404  Sum_probs=54.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC-CCCCCCCC-CCCCCCC---CCCCCCCCCCCCCCCCCC
Q ss_conf             22222222113444443222221222222-221112232211-11112233-2222222---221111222222222111
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKC-LACLKLGA-KHAINYL---KEDFLEILQKETQGRGID  216 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~-~~~~~lGa-~~vi~~~---~~~~~~~i~~~t~g~g~D  216 (332)
                      | .+.++||.| +|-+|.+++..++..|+ +|+.+=|+.+|. ++++++|. .. +...   =+++.+.|.+      +|
T Consensus       183 L-~~~~~LliG-AGeMg~Lva~~L~~~~v~~~~i~NRt~~rA~~LA~e~~~P~~-~~f~~La~~~L~~~L~~------~D  253 (436)
T TIGR01035       183 L-KGKKVLLIG-AGEMGELVAKHLREKGVGKVLIANRTYERAEKLAKELGGPEA-VKFEALALEKLEEALAE------AD  253 (436)
T ss_pred             C-CCCEEEEEE-CCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCC-CCCCHHHHHHHHHHHHH------CC
T ss_conf             1-664189982-745799999999648952898855677899999987078664-54445548999999742------88


Q ss_pred             CCCCCCCCC
Q ss_conf             222211111
Q gi|254780290|r  217 IILDMVGAE  225 (332)
Q Consensus       217 ivid~~G~~  225 (332)
                      +||-++|..
T Consensus       254 ivissTgA~  262 (436)
T TIGR01035       254 IVISSTGAP  262 (436)
T ss_pred             EEEEECCCC
T ss_conf             999855765


No 303
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed
Probab=90.33  E-value=0.024  Score=34.59  Aligned_cols=71  Identities=24%  Similarity=0.353  Sum_probs=51.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222-221112232211-111122332222222221111222222222111222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKC-LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMV  222 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~-~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~  222 (332)
                      .+.++||.| +|-+|..+++.++..|+ +++.+-|+.+|. +++.++|+. ++++.+  +.+.+.      .+|+||-|+
T Consensus       181 ~~~~vlviG-aGem~~l~~k~L~~~g~~~i~v~nRt~~ra~~la~~~~~~-~~~~~~--l~~~l~------~~DvvisaT  250 (429)
T PRK00045        181 SGKKVLVIG-AGEMGELVAKHLAEKGVRKITVANRTLERAEELAEEFGAE-AIPLEE--LPEALA------EADIVISST  250 (429)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCE-EECHHH--HHHHHH------HCCEEEEEC
T ss_conf             206599976-7489999999998559984999758677899999975988-974999--999996------589999944


Q ss_pred             CCC
Q ss_conf             111
Q gi|254780290|r  223 GAE  225 (332)
Q Consensus       223 G~~  225 (332)
                      |.+
T Consensus       251 ~s~  253 (429)
T PRK00045        251 AAP  253 (429)
T ss_pred             CCC
T ss_conf             899


No 304
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]
Probab=90.28  E-value=0.037  Score=33.39  Aligned_cols=92  Identities=25%  Similarity=0.301  Sum_probs=57.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCC--
Q ss_conf             2222221134444432222212222222211122322111111223322--222222211112222222221112222--
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKH--AINYLKEDFLEILQKETQGRGIDIILD--  220 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~--vi~~~~~~~~~~i~~~t~g~g~Divid--  220 (332)
                      +|.+||=.|. |+ |++..-+|+ +|++|++++-+++..+.++......  .+||...... ++.+  .|..||+|+.  
T Consensus        59 ~g~~vLDvGC-Gg-G~Lse~mAr-~Ga~VtgiD~se~~I~~Ak~ha~e~gv~i~y~~~~~e-dl~~--~~~~FDvV~cmE  132 (243)
T COG2227          59 PGLRVLDVGC-GG-GILSEPLAR-LGASVTGIDASEKPIEVAKLHALESGVNIDYRQATVE-DLAS--AGGQFDVVTCME  132 (243)
T ss_pred             CCCEEEEECC-CC-CHHHHHHHH-CCCEEEEECCCHHHHHHHHHHHHHCCCCCCCHHHHHH-HHHH--CCCCCCEEEEHH
T ss_conf             7770887458-83-286499997-7994697438767789998754424632252233299-9972--489744897735


Q ss_pred             ---CCCC--CCCCCCCCCCCCCCCCEE
Q ss_conf             ---1111--112222211223453047
Q gi|254780290|r  221 ---MVGA--EYLNQHLTLLSKEGKLII  242 (332)
Q Consensus       221 ---~~G~--~~~~~~~~~l~~~G~iv~  242 (332)
                         .+-.  ..+..+.++++|+|++..
T Consensus       133 VlEHv~dp~~~~~~c~~lvkP~G~lf~  159 (243)
T COG2227         133 VLEHVPDPESFLRACAKLVKPGGILFL  159 (243)
T ss_pred             HHHCCCCHHHHHHHHHHHCCCCCEEEE
T ss_conf             877169999999999986299928999


No 305
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=90.22  E-value=0.025  Score=34.57  Aligned_cols=35  Identities=20%  Similarity=0.302  Sum_probs=28.5

Q ss_pred             CCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211344--444322222122222222111223
Q gi|254780290|r  145 SGQTVLIHGGS--SGIGTTAIQLASYFGATVYTTAKS  179 (332)
Q Consensus       145 ~g~~vlV~ga~--g~vG~~a~qla~~~G~~vi~~~~~  179 (332)
                      .|+++||+||+  +|+|.+.++-+...|++|+.+.++
T Consensus         5 ~gKvalVTGas~~~GIG~aiA~~la~~Ga~Vvi~~~~   41 (257)
T PRK12859          5 KNKVAVVTGVSRLDGIGAAICKELAEAGYDIFFTYWT   41 (257)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEECC
T ss_conf             9888999288999862999999999879989998365


No 306
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=90.21  E-value=0.035  Score=33.57  Aligned_cols=22  Identities=23%  Similarity=0.123  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             8999999999982998132898
Q gi|254780290|r  309 LGKVAMAHDIMEKSEHIGKIIL  330 (332)
Q Consensus       309 l~~i~~A~~~l~~g~~~GKvVi  330 (332)
                      .++.++|.+...+--..|.+|+
T Consensus       398 ~~~l~~Av~~a~~~a~~gd~VL  419 (450)
T PRK02472        398 ADNVEDAVPKAYALSEPGDVIL  419 (450)
T ss_pred             CCCHHHHHHHHHHHCCCCCEEE
T ss_conf             7999999999998588959899


No 307
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008   Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase . In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase .    There are at least two distinct cobalamin biosynthetic pathways in bacteria :  Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway ; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis ; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii shermanii.     Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) . There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans.   This entry represents CbiT subunit of precorrin-6Y C5,15-methyltransferase (2.1.1.132 from EC) from the anaerobic pathway, a bifunctional enzyme that catalyses two methylations (at C-5 and C-15) in precorrin-6Y, as well as the decarboxylation of the acetate side chain located in ring C, in order to generate precorrin-8X. In the anaerobic pathway, two enzymes are required to produce precorrin-8X: CbiE and CbiT, which can be fused as CbiET (sometimes called CobL) . In the aerobic pathway, the bifunctional enzyme is CobL .; GO: 0008276 protein methyltransferase activity, 0009236 cobalamin biosynthetic process.
Probab=89.97  E-value=0.077  Score=31.29  Aligned_cols=102  Identities=18%  Similarity=0.226  Sum_probs=63.7

Q ss_pred             CCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCC----CC-CCCCCCCCCCCCCC-----CC
Q ss_conf             222222222-22211344444322222122222--22211122322111111----22-33222222222111-----12
Q gi|254780290|r  139 QTANLRSGQ-TVLIHGGSSGIGTTAIQLASYFG--ATVYTTAKSEEKCLACL----KL-GAKHAINYLKEDFL-----EI  205 (332)
Q Consensus       139 ~~~~~~~g~-~vlV~ga~g~vG~~a~qla~~~G--~~vi~~~~~~~~~~~~~----~l-Ga~~vi~~~~~~~~-----~~  205 (332)
                      ...++++++ +++=.||  |.|..++.+++..+  .+|+++.++++...+.+    +| +++.+.- -..++.     ..
T Consensus        13 ~~L~l~~~~~v~wDIGa--GtGS~~iE~~~~~p~~g~v~aiEr~~~~~~~~~~N~~~~c~~~~~~i-~~g~ap~~~~~~~   89 (135)
T TIGR02469        13 AKLRLRPGDSVLWDIGA--GTGSVTIEAARLVPNSGRVYAIERNPEALRLIERNLRRFCGVSNIVI-VEGDAPEELLNSD   89 (135)
T ss_pred             HHHCCCCCCCEEEEECC--CCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCEE-EECCCCCCCCCCC
T ss_conf             87178999946889605--74838999997359860799985376898799999998289996325-6355684333677


Q ss_pred             CC-CCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCEEE
Q ss_conf             22-22222211122221111----1122222112234530479
Q gi|254780290|r  206 LQ-KETQGRGIDIILDMVGA----EYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       206 i~-~~t~g~g~Divid~~G~----~~~~~~~~~l~~~G~iv~~  243 (332)
                      .. ..+.-.-+|.||=-=|+    +.++.+++.|+++|+++.-
T Consensus        90 ~~~~~~~~~~~Da~fvGGs~~~~~~il~~~~~~l~~GGr~v~n  132 (135)
T TIGR02469        90 APEDSAKLPEPDAVFVGGSGGKLEEILEAVERRLRPGGRIVLN  132 (135)
T ss_pred             CCHHHCCCCCCCEEEECCCCHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             7710058874688888389717899999998505968888885


No 308
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, 
Probab=89.95  E-value=0.026  Score=34.37  Aligned_cols=72  Identities=24%  Similarity=0.407  Sum_probs=51.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222-221112232211-111122332222222221111222222222111222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKC-LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMV  222 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~-~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~  222 (332)
                      .+.++||.| +|-+|..+++.++..|+ +++.+-|+.+|. +++.++|.. ++++.+  +.+.+.      .+|+||-++
T Consensus       177 ~~~~vLviG-aGem~~l~~~~L~~~g~~~i~v~nRt~~ra~~la~~~g~~-~~~~~~--l~~~l~------~~DvvisaT  246 (311)
T cd05213         177 KGKKVLVIG-AGEMGELAAKHLAAKGVAEITIANRTYERAEELAKELGGN-AVPLDE--LLELLN------EADVVISAT  246 (311)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCE-EECHHH--HHHHHH------HCCEEEEEC
T ss_conf             116799986-8799999999999659982599768678999999974989-972999--999997------689999927


Q ss_pred             CCCC
Q ss_conf             1111
Q gi|254780290|r  223 GAEY  226 (332)
Q Consensus       223 G~~~  226 (332)
                      |.+.
T Consensus       247 ~s~~  250 (311)
T cd05213         247 GAPH  250 (311)
T ss_pred             CCCC
T ss_conf             9996


No 309
>PRK09730 hypothetical protein; Provisional
Probab=89.85  E-value=0.028  Score=34.16  Aligned_cols=174  Identities=14%  Similarity=0.150  Sum_probs=83.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC----CCCCCCCCCC---CCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             22211344444322222122222222111223-22111----1112233222---2222221----11122222222211
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKS-EEKCL----ACLKLGAKHA---INYLKED----FLEILQKETQGRGI  215 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~-~~~~~----~~~~lGa~~v---i~~~~~~----~~~~i~~~t~g~g~  215 (332)
                      .+||+||++++|...++.+...|++|+.+.+. ++..+    .+++.|....   .|-++++    +.+++.+.  ..++
T Consensus         3 ValITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~i~~~--~g~i   80 (247)
T PRK09730          3 IALVTGGSRGIGRATALLLAQEGYTVAVNYQQNLHAAQEVVNLITQAGGKAFVLQADISDENQVVAMFTAIDQH--DEPL   80 (247)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH--CCCC
T ss_conf             99990622699999999999879999996699878999999999974992899982589999999999999997--5995


Q ss_pred             CCCCCCCCC----CCCC-----------------------CCCCCCC-----CCCCCEEEEECCCCCCCCCC--------
Q ss_conf             122221111----1122-----------------------2221122-----34530479833787543222--------
Q gi|254780290|r  216 DIILDMVGA----EYLN-----------------------QHLTLLS-----KEGKLIIISFLGGNIATEIN--------  255 (332)
Q Consensus       216 Divid~~G~----~~~~-----------------------~~~~~l~-----~~G~iv~~G~~~~~~~~~~~--------  255 (332)
                      |+.+++.|.    ..++                       ..++.+.     .+|+++.++...+....+-.        
T Consensus        81 d~LVNNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~~~m~~~~~~~~g~IVnisS~~~~~g~~~~~~~Y~asK  160 (247)
T PRK09730         81 AALVNNAGILFTQCTVENLTAERINRVLSTNVTGYFLCCREAVKRMALKNGGSGGAIVNVSSVASRLGSPGEYVDYAASK  160 (247)
T ss_pred             EEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEHHHCCCCCCCHHHHHHHH
T ss_conf             59998986356899813399999999999973899999999999999962899976999812654658984127779999


Q ss_pred             ----------CCHHHCCCCEEEEEEECCCH-HCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCC--
Q ss_conf             ----------43343053216777512400-01137899999999999998698310212474189999999999829--
Q gi|254780290|r  256 ----------LNPIISKRITITGSTLRRRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS--  322 (332)
Q Consensus       256 ----------~~~~~~~~~~i~g~~~~~~~-~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g--  322 (332)
                                ..++-..++++....-+... +.....    ...+..+.+.+.  .|. .+.=..+|+.++...|.+.  
T Consensus       161 aav~~ltk~lA~ela~~gIrVN~IaPG~i~T~~~~~~----~~~~~~~~~~~~--~Pl-~R~g~pedia~~v~fL~Sd~a  233 (247)
T PRK09730        161 GAIDTLTTGLSLEVAAQGIRVNCVRPGFIYTEMHASG----GEPGRVDRVKSN--IPM-QRGGQAEEVAQAIVWLLSDKA  233 (247)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCC----CCHHHHHHHHHC--CCC-CCCCCHHHHHHHHHHHHCCHH
T ss_conf             9999999999999705492899997788978543234----996999999857--998-998499999999999968722


Q ss_pred             -CCCCEEEE
Q ss_conf             -98132898
Q gi|254780290|r  323 -EHIGKIIL  330 (332)
Q Consensus       323 -~~~GKvVi  330 (332)
                       -.+|-++.
T Consensus       234 ~~iTGq~i~  242 (247)
T PRK09730        234 SYVTGSFID  242 (247)
T ss_pred             CCCCCCEEE
T ss_conf             483483478


No 310
>pfam05175 MTS Methyltransferase small domain. This domain is found in ribosomal RNA small subunit methyltransferase C as well as other methyltransferases .
Probab=89.69  E-value=0.053  Score=32.36  Aligned_cols=104  Identities=17%  Similarity=0.156  Sum_probs=63.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222222221134444432222212222-2222111223221111112----2332222222221111222222222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYF-GATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQGR  213 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~-G~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~g~  213 (332)
                      +.....++.+||=.|.  |.|.+++.+|+.. .++|++++.++...+.+++    .|.+. +.....|..+.+    ...
T Consensus        25 ~~l~~~~~g~vLDlGc--G~G~i~~~la~~~p~~~v~~vDi~~~Al~~a~~N~~~n~l~~-v~v~~~D~~~~~----~~~   97 (170)
T pfam05175        25 SHLPKPLGGKVLDLGC--GYGVLGAALAKRSPDLEVTMVDINARALESARANLAANGLEN-GEVFWSDLYSAV----EPG   97 (170)
T ss_pred             HCCCCCCCCCEEEECC--CCCHHHHHHHHHCCCCEEEECHHHHHHHHHHHHHHHHHCCCE-EEEEECCCCCCC----CCC
T ss_conf             7089778994999776--482989999997898679851544999999999999809984-899974466657----788


Q ss_pred             CCCCCCCC----CCC--------CCCCCCCCCCCCCCCCEEEEECCCC
Q ss_conf             11122221----111--------1122222112234530479833787
Q gi|254780290|r  214 GIDIILDM----VGA--------EYLNQHLTLLSKEGKLIIISFLGGN  249 (332)
Q Consensus       214 g~Divid~----~G~--------~~~~~~~~~l~~~G~iv~~G~~~~~  249 (332)
                      .||+|+..    .|.        ..+..+.+.|+++|.+..+.+..-.
T Consensus        98 ~fD~IvsNPP~h~g~~~~~~~~~~~i~~A~~~L~pgG~l~~V~n~~l~  145 (170)
T pfam05175        98 KFDLIISNPPFHAGKATDYDVAQRFIAGAARHLKPGGELWIVANRHLG  145 (170)
T ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEECCCC
T ss_conf             660899897721142032899999999999961649799999989999


No 311
>KOG1122 consensus
Probab=89.30  E-value=0.15  Score=29.45  Aligned_cols=137  Identities=20%  Similarity=0.294  Sum_probs=69.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             3333322111111122222223222122222233322211122222222222211-344444322222122222222111
Q gi|254780290|r   98 GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIH-GGSSGIGTTAIQLASYFGATVYTT  176 (332)
Q Consensus        98 G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~-ga~g~vG~~a~qla~~~G~~vi~~  176 (332)
                      |-|..-.++=-+..+++|..=... +--+.+..+.+... +.....++|++||=- +|-||=......+.+..| -|+|-
T Consensus       196 ~~ws~vgl~v~~s~vpigat~e~l-ag~~~LQ~~sS~Lp-v~aL~Pq~gERIlDmcAAPGGKTt~IAalMkn~G-~I~An  272 (460)
T KOG1122         196 GKWSKVGLVVFDSVVPIGATPEYL-AGHYMLQNASSFLP-VMALDPQPGERILDMCAAPGGKTTHIAALMKNTG-VIFAN  272 (460)
T ss_pred             CCCCCCEEEEECCCCCCCCCHHHC-CCCEEECCCCCCCE-EEECCCCCCCEECCHHCCCCCHHHHHHHHHCCCC-EEEEC
T ss_conf             400042089953731157753323-55124226762352-4520799887112121079950778999872774-69961


Q ss_pred             CCCCCCCCCC----CCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCC-C--CCCCC----------------------
Q ss_conf             2232211111----122332222--222221111222222222111222-2--11111----------------------
Q gi|254780290|r  177 AKSEEKCLAC----LKLGAKHAI--NYLKEDFLEILQKETQGRGIDIIL-D--MVGAE----------------------  225 (332)
Q Consensus       177 ~~~~~~~~~~----~~lGa~~vi--~~~~~~~~~~i~~~t~g~g~Divi-d--~~G~~----------------------  225 (332)
                      +.+..+...+    .++|++.+|  |+....|.+..   ..+ +||.|+ |  |.|..                      
T Consensus       273 D~n~~r~~~l~~n~~rlGv~ntiv~n~D~~ef~~~~---~~~-~fDRVLLDAPCSGtgvi~K~~~vkt~k~~~di~~~~~  348 (460)
T KOG1122         273 DSNENRLKSLKANLHRLGVTNTIVSNYDGREFPEKE---FPG-SFDRVLLDAPCSGTGVISKDQSVKTNKTVKDILRYAH  348 (460)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCC---CCC-CCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             354377999998899748774489736763255333---676-4231453487777755545510133012999987279


Q ss_pred             ----CCCCCCCCCCCCCCCE
Q ss_conf             ----1222221122345304
Q gi|254780290|r  226 ----YLNQHLTLLSKEGKLI  241 (332)
Q Consensus       226 ----~~~~~~~~l~~~G~iv  241 (332)
                          .+.+++.++++||.+|
T Consensus       349 LQr~LllsAi~lv~~GGvLV  368 (460)
T KOG1122         349 LQRELLLSAIDLVKAGGVLV  368 (460)
T ss_pred             HHHHHHHHHHHHCCCCCEEE
T ss_conf             99999999873115770899


No 312
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=89.22  E-value=0.057  Score=32.15  Aligned_cols=22  Identities=18%  Similarity=0.217  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             8999999999982998132898
Q gi|254780290|r  309 LGKVAMAHDIMEKSEHIGKIIL  330 (332)
Q Consensus       309 l~~i~~A~~~l~~g~~~GKvVi  330 (332)
                      .+.+++|++...+-...|-+|+
T Consensus       427 ~~~l~~av~~a~~~a~~gd~VL  448 (481)
T PRK01438        427 TEAMARAVRLAARLARPGDTVL  448 (481)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEE
T ss_conf             7899999999996389989899


No 313
>KOG1252 consensus
Probab=89.22  E-value=0.057  Score=32.15  Aligned_cols=57  Identities=25%  Similarity=0.282  Sum_probs=46.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCC
Q ss_conf             2222222222221134444432222212222222211122---32211111122332222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK---SEEKCLACLKLGAKHAI  195 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~---~~~~~~~~~~lGa~~vi  195 (332)
                      +.+.+.||.+.||-.-+|..|.....+|...|+++|.|..   |.+|+..++++|++.+.
T Consensus        96 ~~G~i~pg~stliEpTSGNtGigLA~~~a~~Gyk~i~tmP~~ms~Ek~~~l~a~Gaeii~  155 (362)
T KOG1252          96 KKGLITPGKSTLIEPTSGNTGIGLAYMAALRGYKCIITMPEKMSKEKRILLRALGAEIIL  155 (362)
T ss_pred             HCCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHHHCCCEEEE
T ss_conf             759855896179826998538999999997396399990424517899999971887995


No 314
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=89.06  E-value=0.082  Score=31.10  Aligned_cols=36  Identities=19%  Similarity=0.248  Sum_probs=18.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             221134444432222212222222211122322111
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL  184 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~  184 (332)
                      |||+||+|=+|...++-+...|.+|++++++..+..
T Consensus         3 iLVtG~tGfiG~~l~~~L~~~g~~V~~~~r~~~~~~   38 (314)
T COG0451           3 ILVTGGAGFIGSHLVERLLAAGHDVRGLDRLRDGLD   38 (314)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCC
T ss_conf             999928877799999999858997999917875431


No 315
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=89.04  E-value=0.045  Score=32.80  Aligned_cols=173  Identities=14%  Similarity=0.153  Sum_probs=83.6

Q ss_pred             CCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCC---------------CCCCCCCCCC---CCCCCCC---
Q ss_conf             22222211344--44432222212222222211122322111---------------1112233222---2222221---
Q gi|254780290|r  145 SGQTVLIHGGS--SGIGTTAIQLASYFGATVYTTAKSEEKCL---------------ACLKLGAKHA---INYLKED---  201 (332)
Q Consensus       145 ~g~~vlV~ga~--g~vG~~a~qla~~~G~~vi~~~~~~~~~~---------------~~~~lGa~~v---i~~~~~~---  201 (332)
                      .|+++||+||+  +|+|.+.++.....|++|+.+.++.+...               .+...|....   .|-++++   
T Consensus         4 ~gKvalVTGasr~~GIG~aiA~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~~~   83 (257)
T PRK12748          4 MKKIAIVTGASRLNGIGAAICRVLAQKGIDIFFTYWSQYDKAMPWGMHDKEPFLLKEEIESYGVRCEMLEIDLSQSYSPN   83 (257)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHH
T ss_conf             99889992889998549999999998799999970752554434234606799999999965982899984689999999


Q ss_pred             -CCCCCCCCCCCCCCCCCCCCCCCC---C--------CCC---------------CCCCC--CCCCCCEEEEECCCCCCC
Q ss_conf             -111222222222111222211111---1--------222---------------22112--234530479833787543
Q gi|254780290|r  202 -FLEILQKETQGRGIDIILDMVGAE---Y--------LNQ---------------HLTLL--SKEGKLIIISFLGGNIAT  252 (332)
Q Consensus       202 -~~~~i~~~t~g~g~Divid~~G~~---~--------~~~---------------~~~~l--~~~G~iv~~G~~~~~~~~  252 (332)
                       +.+.+.+.. | .+|+.+++.|..   .        |+.               .++.+  +.+|+++.++...+..+.
T Consensus        84 ~~~~~~~~~~-G-~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vN~~~~~~l~~~~~~~m~~~~~G~IInisS~~~~~~~  161 (257)
T PRK12748         84 RLFYMVSERL-G-DPSILINNAAYSTHTRIEELDVEQLDKHYAVNVRATMLLSSLFAKQFASKTGGRIINLTSGQSLGPM  161 (257)
T ss_pred             HHHHHHHHHC-C-CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHCCC
T ss_conf             9999999974-9-9989998998899999055999999999999838999999999998865389279998227860648


Q ss_pred             CCC-----------------CCHHHCCCCEEEEEEECCCH-HCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHH
Q ss_conf             222-----------------43343053216777512400-011378999999999999986983102124741899999
Q gi|254780290|r  253 EIN-----------------LNPIISKRITITGSTLRRRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAM  314 (332)
Q Consensus       253 ~~~-----------------~~~~~~~~~~i~g~~~~~~~-~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~  314 (332)
                      +-.                 ..++-.+++++....-+... .....    ...    +.+.+.  .| ..+.=..+|+.+
T Consensus       162 ~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~----~~~----~~~~~~--~P-lgR~g~pedia~  230 (257)
T PRK12748        162 PDELAYAATKGAIEAFTKSLAPVLAEKGITVNAVNPGPTDTGWITE----ELK----HHLVPK--FP-QGRVGEPVDAAR  230 (257)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCH----HHH----HHHHHC--CC-CCCCCCHHHHHH
T ss_conf             7604869999999999999999972309499999778789888898----999----999857--99-899859999999


Q ss_pred             HHHHHHCC---CCCCEEEE
Q ss_conf             99999829---98132898
Q gi|254780290|r  315 AHDIMEKS---EHIGKIIL  330 (332)
Q Consensus       315 A~~~l~~g---~~~GKvVi  330 (332)
                      +...|.+.   -.+|-++.
T Consensus       231 ~v~fL~S~~a~~iTG~~i~  249 (257)
T PRK12748        231 LIAFLASEEAKWITGQVIH  249 (257)
T ss_pred             HHHHHHCCHHCCEECCEEE
T ss_conf             9999948553484085589


No 316
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB; InterPro: IPR012730    This entry describes the molybdopterin biosynthesis protein MoeB in Escherichia coli and related species. MoeB and MoaD are involved in molybdenum cofactor biosynthesis, an evolutionarily conserved pathway. The MoeB enzyme covalently modifies the molybdopterin synthase MoaD by sulphurylation. The crystal structure of the complex between the E. coli MoeB and MoaD proteins reveals a MoeB(2)-MoaD(2) heterotetramer in which the MoeB subunits form a mainly hydrophobic dimer .   MoeB is closely related to ThiF, a thiamine biosynthesis enzyme that modifies ThiS by an analogous adenylation. Both MoeB and ThiF belong to the HesA/MoeB/ThiF family (IPR000594 from INTERPRO). ; GO: 0006777 Mo-molybdopterin cofactor biosynthetic process.
Probab=88.95  E-value=0.2  Score=28.61  Aligned_cols=32  Identities=28%  Similarity=0.364  Sum_probs=25.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC
Q ss_conf             222222113444443222221222222-221112
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTA  177 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~  177 (332)
                      +..+|||.| .||.|.+|.|++...|. +.+-++
T Consensus        23 K~s~vLivG-~GGLGCAa~QYLa~AGvG~l~L~D   55 (240)
T TIGR02355        23 KASKVLIVG-LGGLGCAASQYLAAAGVGRLTLVD   55 (240)
T ss_pred             CCCCEEEEE-CCHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             005677783-670345678888643663278863


No 317
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional
Probab=88.83  E-value=0.061  Score=31.97  Aligned_cols=10  Identities=30%  Similarity=0.620  Sum_probs=5.9

Q ss_pred             EEEEEECCCC
Q ss_conf             0899991568
Q gi|254780290|r    7 MRHVAMSGYG   16 (332)
Q Consensus         7 Mka~v~~~~g   16 (332)
                      ||.+.+++-.
T Consensus         1 MKkILVTGg~   10 (355)
T PRK10217          1 MRKILITGGA   10 (355)
T ss_pred             CCEEEECCCC
T ss_conf             9969993787


No 318
>pfam03435 Saccharop_dh Saccharopine dehydrogenase. This family comprised of three structural domains that can not be separated in the linear sequence. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase.
Probab=88.77  E-value=0.036  Score=33.48  Aligned_cols=32  Identities=19%  Similarity=-0.049  Sum_probs=16.0

Q ss_pred             HHHHHHCCCCCCC----CEEEEEHHHHHHHHHHHHC
Q ss_conf             9999986983102----1247418999999999982
Q gi|254780290|r  290 IWPLLNSHVIAPV----IHTVLPLGKVAMAHDIMEK  321 (332)
Q Consensus       290 ~~~~i~~g~l~p~----i~~~~~l~~i~~A~~~l~~  321 (332)
                      ..+++.+|.++..    +...++-+-...+++.+.+
T Consensus       343 ~a~li~~g~i~~~GV~~PE~~~~~~~~~~~l~~l~~  378 (384)
T pfam03435       343 AAALLAGGEWAKPGVVEPEEDLDPDPFLPALPYLGK  378 (384)
T ss_pred             HHHHHHCCCCCCCCEECCCCCCCHHHHHHHHHHHHH
T ss_conf             999996897288957994236884479999999885


No 319
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzyme catalyzes the first step in the biosynthesis of pseudaminic acid, the conversion of UDP-N-acetylglucosamine to UDP-4-keto-6-deoxy-N-acetylglucosamine. These sequences are members of the broader pfam01073 (3-beta hydroxysteroid dehydrogenase/isomerase family) family.
Probab=88.75  E-value=0.073  Score=31.45  Aligned_cols=74  Identities=19%  Similarity=0.337  Sum_probs=36.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCC-CCCCCC-CCCCCCCCCCCCCCCCC-CCCCCCC----CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222-122222-22211122322111111-2233222----22222211112222222221112
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQ-LASYFG-ATVYTTAKSEEKCLACL-KLGAKHA----INYLKEDFLEILQKETQGRGIDI  217 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~q-la~~~G-~~vi~~~~~~~~~~~~~-~lGa~~v----i~~~~~~~~~~i~~~t~g~g~Di  217 (332)
                      .|++|||+||+|.+|.-.+. +++..+ .+++...+++.+...++ .+..+.+    -|-+|.+.   +.+...  ++|+
T Consensus         3 ~~K~ILVTGGaGfIGS~lv~~Ll~~~~~~~iii~~~de~~~~~l~~~~~~~~i~f~~gDIrD~~~---l~~~~~--~vD~   77 (324)
T TIGR03589         3 NNKSILITGGTGSFGKAFISRLLENYNPKKIIIYSRDELKQWEMQQKFPAPCLRFFIGDVRDKER---LTRALR--GVDY   77 (324)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHCCCCCEEEEECCCCCHHH---HHHHHC--CCCE
T ss_conf             93999990797799999999999729982899966864032889851689875999677778899---997634--8889


Q ss_pred             CCCCCC
Q ss_conf             222111
Q gi|254780290|r  218 ILDMVG  223 (332)
Q Consensus       218 vid~~G  223 (332)
                      ||.+..
T Consensus        78 VfHaAA   83 (324)
T TIGR03589        78 VVHAAA   83 (324)
T ss_pred             EEECCC
T ss_conf             999462


No 320
>KOG1207 consensus
Probab=88.73  E-value=0.07  Score=31.55  Aligned_cols=42  Identities=31%  Similarity=0.481  Sum_probs=35.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC  186 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~  186 (332)
                      .|..|+++|+.-|+|...++-+...|++|++++|+++++..+
T Consensus         6 aG~~vlvTgagaGIG~~~v~~La~aGA~ViAvaR~~a~L~sL   47 (245)
T KOG1207           6 AGVIVLVTGAGAGIGKEIVLSLAKAGAQVIAVARNEANLLSL   47 (245)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHCCCEEEEEECCHHHHHHH
T ss_conf             661999605666414999999986688799995698899999


No 321
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase. RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe Tgs1 and Giardia lamblia Tgs2 catalyse methylation of the exocyclic N2 amine of 7-methylguanosine.
Probab=88.36  E-value=0.055  Score=32.27  Aligned_cols=70  Identities=21%  Similarity=0.222  Sum_probs=48.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC
Q ss_conf             11344444322222122222222111223221111112----2332222222221111222222-22211122221
Q gi|254780290|r  151 IHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKET-QGRGIDIILDM  221 (332)
Q Consensus       151 V~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t-~g~g~Divid~  221 (332)
                      |..+..|+|-.++|+|+. +.+|++++.++.+++.++.    .|++.-++.-..|+.+.+..+. .+..+|+||-+
T Consensus         4 vlD~fcG~Ggn~I~fA~~-~~~Vi~vDi~~~~l~~A~~NA~iyGV~drI~fi~gD~f~~~~~l~~~~~~~DvVf~s   78 (165)
T pfam09445         4 ILDVFCGAGGNTIQFANV-FCSVIGIDINPEHLACAQHNAEVYGVSDRIWFILGDWFELLAKLKFGKIPYDCVFLS   78 (165)
T ss_pred             EEECCCCCCHHHHHHHHH-CCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCCEEEEC
T ss_conf             999377807999999975-898999979899999999989983987317999775999978876358875589977


No 322
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase; InterPro: IPR005986   Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway. Additionally, several important metabolic intermediates are produced by these reactions, such as diaminopimelic acid, an essential component of bacterial cell wall biosynthesis, and dipicolinic acid, which is involved in sporulation in Gram-positive bacteria. Members of the animal kingdom do not posses this pathway and must therefore acquire these essential amino acids through their diet. Research into improving the metabolic flux through this pathway has the potential to increase the yield of the essential amino acids in important crops, thus improving their nutritional value. Additionally, since the enzymes are not present in animals, inhibitors of them are promising targets for the development of novel antibiotics and herbicides. For more information see .   Aspartate-semialdehyde dehydrogenase, the second enzyme in the aspartate pathway, converts aspartyl phosphate to aspartate-semialdehyde, the branch point intermediate between the lysine and threonine/methionine pathways. Based on sequence alignments, the aspartate-semialdehyde dehydrogenase family appears to have two distinct subgroups, one found in most bacteria (Gram-positve and Gram-negative), while the other is found primarily in organisms lacking peptidoglycan (archaea,fungi and some bacteria). Most studies have been performed on enzymes isolated from Gram-negative bacteria , , , . The N-terminal domain forms the active site and NADP-binding pocket, while C-terminal domain is primarily involved in hydrophobic intersubunit contacts. The catalytic mechanism involves the formation of a covalent thioester acyl-enzyme intermediate mediated through nucleophilic attack by an active site cysteine residue on the substrate aspartyl phosphate. Release of inorganic phosphate is followed by hydride transfer from NADPH to yield the product. The recently described archaeal structure suggests that the two subgroups of aspartate semi-aldehyde dehydrogenase share similar structures and have an identical catalytic mechanism, despite their relatively low sequence identity . Unlike the bacterial enzymes, the archaeal enzyme utilised both NAD and NADP as cofactor.   This entry represents the subgroup of aspartate-semialdehyde dehydrogenase most commonly found in bacteria. Note that some bacteria, such as Chlamydia, contain the enzyme from the other subgroup (IPR005676 from INTERPRO) instead.; GO: 0004073 aspartate-semialdehyde dehydrogenase activity, 0009086 methionine biosynthetic process, 0009088 threonine biosynthetic process.
Probab=88.34  E-value=0.14  Score=29.64  Aligned_cols=90  Identities=20%  Similarity=0.257  Sum_probs=41.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC--CC-CCCCC--CCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22211344444322222122222--22-21112--23221111112233222222-222111122222222211122221
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFG--AT-VYTTA--KSEEKCLACLKLGAKHAINY-LKEDFLEILQKETQGRGIDIILDM  221 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G--~~-vi~~~--~~~~~~~~~~~lGa~~vi~~-~~~~~~~~i~~~t~g~g~Divid~  221 (332)
                      +|.|.||+|.||+-.+.++--+.  ++ ++..+  ||.-|  .++-.|=+..|.. +.+       ..-.|+.+|++|-|
T Consensus         1 ~vAiVGATG~VGq~~lk~LeeR~FP~~~~~~~AS~RS~G~--~~~F~gke~~v~~~~~~-------n~F~gekidIAlFS   71 (350)
T TIGR01296         1 NVAIVGATGAVGQEMLKILEERNFPIDKLVLLASERSAGR--KVTFKGKELEVEEAKKE-------NSFEGEKIDIALFS   71 (350)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCCCC--EEEECCCEEEEECCCCC-------CCCCCCEEEEEEEC
T ss_conf             9478962674799998764136787755644105678885--78512753660101001-------48887703345651


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEEECC
Q ss_conf             11111222221122345304798337
Q gi|254780290|r  222 VGAEYLNQHLTLLSKEGKLIIISFLG  247 (332)
Q Consensus       222 ~G~~~~~~~~~~l~~~G~iv~~G~~~  247 (332)
                      .|+.+.+..+.-....|.+ .+-++|
T Consensus        72 AGgsvSke~aP~a~k~g~~-VIDntS   96 (350)
T TIGR01296        72 AGGSVSKEFAPKAAKAGVI-VIDNTS   96 (350)
T ss_pred             CCHHHHHHHHHHHHCCCCE-EEECCC
T ss_conf             5313348887888608757-981762


No 323
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion]
Probab=88.07  E-value=0.4  Score=26.58  Aligned_cols=129  Identities=21%  Similarity=0.206  Sum_probs=75.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----------CCCCCCCCCC
Q ss_conf             22222222221134444432222212222222211122322111111223322222222-----------2111122222
Q gi|254780290|r  141 ANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLK-----------EDFLEILQKE  209 (332)
Q Consensus       141 ~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~-----------~~~~~~i~~~  209 (332)
                      +.-.++.++|+.| .|-.|+.++-.++..|+-|.+..-.+.+.+..+++|+...--..+           ++|.++-+++
T Consensus       159 agtv~pA~vlv~G-~Gvagl~aiata~~lG~iVt~rdlrm~~Keqv~s~Ga~f~~~~~ee~~gGYAk~ms~~~~~~q~~~  237 (356)
T COG3288         159 AGTVSPAKVLVIG-AGVAGLAAIATAVRLGAIVTARDLRMFKKEQVESLGAKFLAVEDEESAGGYAKEMSEEFIAKQAEL  237 (356)
T ss_pred             CCCCCCHHHHHHH-HHHHHHHHHHHHHHCCEEEEHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             2425630433335-889999999998654638761331167765345225554565511257875543899999999999


Q ss_pred             C--CCCCCCCCCCCC---CCC----CCCCCCCCCCCCCCCEEEEECCCCCCCCCCC-CHHHCCCCEEEEEE
Q ss_conf             2--222111222211---111----1222221122345304798337875432224-33430532167775
Q gi|254780290|r  210 T--QGRGIDIILDMV---GAE----YLNQHLTLLSKEGKLIIISFLGGNIATEINL-NPIISKRITITGST  270 (332)
Q Consensus       210 t--~g~g~Divid~~---G~~----~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~-~~~~~~~~~i~g~~  270 (332)
                      .  .-+++|+||.+.   |.+    ..+.....+++|+.++.+....|.......+ .-...++.++.|..
T Consensus       238 ~a~~~~~~DivITTAlIPGrpAP~Lvt~~mv~sMkpGSViVDlAa~~GGNce~t~pg~~v~~~gV~iig~~  308 (356)
T COG3288         238 VAEQAKEVDIVITTALIPGRPAPKLVTAEMVASMKPGSVIVDLAAETGGNCELTEPGKVVTKNGVKIIGYT  308 (356)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHCCCCCCCCCCCCEEEECCEEEEEEC
T ss_conf             99884478889981445899874352799997448996899813222898655669807874786999645


No 324
>pfam02558 ApbA Ketopantoate reductase PanE/ApbA. This is a family of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, EC:1.1.1.169. The reaction catalysed by this enzyme is: (R)-pantoate + NADP(+) <= 2-dehydropantoate + NADPH. AbpA catalyses the NADPH reduction of ketopantoic acid to pantoic acid in the alternative pyrimidine biosynthetic (APB) pathway. ApbA and PanE are allelic. ApbA, the ketopantoate reductase enzyme is required for the synthesis of thiamine via the APB biosynthetic pathway.
Probab=88.06  E-value=0.088  Score=30.89  Aligned_cols=95  Identities=16%  Similarity=0.110  Sum_probs=52.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCC--
Q ss_conf             221134444432222212222222211122322111111223322222222211--1122222222211122221111--
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDF--LEILQKETQGRGIDIILDMVGA--  224 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~--~~~i~~~t~g~g~Divid~~G~--  224 (332)
                      |+|.| +|++|.+....+...|.+|..++|++ +.+.+++-|....-+..+..+  ............+|++|-|+=.  
T Consensus         1 I~IiG-aGaiG~~~a~~L~~ag~~V~lv~R~~-~~~~i~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~D~viv~vKa~~   78 (150)
T pfam02558         1 IAILG-AGAVGSLYGARLARAGHDVTLIARGR-HLEAIRENGLRITSPGGERTVPPPVATSASEELGPADLVIVAVKAYQ   78 (150)
T ss_pred             CEEEC-CCHHHHHHHHHHHHCCCEEEEEECCC-HHHHHHHCCEEEEECCCCEEEECCEECCCHHHCCCCCEEEEEECCCC
T ss_conf             99996-68999999999997799289997563-67887749769994798389807410386576588679999722458


Q ss_pred             --CCCCCCCCCCCCCCCCEEEEE
Q ss_conf             --112222211223453047983
Q gi|254780290|r  225 --EYLNQHLTLLSKEGKLIIISF  245 (332)
Q Consensus       225 --~~~~~~~~~l~~~G~iv~~G~  245 (332)
                        +.++...+.++++..++.+-+
T Consensus        79 ~~~al~~l~~~l~~~t~iv~lqN  101 (150)
T pfam02558        79 TAEALEDLAPLLGPNTVVLLLQN  101 (150)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             89999998865288838999425


No 325
>KOG1209 consensus
Probab=88.03  E-value=0.12  Score=29.93  Aligned_cols=77  Identities=26%  Similarity=0.397  Sum_probs=41.1

Q ss_pred             CCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC-CCCCCCCCC----CCCCCCCCCCCCCCCCC
Q ss_conf             222221134-44443222221222222221112232211111-122332-222222221----11122222222211122
Q gi|254780290|r  146 GQTVLIHGG-SSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAK-HAINYLKED----FLEILQKETQGRGIDII  218 (332)
Q Consensus       146 g~~vlV~ga-~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~-~vi~~~~~~----~~~~i~~~t~g~g~Div  218 (332)
                      ...|||+|. .||+|.+...-....|++|++|+|+-+....| .+.|.. .-+|-++++    +..++++.+.|+ .|+.
T Consensus         7 ~k~VlItgcs~GGIG~ala~ef~~~G~~V~AtaR~~e~M~~L~~~~gl~~~kLDV~~~~~V~~v~~evr~~~~Gk-ld~L   85 (289)
T KOG1209           7 PKKVLITGCSSGGIGYALAKEFARNGYLVYATARRLEPMAQLAIQFGLKPYKLDVSKPEEVVTVSGEVRANPDGK-LDLL   85 (289)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHCCEEEEECCCCHHHHHHHHHHHHHCCCCC-EEEE
T ss_conf             975999605776534999999986781999970224607667886097058705687277899888886189982-6888


Q ss_pred             CCCCC
Q ss_conf             22111
Q gi|254780290|r  219 LDMVG  223 (332)
Q Consensus       219 id~~G  223 (332)
                      ++..|
T Consensus        86 ~NNAG   90 (289)
T KOG1209          86 YNNAG   90 (289)
T ss_pred             ECCCC
T ss_conf             71799


No 326
>KOG1270 consensus
Probab=87.88  E-value=0.091  Score=30.79  Aligned_cols=89  Identities=28%  Similarity=0.396  Sum_probs=53.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---------CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222113444443222221222222221112232211111122---------332222222221111222222222111
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKL---------GAKHAINYLKEDFLEILQKETQGRGID  216 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~l---------Ga~~vi~~~~~~~~~~i~~~t~g~g~D  216 (332)
                      |.+||=.| ||+ |++-.-||| +|+.|.+++-+++..+.+++.         +..+.+.|.+.+    +...+ +. ||
T Consensus        90 g~~ilDvG-CGg-GLLSepLAr-lga~V~GID~s~~~V~vA~~h~~~dP~~~~~~~y~l~~~~~~----~E~~~-~~-fD  160 (282)
T KOG1270          90 GMKILDVG-CGG-GLLSEPLAR-LGAQVTGIDASDDMVEVANEHKKMDPVLEGAIAYRLEYEDTD----VEGLT-GK-FD  160 (282)
T ss_pred             CCEEEEEC-CCC-CCCCHHHHH-HCCEEEEECCHHHHHHHHHHHHHCCCHHCCCCCEEEEHHHCC----HHHCC-CC-CC
T ss_conf             86478723-675-502323575-088568526559999999875104903305641463020153----32145-65-64


Q ss_pred             CCCC-----CCC--CCCCCCCCCCCCCCCCCEEE
Q ss_conf             2222-----111--11122222112234530479
Q gi|254780290|r  217 IILD-----MVG--AEYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       217 ivid-----~~G--~~~~~~~~~~l~~~G~iv~~  243 (332)
                      .|+.     .+-  .+.++.+++.++|+|++...
T Consensus       161 aVvcsevleHV~dp~~~l~~l~~~lkP~G~lfit  194 (282)
T KOG1270         161 AVVCSEVLEHVKDPQEFLNCLSALLKPNGRLFIT  194 (282)
T ss_pred             EEEEHHHHHHHHCHHHHHHHHHHHHCCCCCEEEE
T ss_conf             5441989998747899999999984889825864


No 327
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]
Probab=87.87  E-value=0.59  Score=25.45  Aligned_cols=33  Identities=30%  Similarity=0.350  Sum_probs=30.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK  178 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~  178 (332)
                      .|+++-|.| .|.+|....+.++.+|++|++.++
T Consensus       141 ~gkTvGIiG-~G~IG~~va~~l~afgm~v~~~d~  173 (324)
T COG0111         141 AGKTVGIIG-LGRIGRAVAKRLKAFGMKVIGYDP  173 (324)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECC
T ss_conf             698899989-878999999999867986999889


No 328
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=87.83  E-value=0.056  Score=32.22  Aligned_cols=76  Identities=22%  Similarity=0.387  Sum_probs=45.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCC-C----CCCCCCCC---CCCCCCC----CCCCCCCCCC
Q ss_conf             222222113444443222221222222221112-23221111-1----12233222---2222221----1112222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTA-KSEEKCLA-C----LKLGAKHA---INYLKED----FLEILQKETQ  211 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~-~~~~~~~~-~----~~lGa~~v---i~~~~~~----~~~~i~~~t~  211 (332)
                      .|+++||+||++++|.+.+.-+...|++|+.+. ++++..+. +    ++.|.+..   .|-++++    +.+++.+.. 
T Consensus         7 ~gK~alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~l~~~~g~~~~~~~~Dv~~~~~~~~~~~~i~~~~-   85 (260)
T PRK08416          7 KGKTLVISGGTRGIGKAIVYEFAQSGVNIAFTYNSNVEEADKIAQDLEKKYGIKARAYPLNILEPETYKELFKKIDADF-   85 (260)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHH-
T ss_conf             9998999673409999999999987999999859988999999999988419836999778899999999999999981-


Q ss_pred             CCCCCCCCCCC
Q ss_conf             22111222211
Q gi|254780290|r  212 GRGIDIILDMV  222 (332)
Q Consensus       212 g~g~Divid~~  222 (332)
                       .+.|+.+++.
T Consensus        86 -g~iDilVnnA   95 (260)
T PRK08416         86 -DRVDFFISNA   95 (260)
T ss_pred             -CCCCEEEECC
T ss_conf             -9978998643


No 329
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=87.77  E-value=0.22  Score=28.28  Aligned_cols=39  Identities=18%  Similarity=0.141  Sum_probs=24.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222113444443222221222222221112232211111
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC  186 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~  186 (332)
                      ++|.|.|| |.+|.-..+++...|++|+..+.+++.++.+
T Consensus         6 k~VaViGA-G~MG~gIA~~~a~~G~~V~l~D~~~~~l~~~   44 (310)
T PRK06130          6 QNLAIIGA-GAMGSGIAALFASKGLDVVLIDPMPGALERA   44 (310)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCEEEEECCHHHHHHH
T ss_conf             88989787-7999999999985899889997999999999


No 330
>KOG1611 consensus
Probab=87.71  E-value=0.1  Score=30.44  Aligned_cols=78  Identities=23%  Similarity=0.422  Sum_probs=52.4

Q ss_pred             CCCCCCCCCCCCCCCCCC-CCCCCCCC-CCCCCCCCCCC-CCCCCCC-CC---CCC------CCCCCCCCCCCCCCCCCC
Q ss_conf             222211344444322222-12222222-21112232211-1111223-32---222------222221111222222222
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQ-LASYFGAT-VYTTAKSEEKC-LACLKLG-AK---HAI------NYLKEDFLEILQKETQGR  213 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~q-la~~~G~~-vi~~~~~~~~~-~~~~~lG-a~---~vi------~~~~~~~~~~i~~~t~g~  213 (332)
                      .+++|+||.-|+|+-.++ +.+..|.+ +++++|++++. +.+.... .|   |++      |-+-.++.+++.+..+-.
T Consensus         4 ksv~ItGaNRGIGlgLVk~llk~~~i~~iiat~r~~e~a~~~l~~k~~~d~rvHii~Ldvt~deS~~~~~~~V~~iVg~~   83 (249)
T KOG1611           4 KSVFITGANRGIGLGLVKELLKDKGIEVIIATARDPEKAATELALKSKSDSRVHIIQLDVTCDESIDNFVQEVEKIVGSD   83 (249)
T ss_pred             CCEEEECCCCCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCC
T ss_conf             40899626762107788998357884799984479677657878763258852799873365777999999987514668


Q ss_pred             CCCCCCCCCCC
Q ss_conf             11122221111
Q gi|254780290|r  214 GIDIILDMVGA  224 (332)
Q Consensus       214 g~Divid~~G~  224 (332)
                      |.|+.+++.|-
T Consensus        84 GlnlLinNaGi   94 (249)
T KOG1611          84 GLNLLINNAGI   94 (249)
T ss_pred             CCEEEEECCCE
T ss_conf             70588854600


No 331
>PRK10675 UDP-galactose-4-epimerase; Provisional
Probab=87.65  E-value=0.06  Score=32.01  Aligned_cols=17  Identities=6%  Similarity=-0.003  Sum_probs=7.5

Q ss_pred             EEHHH-HHHHHHHHHCCC
Q ss_conf             41899-999999998299
Q gi|254780290|r  307 LPLGK-VAMAHDIMEKSE  323 (332)
Q Consensus       307 ~~l~~-i~~A~~~l~~g~  323 (332)
                      ++|+| +.+-++..++.+
T Consensus       316 ~sl~egl~~t~~W~~~~~  333 (338)
T PRK10675        316 RTLDEMAQDTWHWQSRHP  333 (338)
T ss_pred             CCHHHHHHHHHHHHHHCC
T ss_conf             899999999999999584


No 332
>pfam01564 Spermine_synth Spermine/spermidine synthase. Spermine and spermidine are polyamines. This family includes spermidine synthase that catalyses the fifth (last) step in the biosynthesis of spermidine from arginine, and spermine synthase.
Probab=87.57  E-value=0.071  Score=31.52  Aligned_cols=95  Identities=18%  Similarity=0.203  Sum_probs=56.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCC--CCCCCC-----CCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222113444443222221222222-22111223221111112233--222222-----22211112222222221112
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGA--KHAINY-----LKEDFLEILQKETQGRGIDI  217 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa--~~vi~~-----~~~~~~~~i~~~t~g~g~Di  217 (332)
                      .++|||.|  ||-|..+-+++|+.+. +|..+.-.++=.+.++++=.  ...++.     .-.|-.+-+++.  ...+|+
T Consensus        76 pk~VLIiG--GGDG~~~rEvlk~~~v~~v~~VEiD~~Vv~~~~~~lp~~~~~~~dprv~l~~~Dg~~~l~~~--~~~yDv  151 (240)
T pfam01564        76 PKKVLIIG--GGDGGALREVVKHPSVEKITLVEIDEKVIEFSKKFLPSLAGGFDDPRVKVVIGDGFKFLKDY--LVKFDV  151 (240)
T ss_pred             CCEEEEEC--CCCHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHC--CCCCCE
T ss_conf             55367645--86579999985679953899975788999999998798524347985599981689999857--254458


Q ss_pred             CC-CCC---C-------CCCCCCCCCCCCCCCCCEEEE
Q ss_conf             22-211---1-------111222221122345304798
Q gi|254780290|r  218 IL-DMV---G-------AEYLNQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       218 vi-d~~---G-------~~~~~~~~~~l~~~G~iv~~G  244 (332)
                      || |++   |       .+.++.+.++|+++|.++.-+
T Consensus       152 II~D~~DP~~~~~~Lfs~eFy~~~~~~L~~~Gi~v~Q~  189 (240)
T pfam01564       152 IIVDSTDPVGPAENLFSKEFYDLLKRALKEDGVFVTQA  189 (240)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             99958997653344422999999998659997899924


No 333
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism]
Probab=87.39  E-value=0.086  Score=30.96  Aligned_cols=60  Identities=20%  Similarity=0.180  Sum_probs=43.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1222222222222113444443222221222222221112---232211111122332222222
Q gi|254780290|r  138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTA---KSEEKCLACLKLGAKHAINYL  198 (332)
Q Consensus       138 ~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~---~~~~~~~~~~~lGa~~vi~~~  198 (332)
                      ...+.++||.+ +|-+-+|.+|.....+|+++|++++.+.   -|.+|+++++.+||+.+....
T Consensus        54 e~~G~l~pG~t-IVE~TSGNTGIaLA~vaa~~Gy~~~ivmP~~~S~er~~~l~a~GAevi~t~~  116 (300)
T COG0031          54 EKRGLLKPGGT-IVEATSGNTGIALAMVAAAKGYRLIIVMPETMSQERRKLLRALGAEVILTPG  116 (300)
T ss_pred             HHCCCCCCCCE-EEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCEEEECCC
T ss_conf             98498799998-9970897279999999998199289995898999999999982998998379


No 334
>PRK08040 putative semialdehyde dehydrogenase; Provisional
Probab=87.34  E-value=0.13  Score=29.78  Aligned_cols=16  Identities=0%  Similarity=-0.020  Sum_probs=8.3

Q ss_pred             CCCCCCCCCCCCCCCC
Q ss_conf             2111111122222223
Q gi|254780290|r  104 CLSHQGHTLPIPKGYN  119 (332)
Q Consensus       104 ~~~~~~~~~~iP~~~s  119 (332)
                      .++|.+..++..+++.
T Consensus        92 ~VIDnss~~Rm~~dVP  107 (337)
T PRK08040         92 LVIDSSGLFALEPDVP  107 (337)
T ss_pred             EEEECCHHHCCCCCCC
T ss_conf             9997961310588874


No 335
>KOG1203 consensus
Probab=87.24  E-value=0.14  Score=29.49  Aligned_cols=43  Identities=21%  Similarity=0.254  Sum_probs=36.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             222222113444443222221222222221112232211-1111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC-LACL  187 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~-~~~~  187 (332)
                      .-.+|||.||+|.+|+..++.++..|..|.+.+++.++. ++++
T Consensus        78 ~~~~VlVvGatG~vG~~iv~~llkrgf~vra~VRd~~~a~~~~~  121 (411)
T KOG1203          78 KPTTVLVVGATGKVGRRIVKILLKRGFSVRALVRDEQKAEDLLG  121 (411)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHC
T ss_conf             88749995588736399999999779702342157365544432


No 336
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional
Probab=87.14  E-value=0.11  Score=30.39  Aligned_cols=102  Identities=19%  Similarity=0.287  Sum_probs=63.6

Q ss_pred             CCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             32221112222-22222222113444443222221222222221112232211111122332222222221111222222
Q gi|254780290|r  132 TVWANLFQTAN-LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKET  210 (332)
Q Consensus       132 tA~~~l~~~~~-~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t  210 (332)
                      +.+.++.+.-+ +-+|++|+|.| =|-+|.=..+-|+.+|++|++|.-.|-+.-.+.--|.. |..     ..+.+.   
T Consensus       193 S~~dgi~r~Tn~llaGK~vVV~G-YG~~GkG~A~~arg~GA~ViVtEvDPi~ALeA~mDGf~-V~~-----~~~a~~---  262 (427)
T PRK05476        193 SLLDGIKRATNVLIAGKVVVVAG-YGDVGKGSAQRLRGLGARVIVTEIDPICALQAAMDGFE-VMT-----MEEAAE---  262 (427)
T ss_pred             CHHHHHHHHHCCEECCCEEEEEC-CCCCCCHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCC-CCC-----HHHHHH---
T ss_conf             49999998735212573799955-66556008998741898799980473799998862783-565-----899862---


Q ss_pred             CCCCCCCCCCCCCC-CCC-CCCCCCCCCCCCCEEEEEC
Q ss_conf             22211122221111-112-2222112234530479833
Q gi|254780290|r  211 QGRGIDIILDMVGA-EYL-NQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       211 ~g~g~Divid~~G~-~~~-~~~~~~l~~~G~iv~~G~~  246 (332)
                         -.|+++.++|. +.+ ...++.++.|..++..|..
T Consensus       263 ---~~DifiT~TG~~~vI~~~h~~~MKdgaIl~N~GHf  297 (427)
T PRK05476        263 ---KADIFVTATGNKDVITAEHMEAMKDGAIVCNIGHF  297 (427)
T ss_pred             ---HCCEEEEECCCCCCCCHHHHHHHCCCEEEECCCCC
T ss_conf             ---08999990489572489999850788299767777


No 337
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed
Probab=87.07  E-value=0.12  Score=30.04  Aligned_cols=16  Identities=31%  Similarity=0.434  Sum_probs=12.1

Q ss_pred             CCCCCCCCCCCCCCCC
Q ss_conf             2222211344444322
Q gi|254780290|r  146 GQTVLIHGGSSGIGTT  161 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~  161 (332)
                      =|+|||-+-||+.|.+
T Consensus       184 FD~ILvDaPCSG~G~~  199 (471)
T PRK11933        184 FDAILLDAPCSGEGTV  199 (471)
T ss_pred             CCEEEECCCCCCCEEE
T ss_conf             6679987888887335


No 338
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).
Probab=86.76  E-value=0.085  Score=31.00  Aligned_cols=90  Identities=30%  Similarity=0.306  Sum_probs=53.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-
Q ss_conf             22113444443222221222222221112232211111122----3322222222211112222222221112222111-
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKL----GAKHAINYLKEDFLEILQKETQGRGIDIILDMVG-  223 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~l----Ga~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G-  223 (332)
                      ||=.|  .|.|..+..+++..+.++++++.+++..+.+++.    +.+. +.....|+.+...  .....+|+|+-... 
T Consensus         2 VLDiG--cG~G~~~~~l~~~~~~~v~~iD~s~~~~~~a~~~~~~~~~~~-~~~~~~d~~~~~~--~~~~~fD~V~~~~~~   76 (107)
T cd02440           2 VLDLG--CGTGALALALASGPGARVTGVDISPVALELARKAAAALLADN-VEVLKGDAEELPP--EADESFDVIISDPPL   76 (107)
T ss_pred             EEEEE--CCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCC-EEEECCCHHHCCH--HHCCCEEEEEEECCE
T ss_conf             99998--887999999995689889999898889999999875327886-4671488678863--205753199991750


Q ss_pred             -------CCCCCCCCCCCCCCCCCEEE
Q ss_conf             -------11122222112234530479
Q gi|254780290|r  224 -------AEYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       224 -------~~~~~~~~~~l~~~G~iv~~  243 (332)
                             ...++...+.|++||+++..
T Consensus        77 ~~~~~~~~~~l~~~~~~LkpgG~~~is  103 (107)
T cd02440          77 HHLVEDLARFLEEARRLLKPGGVLVLT  103 (107)
T ss_pred             ECCCCCHHHHHHHHHHHCCCCCEEEEE
T ss_conf             106518999999999874858199999


No 339
>PRK08410 2-hydroxyacid dehydrogenase; Provisional
Probab=86.70  E-value=0.78  Score=24.65  Aligned_cols=35  Identities=31%  Similarity=0.367  Sum_probs=30.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE  180 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~  180 (332)
                      .|+++.|.| .|.+|....++++.+|++|++..++.
T Consensus       144 ~gktlGIvG-~G~IG~~va~~l~~fGm~V~~~d~~~  178 (311)
T PRK08410        144 KGKKWGIIG-LGTIGKRVAKIAQAFGAEVVYYSTSG  178 (311)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             588899984-47489999999997699899989843


No 340
>PRK08309 short chain dehydrogenase; Provisional
Probab=86.42  E-value=0.34  Score=27.04  Aligned_cols=95  Identities=14%  Similarity=0.144  Sum_probs=53.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----C-CCCCCCCCC-CCCCCCCCCCCC-CCCCCC
Q ss_conf             22211344444322222122222222111223221111112233-----2-222222221-111222222222-111222
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGA-----K-HAINYLKED-FLEILQKETQGR-GIDIIL  219 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa-----~-~vi~~~~~~-~~~~i~~~t~g~-g~Divi  219 (332)
                      ..||.||+|-..- +.+.+...|.+|..++|++.+.+..+..+.     + -..||++++ +.+.+.+..... .+|.++
T Consensus         2 haLVIGGTGML~~-vs~~L~~qg~~VsiiaR~~~kl~~~~~~~~~p~~i~~l~~DY~d~~~l~~~l~~ai~q~Gp~dl~V   80 (182)
T PRK08309          2 HALVIGGTGMLKR-VSLWLCEEGFHVSIIARDEVKLENVKRESGTPESITCLPLDYHDDDAVKLAIKRTIEQNGPITLAV   80 (182)
T ss_pred             CEEEECCCHHHHH-HHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             1699724175599-999997379999999448788653686237986325787464886999999999996189856899


Q ss_pred             C---CCCCCCCCCCCCCCC-CCCCCEEE
Q ss_conf             2---111111222221122-34530479
Q gi|254780290|r  220 D---MVGAEYLNQHLTLLS-KEGKLIII  243 (332)
Q Consensus       220 d---~~G~~~~~~~~~~l~-~~G~iv~~  243 (332)
                      -   +.+...+...++-+. ..+.+..+
T Consensus        81 aWiHssa~~al~~v~~~l~~~~~~~~l~  108 (182)
T PRK08309         81 AWIHSSAKDALSVVCRELDLSSETYRLF  108 (182)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCCCEEE
T ss_conf             9983572245999999985489981699


No 341
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]
Probab=86.23  E-value=0.15  Score=29.40  Aligned_cols=148  Identities=24%  Similarity=0.223  Sum_probs=79.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222333322112233333221111111222222232221222222333222111222-2222222221134444432222
Q gi|254780290|r   85 WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTA-NLRSGQTVLIHGGSSGIGTTAI  163 (332)
Q Consensus        85 ~~~GdrV~~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~-~~~~g~~vlV~ga~g~vG~~a~  163 (332)
                      .++|+|.+- .+  +|.+|........+++..++-|=+    +.-..|+ .||.-.- .+++|+++|=.| | |-|.+++
T Consensus       109 ~rig~~f~I-~P--sw~~~~~~~~~~~i~lDPGlAFGT----G~HpTT~-lcL~~Le~~~~~g~~vlDvG-c-GSGILaI  178 (300)
T COG2264         109 VRIGERFVI-VP--SWREYPEPSDELNIELDPGLAFGT----GTHPTTS-LCLEALEKLLKKGKTVLDVG-C-GSGILAI  178 (300)
T ss_pred             EEEEEEEEE-CC--CCCCCCCCCCCEEEEECCCCCCCC----CCCHHHH-HHHHHHHHHHCCCCEEEEEC-C-CHHHHHH
T ss_conf             895104998-78--874668877726999757333678----8780179-99999998605898799826-7-8159999


Q ss_pred             CCCCCCCC-CCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCC
Q ss_conf             21222222-22111223221111112----233222222222111122222222211122221111----1122222112
Q gi|254780290|r  164 QLASYFGA-TVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA----EYLNQHLTLL  234 (332)
Q Consensus       164 qla~~~G~-~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~----~~~~~~~~~l  234 (332)
                      - |..+|+ +|++++..+.-.+.+++    .|++..+.....+    ..+...+..+|+|+-.+=.    ...+...+++
T Consensus       179 A-a~kLGA~~v~g~DiDp~AV~aa~eNa~~N~v~~~~~~~~~~----~~~~~~~~~~DvIVANILA~vl~~La~~~~~~l  253 (300)
T COG2264         179 A-AAKLGAKKVVGVDIDPQAVEAARENARLNGVELLVQAKGFL----LLEVPENGPFDVIVANILAEVLVELAPDIKRLL  253 (300)
T ss_pred             H-HHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCHHHHCCCCC----CHHHCCCCCCCEEEEHHHHHHHHHHHHHHHHHC
T ss_conf             9-99819866899718889999999999976996022003456----300013686568986052789999999999870


Q ss_pred             CCCCCCEEEEECC
Q ss_conf             2345304798337
Q gi|254780290|r  235 SKEGKLIIISFLG  247 (332)
Q Consensus       235 ~~~G~iv~~G~~~  247 (332)
                      +++|+++.-|...
T Consensus       254 kpgg~lIlSGIl~  266 (300)
T COG2264         254 KPGGRLILSGILE  266 (300)
T ss_pred             CCCCEEEEEEECH
T ss_conf             8893699986207


No 342
>PRK11761 cysM cysteine synthase B; Provisional
Probab=85.75  E-value=0.12  Score=29.99  Aligned_cols=57  Identities=21%  Similarity=0.242  Sum_probs=38.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCC
Q ss_conf             12222222222221134444432222212222222211122---32211111122332222
Q gi|254780290|r  138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK---SEEKCLACLKLGAKHAI  195 (332)
Q Consensus       138 ~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~---~~~~~~~~~~lGa~~vi  195 (332)
                      .+.+++++|++| |...+|..|.+...+|+.+|++++.+..   +++|...++.+||+.++
T Consensus        55 ~~~G~l~~g~~v-veaSSGN~g~alA~~a~~~G~~~~iv~p~~~s~~k~~~l~~~GAeVi~  114 (296)
T PRK11761         55 EKRGEIKPGDTL-IEATSGNTGIALAMAAAIKGYRMKLIMPENMSQERRAAMRAYGAELIL  114 (296)
T ss_pred             HHCCCCCCCCEE-EEECCCCHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHCCCCEEE
T ss_conf             974998999879-993788679999999998197479967865788999999974995574


No 343
>pfam08242 Methyltransf_12 Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
Probab=85.70  E-value=0.084  Score=31.02  Aligned_cols=82  Identities=21%  Similarity=0.165  Sum_probs=46.1

Q ss_pred             CCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-------
Q ss_conf             44432222212222-22221112232211111122----3322222222211112222222221112222111-------
Q gi|254780290|r  156 SGIGTTAIQLASYF-GATVYTTAKSEEKCLACLKL----GAKHAINYLKEDFLEILQKETQGRGIDIILDMVG-------  223 (332)
Q Consensus       156 g~vG~~a~qla~~~-G~~vi~~~~~~~~~~~~~~l----Ga~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G-------  223 (332)
                      .|.|.++..+++.. +++|++++.|++..+.+++.    +........ .+..+ ... .....||+|+-.-.       
T Consensus         5 cG~G~~~~~l~~~~~~~~v~giD~s~~~l~~a~~~~~~~~~~~~~~~~-~~~~~-~~~-~~~~~fD~I~~~~vl~~~~~~   81 (98)
T pfam08242         5 CGTGTLLRALLEALPGLEYTGVDISPAALEAAAERLAALGLLDAVRVR-LDVLD-AID-LDPGSFDVVVASNVLHHLADP   81 (98)
T ss_pred             CCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCHHHE-EECCC-HHH-CCCCCCCEEEECCCHHHCCCH
T ss_conf             337999999998789988999859889999999999871345311100-00000-222-035898899610417725899


Q ss_pred             CCCCCCCCCCCCCCCCC
Q ss_conf             11122222112234530
Q gi|254780290|r  224 AEYLNQHLTLLSKEGKL  240 (332)
Q Consensus       224 ~~~~~~~~~~l~~~G~i  240 (332)
                      ...++...++|+|||++
T Consensus        82 ~~~l~~~~r~LkpgG~l   98 (98)
T pfam08242        82 RAVLRNLRRLLKPGGVL   98 (98)
T ss_pred             HHHHHHHHHHCCCCCCC
T ss_conf             99999999974999899


No 344
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional
Probab=85.61  E-value=0.14  Score=29.59  Aligned_cols=15  Identities=0%  Similarity=-0.297  Sum_probs=7.1

Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             211111112222222
Q gi|254780290|r  104 CLSHQGHTLPIPKGY  118 (332)
Q Consensus       104 ~~~~~~~~~~iP~~~  118 (332)
                      +++|.+..++..+++
T Consensus        91 vVIDnSSafRmd~dv  105 (323)
T PRK06901         91 IVIDMLGICAALANV  105 (323)
T ss_pred             EEEECCHHHHCCCCC
T ss_conf             999897565178998


No 345
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy). The equilibrium lies far on the side of AdoHyc synthesis, but in nature the removal of Ado and Hyc is sufficiently fast, so that the net reaction is in the direction of hydrolysis. Since AdoHyc is a potent inhibitor of S-adenosyl-L-methionine dependent methyltransferases,  AdoHycase plays a critical role in the modulation of the activity of various methyltransferases. The enzyme forms homooligomers of 45-50kDa subunits, each binding one molecule of NAD+.
Probab=85.58  E-value=0.11  Score=30.35  Aligned_cols=105  Identities=15%  Similarity=0.218  Sum_probs=65.9

Q ss_pred             CCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             33322211122222-22222221134444432222212222222211122322111111223322222222211112222
Q gi|254780290|r  130 FFTVWANLFQTANL-RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQK  208 (332)
Q Consensus       130 ~~tA~~~l~~~~~~-~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~  208 (332)
                      +.+.+.++.+.-++ -.|++|+|.| =|-+|.=..+-++.+|++|++|.-.|-+.-.+.--|.+ |..     ..+.+. 
T Consensus       185 gqS~~dgi~r~Tn~liaGK~vVV~G-YG~~GkG~A~r~rglGA~V~VtEvDPi~ALeA~mDGf~-V~~-----m~~a~~-  256 (413)
T cd00401         185 RESLIDGIKRATDVMIAGKVAVVAG-YGDVGKGCAQSLRGQGARVIVTEVDPICALQAAMEGYE-VMT-----MEEAVK-  256 (413)
T ss_pred             CHHHHHHHHHHHHHEECCCEEEEEC-CCCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCC-CCC-----HHHHHH-
T ss_conf             2108999998742121377799945-77635688998865898899971775889999856894-577-----999972-


Q ss_pred             CCCCCCCCCCCCCCCC-CCC-CCCCCCCCCCCCCEEEEECC
Q ss_conf             2222211122221111-112-22221122345304798337
Q gi|254780290|r  209 ETQGRGIDIILDMVGA-EYL-NQHLTLLSKEGKLIIISFLG  247 (332)
Q Consensus       209 ~t~g~g~Divid~~G~-~~~-~~~~~~l~~~G~iv~~G~~~  247 (332)
                           -.|+++.++|. +.+ ...++.++.|..++..|...
T Consensus       257 -----~~DifiTaTGn~~VI~~eH~~~MKdgaIl~N~GHfd  292 (413)
T cd00401         257 -----EGDIFVTTTGNKDIITGEHFEQMKDGAIVCNIGHFD  292 (413)
T ss_pred             -----HCCEEEEECCCCCCCCHHHHHHHCCCEEEEECCCCC
T ss_conf             -----389999933887737399999845886998067772


No 346
>COG2520 Predicted methyltransferase [General function prediction only]
Probab=85.35  E-value=0.26  Score=27.78  Aligned_cols=99  Identities=21%  Similarity=0.222  Sum_probs=65.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222211344444322222122222222111223221111112----233222222222111122222222211122
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQGRGIDII  218 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~g~g~Div  218 (332)
                      .++|++|+--=  .|+|-+++-+|++.-.+|++++-|+...++|++    .++...+..-..|..+.+.+.   ..+|.|
T Consensus       186 v~~GE~V~DmF--AGVGpfsi~~Ak~g~~~V~A~diNP~A~~~L~eNi~LN~v~~~v~~i~gD~rev~~~~---~~aDrI  260 (341)
T COG2520         186 VKEGETVLDMF--AGVGPFSIPIAKKGRPKVYAIDINPDAVEYLKENIRLNKVEGRVEPILGDAREVAPEL---GVADRI  260 (341)
T ss_pred             HCCCCEEEECC--CCCCCCHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHCC---CCCCEE
T ss_conf             06998899835--7865401246654786399994598999999999985576551567966488850204---667889


Q ss_pred             CCCC-C--CCCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             2211-1--11122222112234530479833
Q gi|254780290|r  219 LDMV-G--AEYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       219 id~~-G--~~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      +-.. .  ...+..++++++.+|.+..+...
T Consensus       261 im~~p~~a~~fl~~A~~~~k~~g~iHyy~~~  291 (341)
T COG2520         261 IMGLPKSAHEFLPLALELLKDGGIIHYYEFV  291 (341)
T ss_pred             EECCCCCCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             8389872023389999985148679999622


No 347
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated
Probab=85.34  E-value=1.1  Score=23.75  Aligned_cols=23  Identities=13%  Similarity=0.296  Sum_probs=18.1

Q ss_pred             CCCCEEEEEEEEEEECHHHHHHH
Q ss_conf             78862899999998278789998
Q gi|254780290|r   31 PQKEEILIKVEAIGVNRPDVMQR   53 (332)
Q Consensus        31 ~~~~~vlV~v~~~~in~~D~~~~   53 (332)
                      ..+.++++--.+++|.++++..-
T Consensus       103 ~~~~~aIiASsTSgl~~S~l~~~  125 (489)
T PRK07531        103 AARPDALIGSSTSGFKPSELQEG  125 (489)
T ss_pred             HCCCCCEEEECCCCCCHHHHHHH
T ss_conf             67998389853665889999865


No 348
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism]
Probab=85.31  E-value=0.12  Score=30.05  Aligned_cols=95  Identities=20%  Similarity=0.237  Sum_probs=58.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC-CCCC--CCCCCC----CCCCCCCCCCCCCCCC
Q ss_conf             2222222113444443222221222222-221112232211111122-3322--222222----2111122222222211
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKL-GAKH--AINYLK----EDFLEILQKETQGRGI  215 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~l-Ga~~--vi~~~~----~~~~~~i~~~t~g~g~  215 (332)
                      .| .+|||.|  ||-|-.+=.++|+... +++++.-+++=.+++++. +-..  ..|.+-    .|-.+-+++...  .+
T Consensus        76 ~p-k~VLiiG--gGdG~tlRevlkh~~ve~i~~VEID~~Vi~~ar~~l~~~~~~~~dpRv~i~i~Dg~~~v~~~~~--~f  150 (282)
T COG0421          76 NP-KRVLIIG--GGDGGTLREVLKHLPVERITMVEIDPAVIELARKYLPEPSGGADDPRVEIIIDDGVEFLRDCEE--KF  150 (282)
T ss_pred             CC-CEEEEEC--CCCCHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCCCCCCCCEEEEECCHHHHHHHCCC--CC
T ss_conf             97-7699988--9766999999836884337999708899999998666754335797368996107999874887--67


Q ss_pred             CCCC-CCC---CC-------CCCCCCCCCCCCCCCCEEE
Q ss_conf             1222-211---11-------1122222112234530479
Q gi|254780290|r  216 DIIL-DMV---GA-------EYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       216 Divi-d~~---G~-------~~~~~~~~~l~~~G~iv~~  243 (332)
                      |+|| |+.   |.       ..++.+-++|+++|.++.-
T Consensus       151 DvIi~D~tdp~gp~~~Lft~eFy~~~~~~L~~~Gi~v~q  189 (282)
T COG0421         151 DVIIVDSTDPVGPAEALFTEEFYEGCRRALKEDGIFVAQ  189 (282)
T ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEE
T ss_conf             789985889988430237799999999862889689994


No 349
>PRK08229 2-dehydropantoate 2-reductase; Provisional
Probab=85.30  E-value=0.12  Score=29.99  Aligned_cols=10  Identities=10%  Similarity=-0.057  Sum_probs=3.2

Q ss_pred             HHHHCCCCCC
Q ss_conf             9998698310
Q gi|254780290|r  292 PLLNSHVIAP  301 (332)
Q Consensus       292 ~~i~~g~l~p  301 (332)
                      +.++....+|
T Consensus       314 k~~E~~~~~~  323 (341)
T PRK08229        314 KEAERAGARP  323 (341)
T ss_pred             HHHHHCCCCC
T ss_conf             9998378999


No 350
>pfam02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain.
Probab=85.29  E-value=0.18  Score=28.91  Aligned_cols=96  Identities=21%  Similarity=0.231  Sum_probs=60.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222333222111222222-2222221134444432222212222222211122322111111223322222222211
Q gi|254780290|r  124 ASLPESFFTVWANLFQTANLR-SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDF  202 (332)
Q Consensus       124 a~l~~~~~tA~~~l~~~~~~~-~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~  202 (332)
                      +.+||+..-.+.. .+..++. .|.+++|.|.+.-+|.-...++...|+.|.. |.+                  ++.|+
T Consensus        14 ~~~PcTp~ai~~l-L~~~~i~l~Gk~vvViGrS~iVG~Pla~lL~~~~atVti-chs------------------~T~nl   73 (159)
T pfam02882        14 GFVPCTPRGIMEL-LKRYGIDLAGKNVVVIGRSNIVGKPLALLLLNANATVTV-CHS------------------KTKDL   73 (159)
T ss_pred             CCCCCCHHHHHHH-HHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEE-ECC------------------CCCCH
T ss_conf             9969649999999-998399857866999888731489999999877998999-818------------------99997


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             11222222222111222211111122222112234530479833
Q gi|254780290|r  203 LEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       203 ~~~i~~~t~g~g~Divid~~G~~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      .+.+++      .|+++-++|...+=.. +.+++|..++.+|..
T Consensus        74 ~~~~~~------ADIvI~A~G~p~~i~~-~~ik~gavvIDvGi~  110 (159)
T pfam02882        74 AEITRE------ADIVVVAVGKPGLIKA-DWVKPGAVVIDVGIN  110 (159)
T ss_pred             HHHHHC------CCEEEEECCCCCCCCH-HHCCCCCEEEEECCC
T ss_conf             896300------3444231588550569-885899889980220


No 351
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional
Probab=85.20  E-value=0.061  Score=31.97  Aligned_cols=14  Identities=14%  Similarity=0.233  Sum_probs=6.4

Q ss_pred             CCEEEEEEEEEEEC
Q ss_conf             86289999999827
Q gi|254780290|r   33 KEEILIKVEAIGVN   46 (332)
Q Consensus        33 ~~~vlV~v~~~~in   46 (332)
                      ++..-|.-.++.=|
T Consensus        25 ~~~f~v~~lsa~~n   38 (379)
T PRK05447         25 PDRFRVVALSAGSN   38 (379)
T ss_pred             CCCCEEEEEEECCC
T ss_conf             68758999992897


No 352
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional
Probab=85.16  E-value=0.9  Score=24.21  Aligned_cols=46  Identities=24%  Similarity=0.270  Sum_probs=33.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232211111122332
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK  192 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~  192 (332)
                      .|+++-|.| .|.+|....+.|+.+|++|++-+..-. .+.++++|++
T Consensus       137 ~gktlGIiG-~G~IG~~vA~~~~~fgm~Vi~yDP~~~-~~~~~~~gv~  182 (524)
T PRK13581        137 YGKTLGVIG-LGRIGSEVAKRAKAFGMKVIAYDPYIS-PERAAQLGVE  182 (524)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECCCCC-HHHHHHCCCE
T ss_conf             698899977-675789999999854974788777644-6679871966


No 353
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated
Probab=85.13  E-value=0.17  Score=29.00  Aligned_cols=68  Identities=25%  Similarity=0.382  Sum_probs=45.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112----23322222222211112222222221112222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK----LGAKHAINYLKEDFLEILQKETQGRGIDIILD  220 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~----lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid  220 (332)
                      .|.+||=.|  -|.|.+++.+|+. |++|++++-|++-.+.+++    .|.+.-+++...|+     +...|. ||.|+.
T Consensus        63 ~G~rVLDaG--CGtG~la~~LA~~-Ga~V~avDiS~~mi~~A~~Ra~~~g~~~~v~F~~gDl-----e~~~G~-FD~Vv~  133 (230)
T PRK07580         63 TGLSILDAG--CGTGSLSIPLARR-GAKVVASDISPQMVEEARERAPEAGLDGNITFEVGDL-----ESLLGS-FDTVVC  133 (230)
T ss_pred             CCCEEEECC--CCCCHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCEEEECCC-----CCCCCC-CCCHHH
T ss_conf             899898818--7867879999977-9989998389999999997558627876753896676-----545798-660233


Q ss_pred             C
Q ss_conf             1
Q gi|254780290|r  221 M  221 (332)
Q Consensus       221 ~  221 (332)
                      .
T Consensus       134 m  134 (230)
T PRK07580        134 L  134 (230)
T ss_pred             C
T ss_conf             3


No 354
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase; InterPro: IPR011023   This domain is found in archaeal, bacterial and eukaryotic proteins.    In the archaea and bacteria, they are primarily restricted to the euryarchaeota and proteobacteria respectively; where they are either described as either nucleolar protein or tRNA/rRNA cytosine-C5-methylase. They all have the S-adenosyl methionine (SAM) binding domain and are related to bacterial Fmu (16S rRNA m5C 967 methyltransferase) where the structure of the methyl transferase domain has been determined .    In the eukaryota, the majority are annotated as being 'nucleolar protein'. None of the eukaryotic members in this family have a the SAM binding signature. Despite this, the yeast Nop2p is a probable RNA m(5)C methyltransferase, essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis ; localised to the nucleolus and is essential for viability . Reduced Nop2p expression limits yeast growth and decreases levels of mature 60S ribosomal subunits while altering rRNA processing . There is substantial identity between Nop2p and human p120 (NOL1), which is also called the proliferation-associated nucleolar antigen , . .
Probab=84.79  E-value=0.26  Score=27.78  Aligned_cols=88  Identities=17%  Similarity=0.140  Sum_probs=50.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCC---CC
Q ss_conf             23333322111111122222223---2221222222333222111222222--2222221134444432222212---22
Q gi|254780290|r   97 GGGYAEYCLSHQGHTLPIPKGYN---AIQAASLPESFFTVWANLFQTANLR--SGQTVLIHGGSSGIGTTAIQLA---SY  168 (332)
Q Consensus        97 ~G~~ae~~~~~~~~~~~iP~~~s---~~~aa~l~~~~~tA~~~l~~~~~~~--~g~~vlV~ga~g~vG~~a~qla---~~  168 (332)
                      .|.|.+.+.-+..-+-..|+++.   +.|.|+-..|.+    +|    +++  ++++||=.+|+-  |-=+.||+   +.
T Consensus        32 ~~~~~~~v~~s~~~iG~tPEyL~G~y~~q~aSSmiPp~----aL----~p~Gn~~~~vlD~AAaP--GgKTT~is~~m~N  101 (284)
T TIGR00446        32 EGFFIEEVKESPLSIGSTPEYLLGYYYVQEASSMIPPL----AL----EPEGNEKERVLDMAAAP--GGKTTQISALMKN  101 (284)
T ss_pred             CCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCE----EE----CCCCCCCCEEEEEECCC--CCHHHHHHHHHCC
T ss_conf             74277654026776465167885378998787367603----01----77876888799974088--9648999998658


Q ss_pred             CCCCCCCCCCCCCCCCCCC----CCCCCCCC
Q ss_conf             2222211122322111111----22332222
Q gi|254780290|r  169 FGATVYTTAKSEEKCLACL----KLGAKHAI  195 (332)
Q Consensus       169 ~G~~vi~~~~~~~~~~~~~----~lGa~~vi  195 (332)
                      .|| |+|.+-+.+|...|.    ++|+..++
T Consensus       102 ~G~-i~Ane~~ksR~k~L~~NI~R~G~~n~~  131 (284)
T TIGR00446       102 EGA-IVANEVSKSRTKVLIANINRMGVLNVA  131 (284)
T ss_pred             CCE-EEEECCCCCCCHHHHHHHHHHHHEEEE
T ss_conf             851-899737634106678655562100333


No 355
>KOG1663 consensus
Probab=84.54  E-value=0.063  Score=31.86  Aligned_cols=101  Identities=21%  Similarity=0.259  Sum_probs=64.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCC---CCCC
Q ss_conf             222222222113444443222221222222221112232211111----122332222222221111222222---2221
Q gi|254780290|r  142 NLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC----LKLGAKHAINYLKEDFLEILQKET---QGRG  214 (332)
Q Consensus       142 ~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~----~~lGa~~vi~~~~~~~~~~i~~~t---~g~g  214 (332)
                      ++-..++.+..|.=.|-++++..++.-.+-+|+++..+++..+..    +.-|+++-|+.......+.+.++.   +...
T Consensus        70 ~~~~ak~~lelGvfTGySaL~~Alalp~dGrv~a~eid~~~~~~~~~~~k~agv~~KI~~i~g~a~esLd~l~~~~~~~t  149 (237)
T KOG1663          70 RLLNAKRTLELGVFTGYSALAVALALPEDGRVVAIEIDADAYEIGLELVKLAGVDHKITFIEGPALESLDELLADGESGT  149 (237)
T ss_pred             HHHCCCEEEEEECCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCC
T ss_conf             98587338998121278999999745999659999618688887599998606330342342525666999985579984


Q ss_pred             CCCCC-CCCC---CCCCCCCCCCCCCCCCCEE
Q ss_conf             11222-2111---1112222211223453047
Q gi|254780290|r  215 IDIIL-DMVG---AEYLNQHLTLLSKEGKLII  242 (332)
Q Consensus       215 ~Divi-d~~G---~~~~~~~~~~l~~~G~iv~  242 (332)
                      +|.+| |.-=   ....+.+++++++||.++.
T Consensus       150 fDfaFvDadK~nY~~y~e~~l~Llr~GGvi~~  181 (237)
T KOG1663         150 FDFAFVDADKDNYSNYYERLLRLLRVGGVIVV  181 (237)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             25999736667789999999856213538999


No 356
>pfam05221 AdoHcyase S-adenosyl-L-homocysteine hydrolase.
Probab=84.51  E-value=0.14  Score=29.56  Aligned_cols=102  Identities=16%  Similarity=0.271  Sum_probs=63.2

Q ss_pred             CCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             322211122222-2222222113444443222221222222221112232211111122332222222221111222222
Q gi|254780290|r  132 TVWANLFQTANL-RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKET  210 (332)
Q Consensus       132 tA~~~l~~~~~~-~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t  210 (332)
                      +.+.++.+.-++ -.|++++|.| =|-+|.=..+-|+.+|++|++|.-.|-+.-.+.--|. .|.+     ..+.+.   
T Consensus       195 S~~dgi~r~Tn~liaGK~vVV~G-YG~cGkG~A~r~rglGA~V~VtEvDPi~ALeA~mDGf-~V~~-----m~eaa~---  264 (430)
T pfam05221       195 SLPDGIKRATDVMIAGKVAVVCG-YGDVGKGCAASLRGQGARVIVTEIDPICALQAAMEGY-QVVT-----LEEVVK---  264 (430)
T ss_pred             HHHHHHHHHHCCEECCCEEEEEC-CCCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCC-CCCC-----HHHHHH---
T ss_conf             09999998617134276799955-6753578999984279889995478589999985588-4577-----999985---


Q ss_pred             CCCCCCCCCCCCCC-CCC-CCCCCCCCCCCCCEEEEEC
Q ss_conf             22211122221111-112-2222112234530479833
Q gi|254780290|r  211 QGRGIDIILDMVGA-EYL-NQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       211 ~g~g~Divid~~G~-~~~-~~~~~~l~~~G~iv~~G~~  246 (332)
                         -.|+++.++|. +.+ ...+..|+.+..++..|..
T Consensus       265 ---~~DifvT~TG~~~vI~~~H~~~MKdgaIl~N~GHf  299 (430)
T pfam05221       265 ---DADIFVTTTGCVDIIVGRHFMNMKKDAIVCNIGHF  299 (430)
T ss_pred             ---HCCEEEEECCCCCCCCHHHHHHHCCCEEEEECCCC
T ss_conf             ---59999993698875689999864178499956887


No 357
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=84.28  E-value=0.16  Score=29.23  Aligned_cols=21  Identities=19%  Similarity=0.245  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHCCCCCCEEEE
Q ss_conf             999999999982998132898
Q gi|254780290|r  310 GKVAMAHDIMEKSEHIGKIIL  330 (332)
Q Consensus       310 ~~i~~A~~~l~~g~~~GKvVi  330 (332)
                      +++++|.+...+--..|.+|+
T Consensus       397 ~~l~~Av~~a~~~a~~g~~VL  417 (445)
T PRK04308        397 ATLEEAVQTAYAQAEAGDIVL  417 (445)
T ss_pred             CCHHHHHHHHHHHCCCCCEEE
T ss_conf             879999999997488989899


No 358
>PRK09853 putative selenate reductase subunit YgfK; Provisional
Probab=84.14  E-value=0.12  Score=30.04  Aligned_cols=35  Identities=20%  Similarity=0.319  Sum_probs=17.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC-CC-CCCCCCC
Q ss_conf             222222221134444432222212222-22-2211122
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYF-GA-TVYTTAK  178 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~-G~-~vi~~~~  178 (332)
                      +..|++|+|+|| |.++.=++.-|+.+ |+ +|..+.+
T Consensus       676 ~~~GK~VVVIGG-GNTAMDcARTAlRl~GAe~VtivYR  712 (1032)
T PRK09853        676 LKLGKHVVVVGA-GNTAMDCARAALRVPGVEKVTVVYR  712 (1032)
T ss_pred             CCCCCEEEEECC-CHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             668993899898-4799999999875068865899605


No 359
>PRK11207 tellurite resistance protein TehB; Provisional
Probab=84.13  E-value=0.24  Score=28.07  Aligned_cols=95  Identities=20%  Similarity=0.210  Sum_probs=54.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222113444443222221222222221112232211111122----33222222222111122222222211122
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKL----GAKHAINYLKEDFLEILQKETQGRGIDII  218 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~l----Ga~~vi~~~~~~~~~~i~~~t~g~g~Div  218 (332)
                      +.|| ++|=.|  .|-|.-++.||. .|.+|.+++.|+..++.++++    |.+. ++....|+.+    ..-...+|.|
T Consensus        29 ~~~g-~~LDlg--cG~Grna~~La~-~G~~VtavD~s~~al~~~~~~a~~~~l~~-v~~~~~Dl~~----~~~~~~yDlI   99 (198)
T PRK11207         29 VKPG-RTLDLG--CGNGRNSLYLAA-NGYDVTAWDKNPMSIANLERIKAAENLDN-LHTRVVDLNN----LTFDGEYDFI   99 (198)
T ss_pred             CCCC-CEEEEC--CCCCHHHHHHHH-CCCEEEEEECCHHHHHHHHHHHHHCCCCE-EEEEEECCCC----CCCCCCCCEE
T ss_conf             8997-477724--788786999986-89859999799999999999998759982-4656203123----8877770589


Q ss_pred             CCCCC-----CC----CCCCCCCCCCCCCCCEEEEEC
Q ss_conf             22111-----11----122222112234530479833
Q gi|254780290|r  219 LDMVG-----AE----YLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       219 id~~G-----~~----~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      +.++-     .+    .+....++++|||..+.++..
T Consensus       100 lstvv~~fl~p~~~p~iia~mq~~t~PGG~~LIV~~~  136 (198)
T PRK11207        100 LSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAM  136 (198)
T ss_pred             EEEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEEEEC
T ss_conf             7864521048667899999999960899489999974


No 360
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=84.02  E-value=0.15  Score=29.41  Aligned_cols=25  Identities=24%  Similarity=0.080  Sum_probs=16.7

Q ss_pred             EEEHHH-HHHHHHHHHCCCCCCEEEE
Q ss_conf             741899-9999999982998132898
Q gi|254780290|r  306 VLPLGK-VAMAHDIMEKSEHIGKIIL  330 (332)
Q Consensus       306 ~~~l~~-i~~A~~~l~~g~~~GKvVi  330 (332)
                      .-.|++ +.+|++..++....|.+|+
T Consensus       403 ~~~l~~av~~a~~~a~~~~~~gd~VL  428 (457)
T PRK01390        403 SGTLEAAVAAAARDAAASGAPEPVVL  428 (457)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             59899999999999985189999899


No 361
>PRK06719 precorrin-2 dehydrogenase; Validated
Probab=83.97  E-value=0.65  Score=25.17  Aligned_cols=88  Identities=16%  Similarity=0.158  Sum_probs=50.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112233222222222111122222222211122221111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA  224 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~  224 (332)
                      .|.+|||.|| |.++.-=++.+...|++|.+++..  =.+.+++++.   +......+.+.-     =+++++||-++..
T Consensus        12 ~~k~vLVvGG-G~VA~rK~~~Ll~~ga~VtVvsp~--~~~el~~l~~---i~~~~r~~~~~d-----l~~~~lViaATdd   80 (157)
T PRK06719         12 HNKVVVIIGG-GKIAYRKASGLKDTGAFVTVVSPE--ICEEMKELPY---ITWKQKTFSNDD-----IKDAHLIYAATNQ   80 (157)
T ss_pred             CCCEEEEECC-CHHHHHHHHHHHHCCCEEEEECCC--CCHHHHHCCC---EEEECCCCCHHH-----HCCCEEEEECCCC
T ss_conf             9987999889-899999999998787969999998--6899984557---088704678468-----3784399986899


Q ss_pred             CCCCCCCCCCCCCCCCEEE
Q ss_conf             1122222112234530479
Q gi|254780290|r  225 EYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       225 ~~~~~~~~~l~~~G~iv~~  243 (332)
                      ..++..+...+....++.+
T Consensus        81 ~~lN~~i~~~a~~~~lvN~   99 (157)
T PRK06719         81 HAVNMMVKQAAHDFQWVNV   99 (157)
T ss_pred             HHHHHHHHHHHHHCCCEEE
T ss_conf             8999999999977895898


No 362
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional
Probab=83.80  E-value=0.14  Score=29.60  Aligned_cols=10  Identities=10%  Similarity=0.401  Sum_probs=3.7

Q ss_pred             EEEEECCCCC
Q ss_conf             8999915688
Q gi|254780290|r    8 RHVAMSGYGK   17 (332)
Q Consensus         8 ka~v~~~~g~   17 (332)
                      .-+-++..|.
T Consensus         2 ~nILvt~~G~   11 (325)
T PRK12767          2 MNILVTSAGR   11 (325)
T ss_pred             CEEEEECCCC
T ss_conf             4899986786


No 363
>TIGR00417 speE spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase   A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (), spermine synthase () and putrescine N-methyltransferase () .   The Thermotoga maritima spermidine synthase monomer consists of two domains: an N-terminal domain composed of six beta-strands, and a Rossmann-like C- terminal domain . The larger C-terminal catalytic core domain consists of a seven-stranded beta-sheet flanked by nine alpha helices. This domain resembles a topology observed in a number of nucleotide and dinucleotide-binding enzymes, and in S-adenosyl-L-methionine (AdoMet)- dependent methyltransferase (MTases) . ; GO: 0003824 catalytic activity.
Probab=83.68  E-value=0.27  Score=27.63  Aligned_cols=105  Identities=20%  Similarity=0.260  Sum_probs=57.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCC-CCCCCCCCCCCCC-------CC
Q ss_conf             221112222222222221134444432222212222222-21112232211111122-3322222222211-------11
Q gi|254780290|r  134 WANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLKL-GAKHAINYLKEDF-------LE  204 (332)
Q Consensus       134 ~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~~~~~~~~~~l-Ga~~vi~~~~~~~-------~~  204 (332)
                      +-+|+...+.   ++|||+|  ||=|-+.=.++|+...+ +.-+.-...=.+++|++ .-...-.+.++.+       .+
T Consensus        67 HvpL~~H~NP---k~VLvIG--GGDGG~lREV~KH~sVE~~~lVdID~~VI~~srkyLP~~~~g~~dderv~~~i~DG~~  141 (284)
T TIGR00417        67 HVPLFAHPNP---KKVLVIG--GGDGGVLREVVKHKSVEKATLVDIDEKVIELSRKYLPKLAAGSFDDERVDLAIDDGFK  141 (284)
T ss_pred             HHHHHCCCCC---CEEEEEE--CCCCCEEEEEEECCCCCEEEEEECCHHHHHHHHHHCHHHHCCCCCCCEEEEEECCCHH
T ss_conf             7565368988---5478996--3888468788755981679999727478999888261210566588803589825179


Q ss_pred             CCCCC---CCCCCCCCCC----CCCCC-------CCCCCCCCCCCCCCCCEEE
Q ss_conf             22222---2222111222----21111-------1122222112234530479
Q gi|254780290|r  205 ILQKE---TQGRGIDIIL----DMVGA-------EYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       205 ~i~~~---t~g~g~Divi----d~~G~-------~~~~~~~~~l~~~G~iv~~  243 (332)
                      -|++.   --.+.||+||    |.+|.       ..++.+.+||+++|.++.=
T Consensus       142 fl~~~Gasdv~~~fDVIIvDstDPvGPa~~LF~~~Fy~~~~~aL~~~Gv~v~Q  194 (284)
T TIGR00417       142 FLRDTGASDVEKKFDVIIVDSTDPVGPAETLFTKEFYELLKKALNEDGVIVAQ  194 (284)
T ss_pred             HHHHCCCCCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             89761522221214479972778956554102179999999852999889980


No 364
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit; InterPro: IPR006005    One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1.4.1.13 from EC) which transfers the amide group of glutamine to 2-oxoglutarate to yield two molecules of glutamate.  2 L-glutamate + NADP^+ = L-glutamine + 2-oxoglutarate + NADPH + H^+.    This describes a family in several archaeal and deeply branched bacterial lineages of a homotetrameric form of the NADPH-dependent or NADH-dependent glutamate synthase (1.4.1.13 from EC and 1.4.1.14 from EC respectively) small subunit. There is no corresponding large subunit. ; GO: 0016639 oxidoreductase activity acting on the CH-NH2 group of donors NAD or NADP as acceptor, 0006537 glutamate biosynthetic process.
Probab=83.55  E-value=0.24  Score=28.07  Aligned_cols=36  Identities=28%  Similarity=0.373  Sum_probs=30.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222113444443222221222222221112232
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE  180 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~  180 (332)
                      +=|++|.|.| +|+-||||.|-+...|-.|++..+++
T Consensus       149 rTGkkVAVVG-SGPAGLAaA~qLnrAGH~VTVfER~D  184 (517)
T TIGR01317       149 RTGKKVAVVG-SGPAGLAAADQLNRAGHTVTVFERED  184 (517)
T ss_pred             CCCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             4786689975-67579999999853588389974367


No 365
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane]
Probab=83.23  E-value=0.21  Score=28.44  Aligned_cols=32  Identities=25%  Similarity=0.319  Sum_probs=21.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222113444443222221222222221112232
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE  180 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~  180 (332)
                      ++||+|++|.+|....+.+. -+.+|+++++.+
T Consensus         2 ~iLi~G~~GqLG~~L~~~l~-~~~~v~a~~~~~   33 (281)
T COG1091           2 KILITGANGQLGTELRRALP-GEFEVIATDRAE   33 (281)
T ss_pred             CEEEECCCCHHHHHHHHHHC-CCCEEEECCCCC
T ss_conf             58997698767999999717-784399515765


No 366
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional
Probab=83.15  E-value=0.23  Score=28.11  Aligned_cols=17  Identities=18%  Similarity=0.393  Sum_probs=10.0

Q ss_pred             CCCCCCCCCCCCCCEEE
Q ss_conf             22222112234530479
Q gi|254780290|r  227 LNQHLTLLSKEGKLIII  243 (332)
Q Consensus       227 ~~~~~~~l~~~G~iv~~  243 (332)
                      ++.+.++|+++|.+++=
T Consensus       148 l~~a~~~Lk~gG~fv~K  164 (209)
T PRK11188        148 LDMCRQVLAPGGSFVVK  164 (209)
T ss_pred             HHHHHHHCCCCCEEEEE
T ss_conf             99999862679889999


No 367
>KOG4022 consensus
Probab=83.14  E-value=0.17  Score=29.02  Aligned_cols=73  Identities=18%  Similarity=0.291  Sum_probs=48.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222113444443222221222222221112232211111122332222222------2211112222222221112222
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYL------KEDFLEILQKETQGRGIDIILD  220 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~------~~~~~~~i~~~t~g~g~Divid  220 (332)
                      .+|+|+|+-|..|.+.++.-|+.+.-|..++-+++...-     +.-+++.+      ++...+++-+...|+.+|.||.
T Consensus         4 grVivYGGkGALGSacv~~FkannywV~siDl~eNe~Ad-----~sI~V~~~~swtEQe~~v~~~vg~sL~gekvDav~C   78 (236)
T KOG4022           4 GRVIVYGGKGALGSACVEFFKANNYWVLSIDLSENEQAD-----SSILVDGNKSWTEQEQSVLEQVGSSLQGEKVDAVFC   78 (236)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCEEEEEEEECCCCCCC-----CEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             549997686427689999997668689997502566566-----117963775356889999999987624253436999


Q ss_pred             CCCC
Q ss_conf             1111
Q gi|254780290|r  221 MVGA  224 (332)
Q Consensus       221 ~~G~  224 (332)
                      ..|+
T Consensus        79 VAGG   82 (236)
T KOG4022          79 VAGG   82 (236)
T ss_pred             EECC
T ss_conf             6055


No 368
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]
Probab=83.06  E-value=0.24  Score=27.99  Aligned_cols=37  Identities=38%  Similarity=0.538  Sum_probs=29.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE  181 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~  181 (332)
                      .++++||+||++++|...+.-+...|++++.+.++.+
T Consensus         4 ~~k~vlITGas~GiG~aia~~l~~~G~~v~~~~~~~~   40 (251)
T COG1028           4 SGKVALVTGASSGIGRAIARALAREGARVVVAARRSE   40 (251)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             9988999898871899999999988997999967973


No 369
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: IPR005888    The conversion of dTDP-glucose into dTDP-4-keto-6-deoxyglucose by Escherichia coli dTDP-glucose 4,6-dehydratase) takes place in the active site in three steps: dehydrogenation to dTDP-4-ketoglucose, dehydration to dTDP-4-ketoglucose-5,6-ene, and rereduction of C6 to the methyl group. The 4,6-dehydratase makes use of tightly bound NAD^+ as the coenzyme for transiently oxidizing the substrate, activating it for the dehydration step . This and other 4,6-dehydratases catalyze the first committed step in all 6-deoxysugar biosynthetic pathways described to date. Numerous 6-deoxysugars are used in bacterial lipopolysaccharide production as well as in the biosynthesis of a diverse array of secondary metabolites.; GO: 0008460 dTDP-glucose 46-dehydratase activity, 0009225 nucleotide-sugar metabolic process.
Probab=83.01  E-value=0.25  Score=27.94  Aligned_cols=41  Identities=20%  Similarity=0.242  Sum_probs=28.4

Q ss_pred             CCCCCCCCCCCCCCCCCCC-CCC-CCCCCCCC-----CCCCCCCCCCC
Q ss_conf             2221134444432222212-222-22221112-----23221111112
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLA-SYF-GATVYTTA-----KSEEKCLACLK  188 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla-~~~-G~~vi~~~-----~~~~~~~~~~~  188 (332)
                      ++||+||+|=||...+.++ +.. ..+|++.+     +++++++.+.+
T Consensus         1 ~~LVTGGaGFIGsnFvry~~~~~~D~~v~vlDkLTYAgn~e~L~~l~~   48 (340)
T TIGR01181         1 RILVTGGAGFIGSNFVRYILNEHPDAEVIVLDKLTYAGNLENLADLED   48 (340)
T ss_pred             CCEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHC
T ss_conf             923632785256899999997479957998635445578655523323


No 370
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family.
Probab=82.66  E-value=0.26  Score=27.77  Aligned_cols=52  Identities=17%  Similarity=0.280  Sum_probs=33.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCC----CCCCCCCC
Q ss_conf             22222222211344444322222122222--22211122322111111----22332222
Q gi|254780290|r  142 NLRSGQTVLIHGGSSGIGTTAIQLASYFG--ATVYTTAKSEEKCLACL----KLGAKHAI  195 (332)
Q Consensus       142 ~~~~g~~vlV~ga~g~vG~~a~qla~~~G--~~vi~~~~~~~~~~~~~----~lGa~~vi  195 (332)
                      .+++|++||  ..|.+-|--+.++|..++  .++++.+.++.|.+.++    .+|...+.
T Consensus        81 ~p~~g~~VL--D~CAaPGgKt~~la~l~~~~g~i~A~D~~~~Rl~~l~~~~~r~g~~~~~  138 (277)
T pfam01189        81 NPQEDEFIL--DMCAAPGGKTTHIAELMKNEGTVVAVDRNKQRLKRVYANIQRLGVFNII  138 (277)
T ss_pred             CCCCCCEEE--EECCCCCCHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCEE
T ss_conf             889999898--8367888169999987589877998379789999999999975997479


No 371
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase; InterPro: IPR011286   This entry describes 2-deoxy-D-gluconate 3-dehydrogenase (also called 2-keto-3-deoxygluconate oxidoreductase), a member of the family of short-chain-alcohol dehydrogenases (IPR002198 from INTERPRO). This protein has been characterised in Erwinia chrysanthemi as an enzyme of pectin degradation .; GO: 0008678 2-deoxy-D-gluconate 3-dehydrogenase activity, 0051287 NAD binding.
Probab=82.55  E-value=0.14  Score=29.53  Aligned_cols=76  Identities=25%  Similarity=0.379  Sum_probs=46.6

Q ss_pred             CCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCC-CCCC--CCCCCCCCCCC---CCCCCCCCCCC----CCCCCCCCCC
Q ss_conf             22222211344444322-2221222222221112-2322--11111122332---22222222111----1222222222
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTT-AIQLASYFGATVYTTA-KSEE--KCLACLKLGAK---HAINYLKEDFL----EILQKETQGR  213 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~-a~qla~~~G~~vi~~~-~~~~--~~~~~~~lGa~---~vi~~~~~~~~----~~i~~~t~g~  213 (332)
                      .|+.+||+|+..|+||- |+-|| ..||.|+++. .++-  -.+....+|..   -.+|-.++.-.    ++..+..  .
T Consensus         4 ~GK~alvTGa~tGlGQG~a~gLA-~AGadi~g~~~~~~~~ET~~~v~~~Gr~f~~~~~Dl~~~~~~~~~~~~~~~~~--g   80 (249)
T TIGR01832         4 EGKVALVTGANTGLGQGIAVGLA-EAGADIVGVGHISEPSETQQQVEALGRRFLSLTADLSDIEAIKALVDSAVEEF--G   80 (249)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHH-HCCCEEEEECCCCCHHHHHHHHHHHCCCEEHHHHHHHCHHHHHHHHHHHHHHH--C
T ss_conf             87768882598873689999998-57741785143126388899999825210002121223213789999999861--8


Q ss_pred             CCCCCCCCCC
Q ss_conf             1112222111
Q gi|254780290|r  214 GIDIILDMVG  223 (332)
Q Consensus       214 g~Divid~~G  223 (332)
                      .+|+.++..|
T Consensus        81 ~~DiLVNNAG   90 (249)
T TIGR01832        81 KIDILVNNAG   90 (249)
T ss_pred             CCCEEEECCC
T ss_conf             8656760742


No 372
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional
Probab=82.10  E-value=0.23  Score=28.20  Aligned_cols=22  Identities=0%  Similarity=0.015  Sum_probs=11.1

Q ss_pred             EHHH-HHHHHHHHHCCCCCCEEE
Q ss_conf             1899-999999998299813289
Q gi|254780290|r  308 PLGK-VAMAHDIMEKSEHIGKII  329 (332)
Q Consensus       308 ~l~~-i~~A~~~l~~g~~~GKvV  329 (332)
                      +|+| +.+.++..++.-..|+-+
T Consensus       323 sleeGl~~ti~wyk~~~~~~~~~  345 (347)
T PRK11908        323 TFDDALRRIFEAYRGHVADARAL  345 (347)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             69999999999998758745553


No 373
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase; InterPro: IPR010110   This entry represents a clade of shikimate-5-dehydrogenases found in Corynebacterium, Mycobacteria and fungi. The fungal sequences are pentafunctional proteins known as AroM which contain the central five seven steps in the chorismate biosynthesis pathway. The Corynebacterium and Mycobacterial sequences represent the sole shikimate-5-dehydrogenases in species which otherwise have every enzyme of the chorismate biosynthesis pathway.; GO: 0004764 shikimate 5-dehydrogenase activity, 0005737 cytoplasm.
Probab=82.06  E-value=0.31  Score=27.24  Aligned_cols=76  Identities=16%  Similarity=0.230  Sum_probs=49.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222113444443222221222222-2211122322111111223322222222211112222222221112222111
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G  223 (332)
                      .-+-||.| +||..-+|+.=+..+|+ +++.+.|+++|...|-+++...-+-..-+.+...+.+.. -+-+.+.+-|+-
T Consensus       130 ~~~glviG-aGGtsrAA~yaL~sLG~~~I~~inR~~dKl~~L~~~~~~~~~i~~~e~l~~~~~~i~-v~~~~v~vStvP  206 (291)
T TIGR01809       130 NFAGLVIG-AGGTSRAAVYALASLGVKDIYVINRSKDKLKKLVDLLVSEFVIIRLESLDKELEEIE-VKDVEVAVSTVP  206 (291)
T ss_pred             CCEEEEEC-CCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCE-EEEEEEEEEECC
T ss_conf             41058883-872148999999866997069973586676688774135613566510133411020-245678886157


No 374
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=82.01  E-value=0.25  Score=27.93  Aligned_cols=34  Identities=21%  Similarity=0.176  Sum_probs=17.5

Q ss_pred             CCCCCCCCCCCC--CCCCCCCCCCCCCCCCEE-EEEC
Q ss_conf             211122221111--112222211223453047-9833
Q gi|254780290|r  213 RGIDIILDMVGA--EYLNQHLTLLSKEGKLII-ISFL  246 (332)
Q Consensus       213 ~g~Divid~~G~--~~~~~~~~~l~~~G~iv~-~G~~  246 (332)
                      .|+..+=|+-+.  +....+++.++..+.++. +|..
T Consensus       311 ~gv~fiNDSKaTN~~a~~~Al~s~~~~~~i~lI~GG~  347 (438)
T PRK03806        311 NGVRWINDSKATNVGSTEAALNGLHVDGTLHLLLGGD  347 (438)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             9999998972158999999998262039779995477


No 375
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NADP binding domain of the Methylene-Tetrahydrofolate Dehydrogenase/cyclohydrolase (m-THF DH/cyclohydrolase) bifunctional enzyme.   Tetrahydrofolate is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional DH/cyclodrolase form. In bacteria, monofucntional DH, as well a
Probab=81.99  E-value=0.24  Score=27.98  Aligned_cols=95  Identities=20%  Similarity=0.222  Sum_probs=57.1

Q ss_pred             CCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222233322211122222-222222211344444322222122222222111223221111112233222222222111
Q gi|254780290|r  125 SLPESFFTVWANLFQTANL-RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFL  203 (332)
Q Consensus       125 ~l~~~~~tA~~~l~~~~~~-~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~  203 (332)
                      .+||+..-... |.+.+++ -.|.+++|.|-+.-+|.=...++...|+.|.. +.+                  ++.++.
T Consensus        23 ~~PcTp~ai~~-ll~~~~i~l~Gk~vvViGrS~iVG~Pla~lL~~~~atVt~-chs------------------~T~~l~   82 (168)
T cd01080          23 FIPCTPAGILE-LLKRYGIDLAGKKVVVVGRSNIVGKPLAALLLNRNATVTV-CHS------------------KTKNLK   82 (168)
T ss_pred             CCCCCHHHHHH-HHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEE-ECC------------------CCCCHH
T ss_conf             86984999999-9999498877856999878730089999999848997999-768------------------988979


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             1222222222111222211111122222112234530479833
Q gi|254780290|r  204 EILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       204 ~~i~~~t~g~g~Divid~~G~~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      +.++      ..|+++-++|...+-. -+.+++|..++.+|..
T Consensus        83 ~~~~------~ADIvIsA~G~~~li~-~~~vk~gavvIDvGin  118 (168)
T cd01080          83 EHTK------QADIVIVAVGKPGLVK-GDMVKPGAVVIDVGIN  118 (168)
T ss_pred             HHHH------HCCEEEEECCCCCCCC-HHHCCCCCEEEECCCC
T ss_conf             9741------0453554158766378-9995899889966654


No 376
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional
Probab=81.88  E-value=0.26  Score=27.80  Aligned_cols=12  Identities=0%  Similarity=0.063  Sum_probs=4.2

Q ss_pred             CCCCCCCCCCCC
Q ss_conf             111111122222
Q gi|254780290|r  105 LSHQGHTLPIPK  116 (332)
Q Consensus       105 ~~~~~~~~~iP~  116 (332)
                      ++|.+..++..+
T Consensus        95 VID~Ssa~R~~~  106 (347)
T PRK06728         95 VIDNTSEYRMAH  106 (347)
T ss_pred             EEECCHHHCCCC
T ss_conf             998975656899


No 377
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=81.86  E-value=3.6  Score=20.27  Aligned_cols=33  Identities=18%  Similarity=0.261  Sum_probs=13.6

Q ss_pred             CCCCCCCEEEEECCCCCCCCCCC-CHHHCCC-CEEEEEEE
Q ss_conf             22345304798337875432224-3343053-21677751
Q gi|254780290|r  234 LSKEGKLIIISFLGGNIATEINL-NPIISKR-ITITGSTL  271 (332)
Q Consensus       234 l~~~G~iv~~G~~~~~~~~~~~~-~~~~~~~-~~i~g~~~  271 (332)
                      =++.|.+|.+|.+   .  ++|+ ..+-..+ +.+.|++.
T Consensus       647 E~~~GVIVq~GGQ---t--p~nlA~~L~~~GG~~iLGTS~  681 (1089)
T TIGR01369       647 EKPEGVIVQFGGQ---T--PLNLAKELEEAGGVPILGTSP  681 (1089)
T ss_pred             CCCCEEEEECCCH---H--HHHHHHHHHHCCCCEEECCCH
T ss_conf             5866799974873---2--678999999708931736885


No 378
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism]
Probab=81.62  E-value=0.31  Score=27.28  Aligned_cols=15  Identities=0%  Similarity=0.073  Sum_probs=5.8

Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             211111112222222
Q gi|254780290|r  104 CLSHQGHTLPIPKGY  118 (332)
Q Consensus       104 ~~~~~~~~~~iP~~~  118 (332)
                      ++++....++..+++
T Consensus        92 ~VIdnsSa~Rm~~DV  106 (334)
T COG0136          92 VVIDNSSAFRMDPDV  106 (334)
T ss_pred             EEEECCCCCCCCCCC
T ss_conf             899687311158998


No 379
>KOG1199 consensus
Probab=81.57  E-value=0.27  Score=27.71  Aligned_cols=50  Identities=26%  Similarity=0.377  Sum_probs=23.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCC
Q ss_conf             222221134444432222212222222211122-32211111122332222
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK-SEEKCLACLKLGAKHAI  195 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~-~~~~~~~~~~lGa~~vi  195 (332)
                      |-..||+|++++.|.++..-+...|+.|+-.+- +..-.+.+|++|-..+|
T Consensus         9 glvalvtggasglg~ataerlakqgasv~lldlp~skg~~vakelg~~~vf   59 (260)
T KOG1199           9 GLVALVTGGASGLGKATAERLAKQGASVALLDLPQSKGADVAKELGGKVVF   59 (260)
T ss_pred             CEEEEEECCCCCCCHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCCCEEE
T ss_conf             725786167552027789999846860798727765446799984893698


No 380
>PRK00811 spermidine synthase; Provisional
Probab=81.43  E-value=0.15  Score=29.35  Aligned_cols=94  Identities=21%  Similarity=0.275  Sum_probs=55.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC-C--CCCCCC-----CCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222113444443222221222222-221112232211111122-3--322222-----22221111222222222111
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKL-G--AKHAIN-----YLKEDFLEILQKETQGRGID  216 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~l-G--a~~vi~-----~~~~~~~~~i~~~t~g~g~D  216 (332)
                      -++|||.|  ||-|..+-+++|+.+. +|..+...++=.+.++++ .  ....++     -.-+|..+-+.+ +. ..+|
T Consensus        79 pk~VLIiG--GGDGg~~rE~lkh~~v~~v~~VeiD~~Vi~~~~~~lp~~~~~~~~dprv~~~~~Dg~~fv~~-~~-~~yD  154 (283)
T PRK00811         79 PKKVLIIG--GGDGGTLREVLKHPSVEKITMVEIDERVVEMSRKYLPEISGGAWDDPRVELVIGDGVKFVRE-TE-NSFD  154 (283)
T ss_pred             CCEEEEEC--CCCHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHCCCCCEEEEHHHHHHHHHH-CC-CCCC
T ss_conf             77489956--87479999984278856799994689999999998388631330297159982789999984-52-3554


Q ss_pred             CCC-CC---CCC-------CCCCCCCCCCCCCCCCEEE
Q ss_conf             222-21---111-------1122222112234530479
Q gi|254780290|r  217 IIL-DM---VGA-------EYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       217 ivi-d~---~G~-------~~~~~~~~~l~~~G~iv~~  243 (332)
                      +|| |+   .|.       +.++.+.+.|+++|.+++-
T Consensus       155 vII~D~tDP~gpa~~Lft~~Fy~~~~~~L~~~Gi~v~Q  192 (283)
T PRK00811        155 VIIVDSTDPVGPAEGLFTKEFYENCKRALKEGGIFVAQ  192 (283)
T ss_pred             EEEEECCCCCCHHHHHCCHHHHHHHHHHCCCCCEEEEC
T ss_conf             89980899886445534599999999853999589992


No 381
>PRK06932 glycerate dehydrogenase; Provisional
Probab=81.08  E-value=2.1  Score=21.75  Aligned_cols=33  Identities=24%  Similarity=0.394  Sum_probs=28.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK  178 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~  178 (332)
                      .|.++-|.| .|.+|+...++|+.+|++|+...+
T Consensus       146 ~gktvGIiG-~G~IG~~va~~~~~fGm~V~~~~~  178 (314)
T PRK06932        146 RGSTLGVFG-KGCLGSEVGRLATALGMKVLYAEH  178 (314)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHCCCCEEEEECC
T ss_conf             386889976-352888999998528988999787


No 382
>PRK10258 biotin biosynthesis protein BioC; Provisional
Probab=80.93  E-value=0.29  Score=27.48  Aligned_cols=95  Identities=19%  Similarity=0.164  Sum_probs=56.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222211344444322222122222222111223221111112233222222222111122222222211122221
Q gi|254780290|r  142 NLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDM  221 (332)
Q Consensus       142 ~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~  221 (332)
                      ..++..+||=.| | |.|.+.-.+++ .++++++++-++.-++.+++.++..  ++...|. +.+. . ....+|+|+-+
T Consensus        39 ~~~~~~~vLDlG-c-GtG~~t~~l~~-~~~~v~~~Dls~~Ml~~a~~~~~~~--~~~~~D~-e~Lp-~-~~~sfDli~S~  110 (251)
T PRK10258         39 PQRKFTHVLDAG-C-GPGWMSRYWRE-RGSQVTALDLSPPMLAQARQKDAAD--HYLAGDI-ESLP-L-ATATFDLAWSN  110 (251)
T ss_pred             CCCCCCCEEEEE-E-HHHHHHHHHHH-CCCEEEEEECCHHHHHHHHHHCCCH--HHHHCHH-HHCC-C-CCCCCCEEEEC
T ss_conf             657899399983-1-00278999997-4996999959899999998748633--4353606-3099-9-87882178550


Q ss_pred             CC-------CCCCCCCCCCCCCCCCCEEEE
Q ss_conf             11-------111222221122345304798
Q gi|254780290|r  222 VG-------AEYLNQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       222 ~G-------~~~~~~~~~~l~~~G~iv~~G  244 (332)
                      ..       ...+....++|+|||.++.-.
T Consensus       111 ~~lqW~~d~~~~l~e~~rvLkPgG~l~fst  140 (251)
T PRK10258        111 LAVQWCGNLSTALRELYRVVRPGGVVAFTT  140 (251)
T ss_pred             CCHHHCCCHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             404525999999999996458994999981


No 383
>PTZ00075 S-adenosyl-L-homocysteine hydrolase; Provisional
Probab=80.89  E-value=0.33  Score=27.07  Aligned_cols=103  Identities=17%  Similarity=0.280  Sum_probs=64.8

Q ss_pred             CCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             3322211122222-222222211344444322222122222222111223221111112233222222222111122222
Q gi|254780290|r  131 FTVWANLFQTANL-RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKE  209 (332)
Q Consensus       131 ~tA~~~l~~~~~~-~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~  209 (332)
                      .+.+.++.+.-++ -.|++++|.| =|-+|.=.++-++.+|++|++|.-.|-+.-.+.--|.. |..     ..+.+.  
T Consensus       238 qS~~dgi~raTn~liaGK~vVV~G-YG~~GkG~A~~~rg~GA~ViVtEiDPi~ALqA~MdGf~-V~~-----m~ea~~--  308 (476)
T PTZ00075        238 ESLVDGIKRATDVMIAGKTVVVCG-YGDVGKGCAQALRGFGARVVVTEIDPICALQAAMEGYQ-VVL-----LEDVVE--  308 (476)
T ss_pred             HHHHHHHHHHHCCEECCCEEEEEE-CCCCCHHHHHHHCCCCCEEEEECCCCHHHHHHHHCCCE-EEE-----HHHHHH--
T ss_conf             659999998628345475899950-45301214766535897899961680789998745878-756-----999883--


Q ss_pred             CCCCCCCCCCCCCCC-CCC-CCCCCCCCCCCCCEEEEEC
Q ss_conf             222211122221111-112-2222112234530479833
Q gi|254780290|r  210 TQGRGIDIILDMVGA-EYL-NQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       210 t~g~g~Divid~~G~-~~~-~~~~~~l~~~G~iv~~G~~  246 (332)
                          -.|+++.++|. +.+ ...+..++.+..++.+|..
T Consensus       309 ----~~DifVTaTGn~~VI~~~H~~~MKdgaIl~N~GHf  343 (476)
T PTZ00075        309 ----TADIFVTATGNDDIITLEHFPRMKDDAIVGNIGHF  343 (476)
T ss_pred             ----HCCEEEEECCCCCCCCHHHHHHHCCCEEEEECCCC
T ss_conf             ----39999993499774689999865378099945878


No 384
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=80.85  E-value=3.8  Score=20.06  Aligned_cols=86  Identities=15%  Similarity=0.140  Sum_probs=37.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCC-CHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHHHHHC
Q ss_conf             222111111222221122345304798337875432224-3343053216777512400011378999999999999986
Q gi|254780290|r  218 ILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINL-NPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS  296 (332)
Q Consensus       218 vid~~G~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~-~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~~i~~  296 (332)
                      .|+.+.-+..-..++.-++.|.++.+|..   .  ++++ ..+...++.+.|.......   ..+.|+    +..+++.+
T Consensus       612 YFEPlt~E~V~~I~~~E~p~gVivqfGGQ---t--~lnla~~L~~~gv~IlGts~~~Id---~aEdR~----~F~~ll~~  679 (1068)
T PRK12815        612 YFEPITLEDILNVAEAENIKGVIVQFGGQ---T--AINLAKPLEEAGLPILGTSPDTID---RLEDRD----RFYQLLDE  679 (1068)
T ss_pred             EECCCCHHHHHHHHHHHCCCEEEEECCCC---C--HHHHHHHHHHCCCEEECCCHHHHH---HHHHHH----HHHHHHHH
T ss_conf             75368799999999985899799964882---3--679999999769949827868864---241399----99999997


Q ss_pred             -CCCCCCCEEEEEHHHHHHH
Q ss_conf             -9831021247418999999
Q gi|254780290|r  297 -HVIAPVIHTVLPLGKVAMA  315 (332)
Q Consensus       297 -g~l~p~i~~~~~l~~i~~A  315 (332)
                       |.-.|.-....+++++.+.
T Consensus       680 l~i~~p~~~~~~~~~ea~~~  699 (1068)
T PRK12815        680 LGLPHVPGLTATSEEEALAF  699 (1068)
T ss_pred             CCCCCCCCCEECCHHHHHHH
T ss_conf             38999996354566799999


No 385
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit. Members of this protein family are YgfK, predicted to be one subunit of a three-subunit, molybdopterin-containing selenate reductase. This enzyme is found, typically, in genomic regions associated with xanthine dehydrogenase homologs predicted to belong to the selenium-dependent molybdenum hydroxylases (SDMH). Therefore, the selenate reductase is suggested to play a role in furnishing selenide for SelD, the selenophosphate synthase.
Probab=80.83  E-value=0.18  Score=28.89  Aligned_cols=34  Identities=24%  Similarity=0.330  Sum_probs=17.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC-CCC-CCCCCC
Q ss_conf             22222221134444432222212222-222-211122
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYF-GAT-VYTTAK  178 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~-G~~-vi~~~~  178 (332)
                      ..|++|+|+|| |.++.=++.-|+.+ |++ |..+.+
T Consensus       664 ~~GK~VVVIGG-GNTAMDcARTAlRl~GAe~VtvvYR  699 (1012)
T TIGR03315       664 PLGKHVVVVGG-GNTAMDAARAALRVPGVEKVTVVYR  699 (1012)
T ss_pred             CCCCEEEEECC-CHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             68995899898-4799999999875078875799825


No 386
>PRK13940 glutamyl-tRNA reductase; Provisional
Probab=80.76  E-value=0.21  Score=28.38  Aligned_cols=73  Identities=18%  Similarity=0.247  Sum_probs=46.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222-211122322111-11122332222222221111222222222111222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCL-ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMV  222 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~~~~~~-~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~  222 (332)
                      .+.++||.| +|-+|.++++.+...|++ ++.+-|+.+|.+ ++.+++-..+...  .++.+.+.      .+|+||-++
T Consensus       180 ~~~~vlvvG-aGem~~l~~k~L~~~g~~~i~v~nRt~~ra~~la~~~~~~~~~~~--~~l~~~l~------~aDivisaT  250 (414)
T PRK13940        180 SSKNVLIIG-AGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYL--SELPQLIK------KADIIIAAV  250 (414)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCCCH--HHHHHHHH------HCCEEEEEC
T ss_conf             228389966-864789999999976998799945756779999997088850169--99999986------388799816


Q ss_pred             CCCC
Q ss_conf             1111
Q gi|254780290|r  223 GAEY  226 (332)
Q Consensus       223 G~~~  226 (332)
                      |...
T Consensus       251 ~a~~  254 (414)
T PRK13940        251 NVLE  254 (414)
T ss_pred             CCCH
T ss_conf             9824


No 387
>PRK03612 spermidine synthase; Provisional
Probab=80.71  E-value=0.23  Score=28.09  Aligned_cols=95  Identities=22%  Similarity=0.262  Sum_probs=57.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCC---C--CCCCCC-----CCCCCCCCCCCCCCCCC
Q ss_conf             22222113444443222221222222-2211122322111111223---3--222222-----22211112222222221
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLG---A--KHAINY-----LKEDFLEILQKETQGRG  214 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lG---a--~~vi~~-----~~~~~~~~i~~~t~g~g  214 (332)
                      -++|||.|  ||-|.++=+++|+.+. +|..++-.++-.+++|+..   .  .+.++.     ...|...-+++.  .+.
T Consensus       294 p~~VLiiG--GGdG~a~revLk~~~ve~v~lVelD~~vv~lar~~~~l~~~n~~a~~DpRv~v~~~Da~~~l~~~--~~~  369 (516)
T PRK03612        294 ARRVLILG--GGDGLALREVLKYPDVEQVTLVDLDPAVTELARTSPALRALNGGALDDPRVTVVNDDAFNWLRKL--PET  369 (516)
T ss_pred             CCEEEEEC--CCCCHHHHHHHCCCCCCEEEEEECCHHHHHHHHHCCCHHHHHCCCCCCCCEEEEEHHHHHHHHHC--CCC
T ss_conf             77389983--77608799986489966378995188999999857214444123234996489853789999868--887


Q ss_pred             CCCCC-CCCCC-----------CCCCCCCCCCCCCCCCEEEE
Q ss_conf             11222-21111-----------11222221122345304798
Q gi|254780290|r  215 IDIIL-DMVGA-----------EYLNQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       215 ~Divi-d~~G~-----------~~~~~~~~~l~~~G~iv~~G  244 (332)
                      +|+|+ |....           +..+..-+.|+++|.+++-+
T Consensus       370 yDvIi~D~pdP~~~~~~~LYs~eFY~~~~~~L~~~G~~v~qs  411 (516)
T PRK03612        370 FDAIIVDLPDPSNPALGKLYSVEFYRLLKRRLAPDGLLVVQS  411 (516)
T ss_pred             CCEEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEC
T ss_conf             888998189979952246753999999998449995899936


No 388
>PRK13984 putative oxidoreductase; Provisional
Probab=80.70  E-value=0.23  Score=28.21  Aligned_cols=74  Identities=26%  Similarity=0.265  Sum_probs=46.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---------------------CCCCCCCCCCCCCCCCCC-CC
Q ss_conf             22222221134444432222212222222211122322---------------------111111223322222222-21
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE---------------------KCLACLKLGAKHAINYLK-ED  201 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~---------------------~~~~~~~lGa~~vi~~~~-~~  201 (332)
                      +.|++|.|+| +|+-||.+.+.+..+|.+|++..+.++                     +.+.++++|++-..|..- .|
T Consensus       281 ~tGKKVAVIG-sGPAGLaaA~~Lar~Gh~VtVFE~~~~~GGlL~yGIP~fRLpk~vv~rei~~i~~~GV~f~~n~~VGkD  359 (604)
T PRK13984        281 KKGKKVAIVG-SGPAGLSAAYFLATMGYEVEVYESLSKPGGVMRYGIPSYRLPDEALDKDIAFIEALGVKIHTNTRVGKD  359 (604)
T ss_pred             CCCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEECCCEECCC
T ss_conf             7899899989-868999999999986986899745677897233158722287899999999999729899768577984


Q ss_pred             C-CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1-112222222221112222111
Q gi|254780290|r  202 F-LEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       202 ~-~~~i~~~t~g~g~Divid~~G  223 (332)
                      + .++|+     +++|.||=++|
T Consensus       360 it~eeL~-----~~yDAVfLa~G  377 (604)
T PRK13984        360 ISLEELR-----EKHDAVFVSTG  377 (604)
T ss_pred             CCHHHHH-----HCCCEEEEECC
T ss_conf             7899997-----05899999538


No 389
>PRK05600 thiamine biosynthesis protein ThiF; Validated
Probab=80.64  E-value=0.22  Score=28.29  Aligned_cols=23  Identities=35%  Similarity=0.576  Sum_probs=10.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222113444443222221222222
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGA  171 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~  171 (332)
                      +|||.| +||+|.-+++++.+.|.
T Consensus        43 ~VlvvG-~GGLG~p~~~yLaaaGv   65 (370)
T PRK05600         43 RVLVIG-AGGLGCPAMQSLASAGV   65 (370)
T ss_pred             CEEEEC-CCHHHHHHHHHHHHCCC
T ss_conf             789988-87578999999998289


No 390
>KOG4169 consensus
Probab=80.62  E-value=0.22  Score=28.28  Aligned_cols=105  Identities=26%  Similarity=0.323  Sum_probs=61.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCC-CCC---CCCCC---CCCCCCCCCC
Q ss_conf             22222113444443222221222222221112232211111122332-----222-222---22111---1222222222
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK-----HAI-NYL---KEDFL---EILQKETQGR  213 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~-----~vi-~~~---~~~~~---~~i~~~t~g~  213 (332)
                      |.+++++|++||+|+....-+...|+++.++..+.++.+.-.+|-+-     .+| -++   ..+..   +++.+.. | 
T Consensus         5 GKna~vtggagGIGl~~sk~Ll~kgik~~~i~~~~En~~a~akL~ai~p~~~v~F~~~DVt~~~~~~~~f~ki~~~f-g-   82 (261)
T KOG4169           5 GKNALVTGGAGGIGLATSKALLEKGIKVLVIDDSEENPEAIAKLQAINPSVSVIFIKCDVTNRGDLEAAFDKILATF-G-   82 (261)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCHHEEEHHHHHCHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHH-C-
T ss_conf             74589963786366999999997671540610401478999988603998439999801200788999999999870-9-


Q ss_pred             CCCCCCCCCCC---CCCC---------------CCCCCC-----CCCCCCEEEEECCCCCCC
Q ss_conf             11122221111---1122---------------222112-----234530479833787543
Q gi|254780290|r  214 GIDIILDMVGA---EYLN---------------QHLTLL-----SKEGKLIIISFLGGNIAT  252 (332)
Q Consensus       214 g~Divid~~G~---~~~~---------------~~~~~l-----~~~G~iv~~G~~~~~~~~  252 (332)
                      -.|+.++..|-   ..++               .++.++     .++|.++.++...|-.+.
T Consensus        83 ~iDIlINgAGi~~dkd~e~Ti~vNLtgvin~T~~alpyMdk~~gG~GGiIvNmsSv~GL~P~  144 (261)
T KOG4169          83 TIDILINGAGILDDKDWERTINVNLTGVINGTQLALPYMDKKQGGKGGIIVNMSSVAGLDPM  144 (261)
T ss_pred             CEEEEECCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCC
T ss_conf             45799716644461207786502221200336663044554349998189970110266766


No 391
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NAD(P) binding domains of methylene-tetrahydrofolate dehydrogenase (m-THF DH) and  m-THF DH/cyclohydrolase bifunctional enzymes (m-THF DH/cyclohydrolase). M-THF is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional
Probab=80.41  E-value=0.46  Score=26.14  Aligned_cols=83  Identities=19%  Similarity=0.213  Sum_probs=53.5

Q ss_pred             CCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1222222-222222113444443222221222222221112232211111122332222222221111222222222111
Q gi|254780290|r  138 FQTANLR-SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGID  216 (332)
Q Consensus       138 ~~~~~~~-~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~D  216 (332)
                      .+.+++. .|++++|.|-+.-+|.=...++...|+.|+..-                   +++.|+.+.+++      .|
T Consensus        19 l~~y~i~l~Gk~vvVvGrS~~VG~Pla~lL~~~~atVt~~h-------------------s~t~~l~~~~~~------AD   73 (140)
T cd05212          19 LNKEGVRLDGKKVLVVGRSGIVGAPLQCLLQRDGATVYSCD-------------------WKTIQLQSKVHD------AD   73 (140)
T ss_pred             HHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEC-------------------CCCCCHHHHHHH------CC
T ss_conf             99809999999999999981249999999997889899946-------------------999598998523------49


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             222211111122222112234530479833
Q gi|254780290|r  217 IILDMVGAEYLNQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       217 ivid~~G~~~~~~~~~~l~~~G~iv~~G~~  246 (332)
                      +++-++|...+=.. +.+++|..++.+|..
T Consensus        74 IvI~a~G~p~~i~~-~~vk~GavvIDvGi~  102 (140)
T cd05212          74 VVVVGSPKPEKVPT-EWIKPGATVINCSPT  102 (140)
T ss_pred             EEEECCCCCCCCCH-HHCCCCCEEEEECCC
T ss_conf             99981687672789-776799889980377


No 392
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=80.30  E-value=0.3  Score=27.34  Aligned_cols=33  Identities=24%  Similarity=0.145  Sum_probs=13.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2221134444432222212222222211122322
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE  181 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~  181 (332)
                      +|.|.| +|.+|.--++.+...|++|...+.+++
T Consensus         9 ~VaVIG-aG~MG~giAa~~a~~G~~V~l~D~~~~   41 (321)
T PRK07066          9 TFAAIG-SGVIGSGWVARALAHGLDVVAWDPAPG   41 (321)
T ss_pred             EEEEEC-CCHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             799988-878889999999947985999969888


No 393
>PRK10717 cysteine synthase A; Provisional
Probab=79.67  E-value=0.23  Score=28.08  Aligned_cols=57  Identities=23%  Similarity=0.216  Sum_probs=39.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCC
Q ss_conf             1222222222222113444443222221222222221112---232211111122332222
Q gi|254780290|r  138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTA---KSEEKCLACLKLGAKHAI  195 (332)
Q Consensus       138 ~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~---~~~~~~~~~~~lGa~~vi  195 (332)
                      .+.+.++||.+| |...+|..|++....|+.+|.+.+.+.   .+++|.+.++.+||+.+.
T Consensus        56 ~~~G~l~~g~~v-veaSSGN~g~alA~~a~~~G~~~~iv~p~~~~~~k~~~i~~~GAeVi~  115 (334)
T PRK10717         56 EKRGLLKPGGTI-VEGTAGNTGIGLALVAAARGYKTVIVMPETQSQEKKDLLRALGAELVE  115 (334)
T ss_pred             HHCCCCCCCCEE-EEECCCCHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHCCCEEEE
T ss_conf             983998899889-982797389999999998099659995685459999999975983997


No 394
>pfam02254 TrkA_N TrkA-N domain. This domain is found in a wide variety of proteins. These protein include potassium channels, phosphoesterases, and various other transporters. This domain binds to NAD.
Probab=79.67  E-value=0.23  Score=28.10  Aligned_cols=71  Identities=18%  Similarity=0.233  Sum_probs=45.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22113444443222221222222221112232211111122332222-222221111222222222111222211111
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI-NYLKEDFLEILQKETQGRGIDIILDMVGAE  225 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi-~~~~~~~~~~i~~~t~g~g~Divid~~G~~  225 (332)
                      |+|.| .|.+|...++.++..| +|++++.++++.+.+++.|...++ |.+++++.++    .+-..+|.++-+++.+
T Consensus         1 viI~G-~g~~G~~la~~L~~~~-~v~vId~d~~~~~~~~~~~~~vi~GD~~~~~~L~~----a~i~~a~~vi~~~~~d   72 (115)
T pfam02254         1 IIIIG-YGRVGRSLAEELREGG-PVVVIDKDPERVEELREEGVPVVVGDATDEEVLEE----AGIEDADAVVAATGDD   72 (115)
T ss_pred             CEEEC-CCHHHHHHHHHHHHCC-CEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHH----HCCCCCCEEEEECCCH
T ss_conf             99987-8889999999998089-99999998799877886698699995688667876----1920287999962984


No 395
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed
Probab=79.62  E-value=0.23  Score=28.18  Aligned_cols=145  Identities=21%  Similarity=0.223  Sum_probs=72.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222333322112233333221111111222222232221222222333222111222-2222222221134444432222
Q gi|254780290|r   85 WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTA-NLRSGQTVLIHGGSSGIGTTAI  163 (332)
Q Consensus        85 ~~~GdrV~~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~-~~~~g~~vlV~ga~g~vG~~a~  163 (332)
                      +++|+|.+-..   +|.+. ..+....+.+..++.|=..    . ..|...+|.-.. -+++|++||=.|  .|.|.+++
T Consensus       110 ~~ig~~~~I~P---sw~~~-~~~~~~~I~idPgmAFGTG----~-H~TT~lcl~~l~~~~~~~~~vLDvG--~GSGILaI  178 (298)
T PRK00517        110 IRIGDRLWIVP---SWHEA-PDPGAINIELDPGLAFGTG----T-HPTTRLCLEWLEKLVLPGKTVLDVG--CGSGILAI  178 (298)
T ss_pred             EEECCEEEEEC---CCCCC-CCCCCEEEEECCCCCCCCC----C-CHHHHHHHHHHHHHCCCCCEEEEEC--CCCHHHHH
T ss_conf             89768399938---98879-9987347986664345677----7-7479999999984354688688715--77069999


Q ss_pred             CCCCCCCC-CCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCC
Q ss_conf             21222222-221112232211111122----332222222221111222222222111222211111----122222112
Q gi|254780290|r  164 QLASYFGA-TVYTTAKSEEKCLACLKL----GAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAE----YLNQHLTLL  234 (332)
Q Consensus       164 qla~~~G~-~vi~~~~~~~~~~~~~~l----Ga~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~----~~~~~~~~l  234 (332)
                      - |..+|+ +|++++..+.-.+.+++.    |.+..+.-...+      .......+|+|+=.+-.+    ......+.+
T Consensus       179 a-A~klGa~~v~a~DiD~~Av~~a~eN~~lN~v~~~~~~~~~~------~~~~~~~~DlvvANIla~vl~~l~~~~~~~l  251 (298)
T PRK00517        179 A-AAKLGAKPVLAIDIDPQAVEAARENAELNGVDDRLELYLPE------DQPLEGKADVIVANILANPLIELAPDLAALV  251 (298)
T ss_pred             H-HHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEECCC------CCCCCCCCCEEEEECCHHHHHHHHHHHHHHH
T ss_conf             9-99749984999989899999999999986998426896166------4344676468997315899999999999973


Q ss_pred             CCCCCCEEEEECC
Q ss_conf             2345304798337
Q gi|254780290|r  235 SKEGKLIIISFLG  247 (332)
Q Consensus       235 ~~~G~iv~~G~~~  247 (332)
                      +++|+++.-|...
T Consensus       252 ~~~G~lilSGIl~  264 (298)
T PRK00517        252 KPGGRLILSGILA  264 (298)
T ss_pred             CCCCEEEEECCCH
T ss_conf             8997999927848


No 396
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional
Probab=79.52  E-value=0.21  Score=28.42  Aligned_cols=40  Identities=20%  Similarity=0.272  Sum_probs=31.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222222211344444322222122222222111223
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKS  179 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~  179 (332)
                      +...--.|.+++|.| .|.||+.+++.+..+|++|++++.+
T Consensus       245 ~~~~~l~gk~vaIqG-fGNVg~~aA~kl~e~GakVVavSDs  284 (469)
T PTZ00079        245 SLNIVVEKKTAVVSG-SGNVAQYCVEKLLQLGAKVLTLSDS  284 (469)
T ss_pred             HCCCCCCCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             679985788899976-6738999999999769989999838


No 397
>cd01487 E1_ThiF_like E1_ThiF_like. Member of superfamily of activating enzymes (E1) of the ubiquitin-like proteins. The common reaction mechanism catalyzed by E1-like enzymes begins with a nucleophilic attack of the C-terminal carboxylate of the ubiquitin-like substrate, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of the substrate. The exact function of this family is unknown.
Probab=79.25  E-value=0.18  Score=28.78  Aligned_cols=28  Identities=25%  Similarity=0.342  Sum_probs=21.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             2221134444432222212222222-2111
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGAT-VYTT  176 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~-vi~~  176 (332)
                      +|+|.| +||+|..+.+++...|.. +..+
T Consensus         1 kV~IvG-~GGLG~~~a~~La~aGvg~i~lv   29 (174)
T cd01487           1 KVGIAG-AGGLGSNIAVLLARSGVGNLKLV   29 (174)
T ss_pred             CEEEEC-CCHHHHHHHHHHHHHCCCEEEEE
T ss_conf             989987-67889999999998189739999


No 398
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=78.76  E-value=0.35  Score=26.93  Aligned_cols=22  Identities=9%  Similarity=-0.062  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             8999999999982998132898
Q gi|254780290|r  309 LGKVAMAHDIMEKSEHIGKIIL  330 (332)
Q Consensus       309 l~~i~~A~~~l~~g~~~GKvVi  330 (332)
                      .+.+++|.+...+-...|.+|+
T Consensus       419 ~~~l~~av~~a~~~a~~gd~VL  440 (476)
T PRK00141        419 EEAMREAVAAAFSLAEPGDSVV  440 (476)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEE
T ss_conf             8899999999997388989899


No 399
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=78.74  E-value=0.28  Score=27.54  Aligned_cols=25  Identities=16%  Similarity=0.268  Sum_probs=15.5

Q ss_pred             EEEHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             7418999999999982998132898
Q gi|254780290|r  306 VLPLGKVAMAHDIMEKSEHIGKIIL  330 (332)
Q Consensus       306 ~~~l~~i~~A~~~l~~g~~~GKvVi  330 (332)
                      ++..+++++|++...+--..|.+|+
T Consensus       406 ~~~~~~l~~Av~~a~~~a~~gd~VL  430 (458)
T PRK01710        406 IVIVNSLEEAVKVAKNIAEKGDIIT  430 (458)
T ss_pred             EEHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             2337359999999997588979899


No 400
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. For example, leucine DH catalyzes the reversible oxidative deamination of L-leucine and several other straight or branched chain amino acids to the corresponding 2-oxoacid derivative. Amino acid DH -like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily inc
Probab=78.50  E-value=0.25  Score=27.85  Aligned_cols=69  Identities=19%  Similarity=0.185  Sum_probs=45.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111-223322222222211112222222221112222111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL-KLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~-~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G  223 (332)
                      .|.+|.|+| .|.||..+.+++...|++|++++.++.+...++ ..|++.+ +  .    +++.    ...+|+.+=|.-
T Consensus        27 ~gk~VaIqG-~GnVG~~~A~~l~~~Gakvvv~d~~~~~~~~~~~~~~~~~~-~--~----~~~~----~~~~DIl~PcA~   94 (200)
T cd01075          27 EGKTVAVQG-LGKVGYKLAEHLLEEGAKLIVADINEEAVARAAELFGATVV-A--P----EEIY----SVDADVFAPCAL   94 (200)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEE-C--C----HHHH----CCCCCEEEECCC
T ss_conf             899999989-87999999999996799799982688999999856898893-7--3----3232----277768865141


Q ss_pred             CC
Q ss_conf             11
Q gi|254780290|r  224 AE  225 (332)
Q Consensus       224 ~~  225 (332)
                      +.
T Consensus        95 ~~   96 (200)
T cd01075          95 GG   96 (200)
T ss_pred             CC
T ss_conf             15


No 401
>PRK12550 shikimate 5-dehydrogenase; Reviewed
Probab=78.46  E-value=0.25  Score=27.92  Aligned_cols=70  Identities=17%  Similarity=0.187  Sum_probs=44.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222222113444443222221222222-2211122322111111-223322222222211112222222221112
Q gi|254780290|r  140 TANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACL-KLGAKHAINYLKEDFLEILQKETQGRGIDI  217 (332)
Q Consensus       140 ~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~-~lGa~~vi~~~~~~~~~~i~~~t~g~g~Di  217 (332)
                      ...+.++.+++|.| +||.+.+++.-++..|+ +++.+.|+.++.+.+. .++.++.         ..+    ....+|+
T Consensus       116 ~~~~~~~~~~lilG-aGGaarai~~aL~~~G~~~i~I~nR~~~~a~~L~~~~~~~~~---------~~~----~~~~~dl  181 (272)
T PRK12550        116 EYQVPPDAVVALRG-SGGMAKAVAAALRDAGFTDGTIVARNEKTGKALAELYGYEWR---------PDL----GGIEADL  181 (272)
T ss_pred             HCCCCCCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCCC---------CCC----CCCCCCE
T ss_conf             70888677389973-623389999999976998799998998999999987397334---------643----3466897


Q ss_pred             CCCCCC
Q ss_conf             222111
Q gi|254780290|r  218 ILDMVG  223 (332)
Q Consensus       218 vid~~G  223 (332)
                      +++++.
T Consensus       182 iINaTp  187 (272)
T PRK12550        182 LVNVTP  187 (272)
T ss_pred             EEECCC
T ss_conf             996676


No 402
>PRK08644 thiamine biosynthesis protein ThiF; Provisional
Probab=78.40  E-value=0.25  Score=27.95  Aligned_cols=30  Identities=20%  Similarity=0.247  Sum_probs=23.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             222221134444432222212222222-2111
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGAT-VYTT  176 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~-vi~~  176 (332)
                      ..+|+|.| +||+|..+++++...|.- +..+
T Consensus        27 ~s~VlivG-~GGLG~~~a~~La~aGVG~i~lv   57 (209)
T PRK08644         27 KAKVGIAG-AGGLGSNIAVALARSGVGNLKLV   57 (209)
T ss_pred             CCCEEEEC-CCHHHHHHHHHHHHHCCCEEEEE
T ss_conf             29689988-87889999999999389818998


No 403
>PRK13685 hypothetical protein; Provisional
Probab=77.73  E-value=0.28  Score=27.60  Aligned_cols=93  Identities=17%  Similarity=0.156  Sum_probs=43.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-------CCCCCCCCCCC
Q ss_conf             22223333221122333332---211111112222222322212222223332221112222-------22222222113
Q gi|254780290|r   84 HWNIGDEVCALVNGGGYAEY---CLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTAN-------LRSGQTVLIHG  153 (332)
Q Consensus        84 ~~~~GdrV~~~~~~G~~ae~---~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~~-------~~~g~~vlV~g  153 (332)
                      ..+.|||| |+...++.|-.   ...|.+.+...=++++....-+++.+..+|...+.+...       .++..-||++.
T Consensus       124 ~~~~~dri-Glv~Fa~~a~~~~plT~D~~~~~~~l~~l~~~~~taiG~ai~~Al~~l~~~~~~~~~~~~~~~~~IILLTD  202 (326)
T PRK13685        124 QLTPGINL-GLIAFAGTATVLVSPTTNREATKNALDKLQLADRTATGEGIFTALQAIATVGAVIGGGDTPPPARIVLFSD  202 (326)
T ss_pred             HCCCCCEE-EEEEECCCCEECCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECC
T ss_conf             37988828-99996587201489875399999999846878888640689999999986332014567778867999748


Q ss_pred             CCCCCC---------CCCCCCCCCCCCCCCCCC
Q ss_conf             444443---------222221222222221112
Q gi|254780290|r  154 GSSGIG---------TTAIQLASYFGATVYTTA  177 (332)
Q Consensus       154 a~g~vG---------~~a~qla~~~G~~vi~~~  177 (332)
                      |...+|         +.|.++|+..|.+|+.+.
T Consensus       203 G~~n~g~~~~~p~~~~~AA~~A~~~gi~IyTIg  235 (326)
T PRK13685        203 GKETVPTNPDNPKGAYTAARTAKDQGVPISTIS  235 (326)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEE
T ss_conf             997778898873029999999998599489999


No 404
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed
Probab=77.55  E-value=0.49  Score=25.97  Aligned_cols=14  Identities=7%  Similarity=0.268  Sum_probs=10.3

Q ss_pred             CCCCEEEEEECCCC
Q ss_conf             77620899991568
Q gi|254780290|r    3 ICKKMRHVAMSGYG   16 (332)
Q Consensus         3 ~~~~Mka~v~~~~g   16 (332)
                      |+++||-.++=..|
T Consensus         1 M~~~~~VaIvGATG   14 (336)
T PRK05671          1 MSQPLDIAVVGATG   14 (336)
T ss_pred             CCCCCEEEEECCCC
T ss_conf             99888799999864


No 405
>pfam03848 TehB Tellurite resistance protein TehB.
Probab=77.28  E-value=0.55  Score=25.66  Aligned_cols=97  Identities=20%  Similarity=0.263  Sum_probs=53.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222211344444322222122222222111223221111112233222--22222211112222222221112222
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHA--INYLKEDFLEILQKETQGRGIDIILD  220 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~v--i~~~~~~~~~~i~~~t~g~g~Divid  220 (332)
                      ++||+ +|=.| | |-|.-++-|| ..|.+|.+++.|+...+.++++-..+-  ++....|+    .+..-.+.+|.|+.
T Consensus        29 i~pgk-~LDlg-c-G~GRNslyLa-~~G~~VtavD~n~~aL~~l~~ia~~e~l~i~~~~~Di----n~~~~~e~YD~Iis  100 (192)
T pfam03848        29 VKPGK-ALDLG-C-GQGRNSLFLS-LLGYDVTAVDHNENSIANLQDIKEKENLDIPTALYDI----NSASIDENYDFILS  100 (192)
T ss_pred             CCCCC-EEEEC-C-CCCHHHHHHH-HCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEECC----CCCCCCCCCCEEEE
T ss_conf             79974-66604-7-8973189998-6899179997999999999999997099752687315----55687677687988


Q ss_pred             CCC-----C----CCCCCCCCCCCCCCCCEEEEECC
Q ss_conf             111-----1----11222221122345304798337
Q gi|254780290|r  221 MVG-----A----EYLNQHLTLLSKEGKLIIISFLG  247 (332)
Q Consensus       221 ~~G-----~----~~~~~~~~~l~~~G~iv~~G~~~  247 (332)
                      ++-     .    +.+...-++.++||-....+..+
T Consensus       101 TVvfmFL~~~~ip~iI~~mq~~T~pGGynlIv~am~  136 (192)
T pfam03848       101 TVVLMFLQAERIPAIIANMQEHTNVGGYNLIVAAMS  136 (192)
T ss_pred             EEEEEECCHHHHHHHHHHHHHHCCCCCEEEEEEEEC
T ss_conf             887773186787799999998528998899997614


No 406
>PRK08294 phenol 2-monooxygenase; Provisional
Probab=77.24  E-value=0.57  Score=25.54  Aligned_cols=18  Identities=17%  Similarity=0.311  Sum_probs=8.7

Q ss_pred             HHHHHHCCCCCCEEE-EEC
Q ss_conf             999998299813289-839
Q gi|254780290|r  315 AHDIMEKSEHIGKII-LLP  332 (332)
Q Consensus       315 A~~~l~~g~~~GKvV-i~P  332 (332)
                      ||+..--.+..|.+| |+|
T Consensus       588 ay~~~Gid~~~G~vVVvRP  606 (634)
T PRK08294        588 IFDLRGIDREDGCVVVVRP  606 (634)
T ss_pred             HHHHCCCCCCCEEEEEECC
T ss_conf             7664484877647999999


No 407
>pfam00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain. This family represents the largest portion of the catalytic domain of 2-hydroxyacid dehydrogenases as the NAD binding domain is inserted within the structural domain.
Probab=77.23  E-value=2.9  Score=20.83  Aligned_cols=35  Identities=26%  Similarity=0.370  Sum_probs=28.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE  180 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~  180 (332)
                      .|.++.|.| .|.+|......++.+|+++++.....
T Consensus       136 ~~~~~giiG-~G~iG~~va~~~~~~g~~v~~~d~~~  170 (313)
T pfam00389       136 RGKTLGVIG-GGGIGGIGAAIAKALGMGVVAYDPYP  170 (313)
T ss_pred             CCCEEEEEE-ECCHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             898899994-65436999999997698699995799


No 408
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]
Probab=77.13  E-value=0.27  Score=27.70  Aligned_cols=71  Identities=21%  Similarity=0.340  Sum_probs=47.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222-21112232211-111122332222222221111222222222111222211
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKC-LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMV  222 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~~~~~-~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~  222 (332)
                      .+.++||.| +|-+|..+++.+...|.+ ++..-|+.+|. ++++++|++. +.+++  +.+.+.      -+|+||-++
T Consensus       177 ~~~~vlvIG-AGem~~lva~~L~~~g~~~i~IaNRT~erA~~La~~~~~~~-~~l~e--l~~~l~------~~DvVissT  246 (414)
T COG0373         177 KDKKVLVIG-AGEMGELVAKHLAEKGVKKITIANRTLERAEELAKKLGAEA-VALEE--LLEALA------EADVVISST  246 (414)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCEE-ECHHH--HHHHHH------HCCEEEEEC
T ss_conf             467699986-51899999999985898779997587899999999838702-21877--887652------079999906


Q ss_pred             CCC
Q ss_conf             111
Q gi|254780290|r  223 GAE  225 (332)
Q Consensus       223 G~~  225 (332)
                      |.+
T Consensus       247 sa~  249 (414)
T COG0373         247 SAP  249 (414)
T ss_pred             CCC
T ss_conf             998


No 409
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed
Probab=77.08  E-value=0.26  Score=27.75  Aligned_cols=31  Identities=16%  Similarity=0.208  Sum_probs=14.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222113444443222221222222221112
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTA  177 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~  177 (332)
                      |++|.|.| +|+-||.+...+..+|.+|++..
T Consensus       310 gkKVAVIG-sGPAGLaaA~~Lar~G~~VTVfE  340 (639)
T PRK12809        310 SEKVAVIG-AGPAGLGCADILARAGVQVDVFD  340 (639)
T ss_pred             CCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99899989-75899999999997599069993


No 410
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism]
Probab=76.89  E-value=0.35  Score=26.91  Aligned_cols=71  Identities=18%  Similarity=0.257  Sum_probs=43.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCC-CCCCCC----CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222113444443222221222222-2211122322111111-223322----222222211112222222221112
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACL-KLGAKH----AINYLKEDFLEILQKETQGRGIDI  217 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~-~lGa~~----vi~~~~~~~~~~i~~~t~g~g~Di  217 (332)
                      .++++++|.|| ||.+.+++.-++..|+ +++.+-|+.+|.+.+. .++...    ..+..+      +...   ..+|+
T Consensus       124 ~~~~~vlilGA-GGAarAv~~aL~~~g~~~i~V~NRt~~ra~~La~~~~~~~~~~~~~~~~~------~~~~---~~~dl  193 (283)
T COG0169         124 VTGKRVLILGA-GGAARAVAFALAEAGAKRITVVNRTRERAEELADLFGELGAAVEAAALAD------LEGL---EEADL  193 (283)
T ss_pred             CCCCEEEEECC-CHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCCC------CCCC---CCCCE
T ss_conf             67888999897-68999999999986998799995888999999998645056311024554------1235---54578


Q ss_pred             CCCCCCC
Q ss_conf             2221111
Q gi|254780290|r  218 ILDMVGA  224 (332)
Q Consensus       218 vid~~G~  224 (332)
                      +++++..
T Consensus       194 iINaTp~  200 (283)
T COG0169         194 LINATPV  200 (283)
T ss_pred             EEECCCC
T ss_conf             9978878


No 411
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=76.88  E-value=0.47  Score=26.06  Aligned_cols=22  Identities=14%  Similarity=0.258  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHHCC-CCCCEEEE
Q ss_conf             89999999999829-98132898
Q gi|254780290|r  309 LGKVAMAHDIMEKS-EHIGKIIL  330 (332)
Q Consensus       309 l~~i~~A~~~l~~g-~~~GKvVi  330 (332)
                      .+++++|.+...+. ...|-+|+
T Consensus       405 ~~~l~~Av~~a~~~~~~~gd~VL  427 (468)
T PRK04690        405 ADDLPHAMALARTALGAQGGVVL  427 (468)
T ss_pred             CCCHHHHHHHHHHHCCCCCCEEE
T ss_conf             06799999999996058999899


No 412
>pfam07021 MetW Methionine biosynthesis protein MetW. This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins. Biosynthesis of methionine from homoserine in Pseudomonas putida takes place in three steps. The first step is the acylation of homoserine to yield an acyl-L-homoserine. This reaction is catalysed by the products of the metXW genes and is equivalent to the first step in enterobacteria, gram-positive bacteria and fungi, except that in these microorganisms the reaction is catalysed by a single polypeptide (the product of the metA gene in Escherichia coli and the met5 gene product in Neurospora crassa). In Pseudomonas putida, as in gram-positive bacteria and certain fungi, the second and third steps are a direct sulfhydrylation that converts the O-acyl-L-homoserine into homocysteine and further methylation to yield methionine. The latter reaction can be mediated by either of the two methionine synthetases present in the cells.
Probab=76.72  E-value=0.56  Score=25.57  Aligned_cols=91  Identities=15%  Similarity=0.079  Sum_probs=53.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222113444443222221222222221112232211111122332222222221111222222222111222211
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMV  222 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~  222 (332)
                      +++|++||=.| || -|.++-.+.+..++++++++.++++...+.+.|... +   ..|+.+.+.. .....||+|+-+-
T Consensus        11 I~~~srVLDlG-CG-~G~ll~~L~~~k~v~~~GvEid~~~v~~a~~kg~~V-i---~~D~d~~l~~-f~d~sFD~VIls~   83 (193)
T pfam07021        11 IPPGSRVLDLG-CG-DGSLLYLLQEEKQVDGRGIELDAAGVAECVAKGLSV-I---QGDADKGLEH-FPDKSFDYVILSQ   83 (193)
T ss_pred             CCCCCEEEEEC-CC-CCHHHHHHHHCCCCCEEEECCCHHHHHHHHHCCCCE-E---CCCHHHCHHH-CCCCCCCEEEHHH
T ss_conf             58969899836-88-989999998766987698338999999998647954-5---0774459745-7767803786987


Q ss_pred             CC----CCCCCCCCCCCCCCCC
Q ss_conf             11----1122222112234530
Q gi|254780290|r  223 GA----EYLNQHLTLLSKEGKL  240 (332)
Q Consensus       223 G~----~~~~~~~~~l~~~G~i  240 (332)
                      --    +.....-++++.++++
T Consensus        84 vLqhl~~P~~vL~EmlRVgk~~  105 (193)
T pfam07021        84 TLQATRNPREVLDELLRIGRRA  105 (193)
T ss_pred             HHHHHCCCHHHHHHHHHHCCEE
T ss_conf             9987528199999985126869


No 413
>PRK09414 glutamate dehydrogenase; Provisional
Probab=76.71  E-value=0.26  Score=27.78  Aligned_cols=34  Identities=38%  Similarity=0.521  Sum_probs=29.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKS  179 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~  179 (332)
                      .|.+++|.| .|.||+.+++.+..+|++|+++..+
T Consensus       228 ~gk~v~IqG-fGNVg~~aA~~l~e~GakvVavSDs  261 (446)
T PRK09414        228 EGKTVVVSG-SGNVAIYAIEKAMELGAKVVTCSDS  261 (446)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             788799977-7779999999999769979999837


No 414
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT). This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes. Thiopurine S-methyltransferase (TPMT) is a cytosolic enzyme that catalyses S-methylation of aromatic and heterocyclic sulfhydryl compounds, including anticancer and immunosuppressive thiopurines.
Probab=76.59  E-value=0.59  Score=25.42  Aligned_cols=100  Identities=23%  Similarity=0.269  Sum_probs=55.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCC-------CCCC-------CCCCC
Q ss_conf             22222222222113444443222221222222221112232211111-122332222-------2222-------21111
Q gi|254780290|r  140 TANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC-LKLGAKHAI-------NYLK-------EDFLE  204 (332)
Q Consensus       140 ~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~-~~lGa~~vi-------~~~~-------~~~~~  204 (332)
                      ...+.++.+|||-+ ||- |.-+. ++...|.+|++++-++.-++.. ++.+.+..+       .|+.       .|+-+
T Consensus        17 ~l~~~~~~rvlVPl-CGk-s~D~~-wLa~~G~~VvGvels~~Av~~ff~e~~~~~~~~~~~~~~~~~~~~i~i~~gD~F~   93 (203)
T pfam05724        17 ALNLPPGLRVLVPL-CGK-ALDMV-WLAEQGHFVVGVEISELAVEKFFAEANLSPPITELSGFKEYRAGGIELLCGDFFT   93 (203)
T ss_pred             HCCCCCCCEEEEEC-CCC-HHHHH-HHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCEECCCCEEECCCCEEEEECCHHC
T ss_conf             63899998899968-998-59999-9983898489995679999999997378875101366213205864899773213


Q ss_pred             CCCCCCCCCCCCCCCCCCC---------CCCCCCCCCCCCCCCCCEEEE
Q ss_conf             2222222221112222111---------111222221122345304798
Q gi|254780290|r  205 ILQKETQGRGIDIILDMVG---------AEYLNQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       205 ~i~~~t~g~g~Divid~~G---------~~~~~~~~~~l~~~G~iv~~G  244 (332)
                      --.+.  ...||.|+|...         .++.++..++|+++|++..+.
T Consensus        94 l~~~~--~g~fD~IyDraal~ALpp~~R~~Ya~~l~~lL~pgg~~lLit  140 (203)
T pfam05724        94 LPREE--LGKFDLIYDRAALCALPPEMRPRYAKQMYELLPPGGEGLLIT  140 (203)
T ss_pred             CCHHH--CCCCCEEEEECCEEECCHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             78434--687348997032353898999999999999718996699999


No 415
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E.coli hypothetical protein ygdL. The common reaction mechanism catalyzed by E1-like enzymes begins with a nucleophilic attack of the C-terminal carboxylate of the ubiquitin-like substrate, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of the substrate. The exact function of this family is unknown.
Probab=76.49  E-value=0.33  Score=27.09  Aligned_cols=29  Identities=21%  Similarity=0.291  Sum_probs=22.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             22222113444443222221222222-2211
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGA-TVYT  175 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~  175 (332)
                      ..+|+|.| +||+|..+++.+-..|. +++-
T Consensus        11 ~s~V~v~G-~GGvGs~~a~~LarsGVG~l~l   40 (231)
T cd00755          11 NAHVAVVG-LGGVGSWAAEALARSGVGKLTL   40 (231)
T ss_pred             CCCEEEEC-CCHHHHHHHHHHHHCCCCEEEE
T ss_conf             49789988-8636899999999809975999


No 416
>KOG0069 consensus
Probab=76.40  E-value=0.51  Score=25.86  Aligned_cols=89  Identities=17%  Similarity=0.204  Sum_probs=55.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             222222221134444432222212222222211122322111111223322222222211112222222221112-2221
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDI-ILDM  221 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Di-vid~  221 (332)
                      -..|++|.|.| .|.+|+...+=++.+|+.+.-..+++..-+...+.+++      ..++.+.+.+      .|+ ++.|
T Consensus       159 ~~~gK~vgilG-~G~IG~~ia~rL~~Fg~~i~y~~r~~~~~~~~~~~~~~------~~d~~~~~~~------sD~ivv~~  225 (336)
T KOG0069         159 DLEGKTVGILG-LGRIGKAIAKRLKPFGCVILYHSRTQLPPEEAYEYYAE------FVDIEELLAN------SDVIVVNC  225 (336)
T ss_pred             CCCCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHCCC------CCCHHHHHHH------CCEEEEEC
T ss_conf             65677799962-74788999996353266255411357763668874354------3678888732------88799926


Q ss_pred             CCCCC----C-CCCCCCCCCCCCCEEEE
Q ss_conf             11111----2-22221122345304798
Q gi|254780290|r  222 VGAEY----L-NQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       222 ~G~~~----~-~~~~~~l~~~G~iv~~G  244 (332)
                      ...+.    + ...+..|++++.++.++
T Consensus       226 pLt~~T~~liNk~~~~~mk~g~vlVN~a  253 (336)
T KOG0069         226 PLTKETRHLINKKFIEKMKDGAVLVNTA  253 (336)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             8977888776099998647976999646


No 417
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=76.29  E-value=0.56  Score=25.57  Aligned_cols=39  Identities=28%  Similarity=0.533  Sum_probs=29.0

Q ss_pred             CCCCCCCCCCCCCCCCCCC-CCCCCCCC-CCCCCCCCCCCCC
Q ss_conf             2222221134444432222-21222222-2211122322111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAI-QLASYFGA-TVYTTAKSEEKCL  184 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~-qla~~~G~-~vi~~~~~~~~~~  184 (332)
                      .|++|||+||+|++|.-.+ |+++. +. +++...+++.+..
T Consensus       249 ~gK~vLVTGagGSiGsel~~qil~~-~p~~i~l~~~~E~~~~  289 (588)
T COG1086         249 TGKTVLVTGGGGSIGSELCRQILKF-NPKEIILFSRDEYKLY  289 (588)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHC-CCCEEEEECCCHHHHH
T ss_conf             7988999689873679999999854-9878999617637799


No 418
>pfam01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain. This Pfam entry contains the following members: N-acetyl-glutamine semialdehyde dehydrogenase (AgrC) Aspartate-semialdehyde dehydrogenase
Probab=76.22  E-value=0.52  Score=25.81  Aligned_cols=89  Identities=13%  Similarity=0.097  Sum_probs=42.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22211344444322222122-22222211122322-11111122332222222221111222222222111222211111
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLAS-YFGATVYTTAKSEE-KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAE  225 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~-~~G~~vi~~~~~~~-~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~  225 (332)
                      +|.|.||+|-+|+-.++++. +...++..+..+.. .-+...+..- +.-+..+-.+.+.-.+.  -.++|++|.|++..
T Consensus         1 kvaIiGatGyvG~eLirlL~~hp~~~i~~l~~s~~saG~~~~~~~~-~~~~~~~~~~~~~~~~~--~~~~Dvvf~alp~~   77 (121)
T pfam01118         1 KVAIVGATGYVGQELLRLLAEHPPLELVALVASSRSAGKKVAFAGP-WLTGGVDLLLEDVDPED--LKDVDIVFFALPAG   77 (121)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHHHCC-CCCCCCCCEEEECCHHH--HCCCCEEEECCCHH
T ss_conf             9999893619999999999718875513788505658960144165-42466664477589778--53898999838768


Q ss_pred             CCCCCCCCCCCCCC
Q ss_conf             12222211223453
Q gi|254780290|r  226 YLNQHLTLLSKEGK  239 (332)
Q Consensus       226 ~~~~~~~~l~~~G~  239 (332)
                      ......+-+...|.
T Consensus        78 ~s~~~~~~~~~~g~   91 (121)
T pfam01118        78 VSKELAPKLLEAGA   91 (121)
T ss_pred             HHHHHHHHHHHCCC
T ss_conf             99999999871598


No 419
>PRK04148 hypothetical protein; Provisional
Probab=76.17  E-value=0.63  Score=25.25  Aligned_cols=32  Identities=16%  Similarity=0.089  Sum_probs=24.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             21222222221112232211111122332222
Q gi|254780290|r  164 QLASYFGATVYTTAKSEEKCLACLKLGAKHAI  195 (332)
Q Consensus       164 qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi  195 (332)
                      ..++..|++|++|+-++...+-+++.|...+.
T Consensus        33 ~~L~e~g~dv~~~Din~~aV~~a~~~Gl~~v~   64 (135)
T PRK04148         33 KKLKESGFDVIVIDINKKAVEKAKKLGLNAFV   64 (135)
T ss_pred             HHHHHCCCCEEEEECCHHHHHHHHHCCCCEEE
T ss_conf             99987499889995765543221232876375


No 420
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain. This domain is inserted into the catalytic domain, the large dehydrogenase and D-lactate dehydrogenase families in SCOP. N-terminal portion of which is represented by family pfam00389.
Probab=75.44  E-value=0.52  Score=25.79  Aligned_cols=86  Identities=26%  Similarity=0.307  Sum_probs=53.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-
Q ss_conf             2222221134444432222212222222211122322111111223322222222211112222222221112222111-
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG-  223 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G-  223 (332)
                      .|+++.|.| .|.+|....++++.+|++|++..++.....  ...++.    +  .++.+-+.      ..|+++-++- 
T Consensus        35 ~gk~vgIiG-~G~IG~~va~~l~~fg~~V~~~d~~~~~~~--~~~~~~----~--~~l~~ll~------~sDii~~~~pl   99 (176)
T pfam02826        35 SGKTVGIIG-LGRIGRAVARRLKAFGMKVIAYDRYPKAEA--EALGAR----Y--VSLDELLA------ESDVVSLHLPL   99 (176)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHHCCCEEEECCCCCCHH--HHCCEE----E--CCHHHHHH------HCCEEEECCCC
T ss_conf             999999989-699999999999983981254379876102--315716----6--68999986------29988754767


Q ss_pred             CC----CC-CCCCCCCCCCCCCEEEEE
Q ss_conf             11----12-222211223453047983
Q gi|254780290|r  224 AE----YL-NQHLTLLSKEGKLIIISF  245 (332)
Q Consensus       224 ~~----~~-~~~~~~l~~~G~iv~~G~  245 (332)
                      .+    .+ ...++.|+++..++.+|.
T Consensus       100 t~~T~~li~~~~l~~mk~~a~lIN~sR  126 (176)
T pfam02826       100 TPETRHLINAERLALMKPGAILINTAR  126 (176)
T ss_pred             CCCCCCCCCHHHHHHHCCCCEEEEECC
T ss_conf             420246346999985189988998067


No 421
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus. NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate. This family represents the N-terminal NAD-binding domain.
Probab=75.35  E-value=0.42  Score=26.42  Aligned_cols=93  Identities=19%  Similarity=0.173  Sum_probs=49.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22221134444432222212222222211122322111111223322------222222211112222222221112222
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKH------AINYLKEDFLEILQKETQGRGIDIILD  220 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~------vi~~~~~~~~~~i~~~t~g~g~Divid  220 (332)
                      ++|.|.| +|..|.+..+.+...|-+|...+++++..+.+.+-+-..      .+ ..+-.+...+.+..  .+.|+++-
T Consensus         1 kKI~IiG-aG~wGtAla~~la~n~~~V~l~~r~~~~~~~i~~~~~n~~~lp~~~l-~~~i~~~~dl~~a~--~~adiIii   76 (159)
T pfam01210         1 KKIAVLG-AGSWGTALAKVLARNGHEVRLWGRDEELIEEINTTRENVKYLPGIKL-PDNLRATTDLEEAI--KGADIIVL   76 (159)
T ss_pred             CEEEEEC-CCHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHCCCCCHHCCCCCC-CCCEEECCCHHHHH--HCCCEEEE
T ss_conf             9899999-69999999999998799899999043666778866978210478645-55305428899998--37989999


Q ss_pred             CCCCCCCCCCCCC----CCCCCCCEEE
Q ss_conf             1111112222211----2234530479
Q gi|254780290|r  221 MVGAEYLNQHLTL----LSKEGKLIII  243 (332)
Q Consensus       221 ~~G~~~~~~~~~~----l~~~G~iv~~  243 (332)
                      ++-...++..++-    +..+-.++.+
T Consensus        77 avps~~~~~~~~~i~~~~~~~~~iv~~  103 (159)
T pfam01210        77 AVPSQALREVLKQLKGLLSPGAILVSL  103 (159)
T ss_pred             ECCHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             174889999999998655765568887


No 422
>KOG3010 consensus
Probab=75.04  E-value=0.69  Score=25.00  Aligned_cols=103  Identities=16%  Similarity=0.199  Sum_probs=56.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC-CCCCCCCC-CCCC
Q ss_conf             22222222222211344444322222122222222111223221111112233222222222-111-12222222-2211
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKE-DFL-EILQKETQ-GRGI  215 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~-~~~-~~i~~~t~-g~g~  215 (332)
                      ..+....+.+.++-- +.|-|+++.-+|-+.- +||+|+.|++.++.+++.--.  .+.+.+ .+. +....+.+ .+.+
T Consensus        26 ~ia~~~~~h~~a~Dv-G~G~Gqa~~~iae~~k-~VIatD~s~~mL~~a~k~~~~--~y~~t~~~ms~~~~v~L~g~e~SV  101 (261)
T KOG3010          26 KIASRTEGHRLAWDV-GTGNGQAARGIAEHYK-EVIATDVSEAMLKVAKKHPPV--TYCHTPSTMSSDEMVDLLGGEESV  101 (261)
T ss_pred             HHHHHCCCCCEEEEE-CCCCCCCHHHHHHHHH-HHEEECCCHHHHHHHHCCCCC--CCCCCCCCCCCCCCCCCCCCCCCE
T ss_conf             998428886458884-5688711478887543-431306879999986118986--204578534566565323787641


Q ss_pred             CCCCCCCCC------CCCCCCCCCCCCCC-CCEEEEE
Q ss_conf             122221111------11222221122345-3047983
Q gi|254780290|r  216 DIILDMVGA------EYLNQHLTLLSKEG-KLIIISF  245 (332)
Q Consensus       216 Divid~~G~------~~~~~~~~~l~~~G-~iv~~G~  245 (332)
                      |+|.-.-+-      ..+..+-+.|++.| .+..-+.
T Consensus       102 DlI~~Aqa~HWFdle~fy~~~~rvLRk~Gg~iavW~Y  138 (261)
T KOG3010         102 DLITAAQAVHWFDLERFYKEAYRVLRKDGGLIAVWNY  138 (261)
T ss_pred             EEEHHHHHHHHHCHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             2110545677634299999999980778977999972


No 423
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=74.98  E-value=0.47  Score=26.10  Aligned_cols=21  Identities=14%  Similarity=0.162  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHHCCCCCCEEEE
Q ss_conf             999999999982998132898
Q gi|254780290|r  310 GKVAMAHDIMEKSEHIGKIIL  330 (332)
Q Consensus       310 ~~i~~A~~~l~~g~~~GKvVi  330 (332)
                      +++++|.+...+--..|.+|+
T Consensus       445 ~~l~~Av~~a~~~a~~gd~VL  465 (501)
T PRK02006        445 ATLEEAVRAAAELAQPGDAVL  465 (501)
T ss_pred             CCHHHHHHHHHHHCCCCCEEE
T ss_conf             999999999997578979899


No 424
>PRK07411 hypothetical protein; Validated
Probab=74.98  E-value=0.49  Score=25.94  Aligned_cols=11  Identities=9%  Similarity=0.271  Sum_probs=4.0

Q ss_pred             EEEEEEEEEEE
Q ss_conf             28999999982
Q gi|254780290|r   35 EILIKVEAIGV   45 (332)
Q Consensus        35 ~vlV~v~~~~i   45 (332)
                      |+|-.....|-
T Consensus        81 Q~l~~~~~vG~   91 (390)
T PRK07411         81 QVIHGTSWVGK   91 (390)
T ss_pred             CCCCCHHCCCC
T ss_conf             43666200797


No 425
>PRK02947 hypothetical protein; Provisional
Probab=74.94  E-value=0.94  Score=24.11  Aligned_cols=71  Identities=18%  Similarity=0.174  Sum_probs=42.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1112222222222221134444432222---2122222222111223221111112233222222222111122222222
Q gi|254780290|r  136 NLFQTANLRSGQTVLIHGGSSGIGTTAI---QLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQG  212 (332)
Q Consensus       136 ~l~~~~~~~~g~~vlV~ga~g~vG~~a~---qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g  212 (332)
                      .+.+..+++++|.++|.. .||.-.+.+   +.||..|++||++++-+... ...+         +.+ --+.+.+.   
T Consensus        98 ~il~~~~i~~~Dvlii~S-nSG~N~~pVE~A~~ak~~G~~VIaiTS~~~s~-~~~s---------rH~-SGkkL~d~---  162 (247)
T PRK02947         98 LILDRYPIRPGDVLIIVS-NSGRNAVPIEMALEAKERGAKVIAVTSLAYSK-SVAS---------RHS-SGKRLYEV---  162 (247)
T ss_pred             HHHHHCCCCCCCEEEEEE-CCCCCHHHHHHHHHHHHCCCEEEEEECHHHHC-CCCC---------CCC-CCCEEHHH---
T ss_conf             999867999998899996-78777689999999998699699996678816-7899---------897-66711563---


Q ss_pred             CCCCCCCCCCC
Q ss_conf             21112222111
Q gi|254780290|r  213 RGIDIILDMVG  223 (332)
Q Consensus       213 ~g~Divid~~G  223 (332)
                        +|+|||+-+
T Consensus       163 --aDiviDN~~  171 (247)
T PRK02947        163 --ADVVIDNGA  171 (247)
T ss_pred             --CCEEEECCC
T ss_conf             --667865799


No 426
>PRK06545 prephenate dehydrogenase; Validated
Probab=74.50  E-value=0.18  Score=28.86  Aligned_cols=11  Identities=18%  Similarity=0.075  Sum_probs=3.7

Q ss_pred             CCCCCCCCCCC
Q ss_conf             33322112233
Q gi|254780290|r   89 DEVCALVNGGG   99 (332)
Q Consensus        89 drV~~~~~~G~   99 (332)
                      |-|+-..|...
T Consensus        62 DlVvlatPv~~   72 (357)
T PRK06545         62 DLIVLAVPVDA   72 (357)
T ss_pred             CEEEECCCHHH
T ss_conf             99999499999


No 427
>pfam01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family. The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones.
Probab=74.43  E-value=0.39  Score=26.62  Aligned_cols=29  Identities=24%  Similarity=0.309  Sum_probs=18.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC--CCCCCCC
Q ss_conf             2113444443222221222222--2211122
Q gi|254780290|r  150 LIHGGSSGIGTTAIQLASYFGA--TVYTTAK  178 (332)
Q Consensus       150 lV~ga~g~vG~~a~qla~~~G~--~vi~~~~  178 (332)
                      ||+||+|=+|...++.+...|.  +|.+.++
T Consensus         1 LVTGg~GFIGs~lv~~Ll~~g~~~~V~~~d~   31 (280)
T pfam01073         1 LVTGGGGFLGRHIVRLLLREGELQEVRVFDL   31 (280)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             9058675999999999997799757999878


No 428
>KOG3201 consensus
Probab=74.27  E-value=0.46  Score=26.17  Aligned_cols=114  Identities=21%  Similarity=0.246  Sum_probs=65.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCC-CCCCCCC------CCC
Q ss_conf             3322211122222222222211344444322222122222-2221112232211111122332-2222222------211
Q gi|254780290|r  131 FTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKCLACLKLGAK-HAINYLK------EDF  202 (332)
Q Consensus       131 ~tA~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G-~~vi~~~~~~~~~~~~~~lGa~-~vi~~~~------~~~  202 (332)
                      .-||+.|.+-..+ .|.+|+=.| +|-.|++-+.+|...- ..|..|+++++..+-+++.--. ....++.      ...
T Consensus        16 ala~~~l~~~n~~-rg~~ilelg-ggft~laglmia~~a~~~~v~ltdgne~svrnv~ki~~~n~~s~~tsc~vlrw~~~   93 (201)
T KOG3201          16 ALAWTILRDPNKI-RGRRILELG-GGFTGLAGLMIACKAPDSSVWLTDGNEESVRNVEKIRNSNMASSLTSCCVLRWLIW   93 (201)
T ss_pred             HHHHHHHHCHHHH-HHHHHHHHC-CCHHHHHHHHEEEECCCCEEEEECCCHHHHHHHHHHHHCCCCCCCCEEHHHHHHHH
T ss_conf             9999998060677-678898726-74465545520453587358871697899997999985120025650003478776


Q ss_pred             CCCCCCCCCCCCCCCCC--CCCCC-----CCCCCCCCCCCCCCCCEEEEECCC
Q ss_conf             11222222222111222--21111-----112222211223453047983378
Q gi|254780290|r  203 LEILQKETQGRGIDIIL--DMVGA-----EYLNQHLTLLSKEGKLIIISFLGG  248 (332)
Q Consensus       203 ~~~i~~~t~g~g~Divi--d~~G~-----~~~~~~~~~l~~~G~iv~~G~~~~  248 (332)
                      ..+..+  .+..||+|+  ||+.-     +..+....+|+|.|+-..++..-+
T Consensus        94 ~aqsq~--eq~tFDiIlaADClFfdE~h~sLvdtIk~lL~p~g~Al~fsPRRg  144 (201)
T KOG3201          94 GAQSQQ--EQHTFDIILAADCLFFDEHHESLVDTIKSLLRPSGRALLFSPRRG  144 (201)
T ss_pred             HHHHHH--HHCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             448887--517022798601025889999999999998584666167667555


No 429
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. Glutamate DH is a multidomain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms. Enzymes involved in ammonia assimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids 
Probab=74.26  E-value=0.29  Score=27.44  Aligned_cols=35  Identities=29%  Similarity=0.406  Sum_probs=30.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222211344444322222122222222111223
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKS  179 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~  179 (332)
                      -.|.+++|.| .|.||..+++++...|++|++++.+
T Consensus        29 l~g~~v~IqG-~GnVG~~~a~~L~~~Gakvv~vsD~   63 (227)
T cd01076          29 LAGARVAIQG-FGNVGSHAARFLHEAGAKVVAVSDS   63 (227)
T ss_pred             CCCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             7899999989-8899999999999879959999847


No 430
>PRK06849 hypothetical protein; Provisional
Probab=74.16  E-value=0.35  Score=26.91  Aligned_cols=11  Identities=18%  Similarity=0.096  Sum_probs=4.7

Q ss_pred             CCCCCCCCCCC
Q ss_conf             22211122221
Q gi|254780290|r  211 QGRGIDIILDM  221 (332)
Q Consensus       211 ~g~g~Divid~  221 (332)
                      +.-.||.+.|-
T Consensus       253 G~isFDFI~~~  263 (387)
T PRK06849        253 GQISFDFIQTE  263 (387)
T ss_pred             EEEEEEEEECC
T ss_conf             58999999989


No 431
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism]
Probab=74.08  E-value=0.45  Score=26.19  Aligned_cols=36  Identities=25%  Similarity=0.377  Sum_probs=31.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE  181 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~  181 (332)
                      .|.+|.|.| .|.||+.+++.+...|++|++++.+..
T Consensus       206 ~G~rVaVQG-~GNVg~~aa~~l~~~GAkvv~~sds~g  241 (411)
T COG0334         206 EGARVAVQG-FGNVGQYAAEKLHELGAKVVAVSDSKG  241 (411)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             887899977-628999999999974997999976788


No 432
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional
Probab=74.04  E-value=0.67  Score=25.08  Aligned_cols=33  Identities=21%  Similarity=0.214  Sum_probs=24.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK  178 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~  178 (332)
                      .|++|.|.| +|+-||.+...+..+|.+|+....
T Consensus       438 ~GkKVAVIG-sGPAGLsaA~~La~~G~~VtVFE~  470 (760)
T PRK12778        438 NGIKVAVIG-SGPAGLSFAGDMAKYGYDVTVFEA  470 (760)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             899899989-778999999999977990699805


No 433
>PRK06718 precorrin-2 dehydrogenase; Reviewed
Probab=73.73  E-value=1.5  Score=22.83  Aligned_cols=91  Identities=14%  Similarity=0.135  Sum_probs=45.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112233222222222111122222222211122221111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA  224 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~  224 (332)
                      .|.++||.| +|.++.-=++.+...|++|.+++..-  .+.++++-.+.-+.....++...-     =.++++||-+++.
T Consensus         9 ~gk~vLVVG-GG~vA~rK~~~Ll~~gA~VtVvsp~~--~~el~~l~~~~~i~~~~~~~~~~d-----l~~~~lViaAT~d   80 (202)
T PRK06718          9 SNKRVVIVG-GGKVAGRRAITLLKYGAHITVISPEI--TENLVKLVEEGKIRWKEKEFEPSD-----IVDAFLVIAATND   80 (202)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECCCC--CHHHHHHHHCCCCEEEECCCCHHH-----HCCCCEEEECCCC
T ss_conf             898699988-98999999999986899699986999--989999997699447616788667-----5167044552798


Q ss_pred             CCCCCCCCCCCCCCCCEEE
Q ss_conf             1122222112234530479
Q gi|254780290|r  225 EYLNQHLTLLSKEGKLIII  243 (332)
Q Consensus       225 ~~~~~~~~~l~~~G~iv~~  243 (332)
                      ..++..+...+..+.++.+
T Consensus        81 ~~~N~~i~~~~~~~~lvNv   99 (202)
T PRK06718         81 PRVNEAVAEALPENALFNV   99 (202)
T ss_pred             HHHHHHHHHHHHHCCCEEE
T ss_conf             9999999998654487575


No 434
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated
Probab=73.72  E-value=0.5  Score=25.92  Aligned_cols=13  Identities=8%  Similarity=0.450  Sum_probs=4.7

Q ss_pred             EEEEEEEEEEECH
Q ss_conf             2899999998278
Q gi|254780290|r   35 EILIKVEAIGVNR   47 (332)
Q Consensus        35 ~vlV~v~~~~in~   47 (332)
                      |+|-.....|-+.
T Consensus        71 Q~l~~~~~iG~~K   83 (355)
T PRK05597         71 QVIHTTAGVGTPK   83 (355)
T ss_pred             HHCCCCCCCCCCH
T ss_conf             7565412179797


No 435
>PRK08639 threonine dehydratase; Validated
Probab=73.40  E-value=1  Score=23.89  Aligned_cols=32  Identities=13%  Similarity=0.129  Sum_probs=13.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCC
Q ss_conf             22221134444432222212222--222211122
Q gi|254780290|r  147 QTVLIHGGSSGIGTTAIQLASYF--GATVYTTAK  178 (332)
Q Consensus       147 ~~vlV~ga~g~vG~~a~qla~~~--G~~vi~~~~  178 (332)
                      |.|++--|+||.-.-....+|.+  ..+||++..
T Consensus       179 D~vvvpvGGGGLiaGia~~lK~~~P~ikIiGVEp  212 (418)
T PRK08639        179 DYVFVPVGGGGLISGVTTYLKEVSPKTKVIGVEP  212 (418)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             8899961873689999999985099971899815


No 436
>PRK12749 quinate/shikimate dehydrogenase; Reviewed
Probab=73.27  E-value=0.67  Score=25.06  Aligned_cols=41  Identities=17%  Similarity=0.212  Sum_probs=25.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222-21112232211111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLAC  186 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~~~~~~~~  186 (332)
                      ++.+++|.| +||.+.+++..+...|++ +..+.|++++.+.+
T Consensus       123 ~~k~~lIlG-aGGaa~Ai~~~l~~~g~~~i~i~nR~~~~~~~~  164 (288)
T PRK12749        123 KGKTMVLLG-AGGASTAIGAQGAIEGLKEIKLFNRRDEFFDKA  164 (288)
T ss_pred             CCCEEEEEE-CCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHH
T ss_conf             677689982-345889999999976998799996885578999


No 437
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. Glutamate DH is a multidomain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms. Enzymes involved in ammonia asimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids t
Probab=73.25  E-value=0.37  Score=26.81  Aligned_cols=33  Identities=30%  Similarity=0.372  Sum_probs=29.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK  178 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~  178 (332)
                      +|.++.|+| -|.||+.+.+++...|++|+++..
T Consensus        37 ~g~~vaIQG-fGnVG~~aA~~l~e~GakvVaVsD   69 (254)
T cd05313          37 KGKRVAISG-SGNVAQYAAEKLLELGAKVVTLSD   69 (254)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             899999989-779999999999977997999985


No 438
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase. Members of this protein family are CoA-disulfide reductase (EC 1.8.1.14), as characterized in Staphylococcus aureus, Pyrococcus horikoshii, and Borrelia burgdorferi, and inferred in several other species on the basis of high levels of CoA and an absence of glutathione as a protective thiol.
Probab=73.21  E-value=0.46  Score=26.16  Aligned_cols=80  Identities=18%  Similarity=0.166  Sum_probs=45.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-------------CCCCCCCCCCCCCCCCCCCCC--CCCC
Q ss_conf             2222222113444443222221222222221112232211-------------111122332222222221111--2222
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC-------------LACLKLGAKHAINYLKEDFLE--ILQK  208 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~-------------~~~~~lGa~~vi~~~~~~~~~--~i~~  208 (332)
                      +..++++|.| +|.+|+=+.+.++.+|.+|..+.+++.=+             +.+++.|.+-..+..-..+..  ....
T Consensus       135 ~~~k~vvViG-gG~IGlE~A~~l~~~G~~Vtvve~~~~il~~~~d~~~~~~~~~~l~~~Gv~i~~~~~v~~i~~~~~~~~  213 (427)
T TIGR03385       135 NKVDRVVIIG-GGYIGLEMVEALRERGKNVTLIHRSDKILNKLFDEEMNQIVEEELEKHEIELRLNEEVDSIIGEERVGV  213 (427)
T ss_pred             CCCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCEEEECCEEEEEECCCCEEE
T ss_conf             7998899999-639999999999976998999984683365548999999999999975979997988999987887899


Q ss_pred             CCCCC--CCCCCCCCCCC
Q ss_conf             22222--11122221111
Q gi|254780290|r  209 ETQGR--GIDIILDMVGA  224 (332)
Q Consensus       209 ~t~g~--g~Divid~~G~  224 (332)
                      ++.|+  .+|.|+-++|.
T Consensus       214 l~~g~~i~~D~vi~a~G~  231 (427)
T TIGR03385       214 ITSGGVYQADMVILAIGV  231 (427)
T ss_pred             EECCCEEECCEEEECCCC
T ss_conf             946999972899988774


No 439
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]
Probab=72.86  E-value=0.78  Score=24.62  Aligned_cols=87  Identities=24%  Similarity=0.232  Sum_probs=56.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC
Q ss_conf             2222221134444432222212222222211122322111111223322222222211112222222221112222-111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILD-MVG  223 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid-~~G  223 (332)
                      .|.++.|.| .|.+|++..+.++.+|++|+...+++. .+..++.++.+    .+  +.+.+.+      .|++.- |..
T Consensus       145 ~gktvGIiG-~GrIG~avA~r~~~Fgm~v~y~~~~~~-~~~~~~~~~~y----~~--l~ell~~------sDii~l~~Pl  210 (324)
T COG1052         145 RGKTLGIIG-LGRIGQAVARRLKGFGMKVLYYDRSPN-PEAEKELGARY----VD--LDELLAE------SDIISLHCPL  210 (324)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHCCCCEEEEECCCCC-HHHHHHCCCEE----CC--HHHHHHH------CCEEEEECCC
T ss_conf             788889978-488999999987217968998668874-55574058604----16--8999976------9999997799


Q ss_pred             CC----CC-CCCCCCCCCCCCCEEEEE
Q ss_conf             11----12-222211223453047983
Q gi|254780290|r  224 AE----YL-NQHLTLLSKEGKLIIISF  245 (332)
Q Consensus       224 ~~----~~-~~~~~~l~~~G~iv~~G~  245 (332)
                      .+    .+ ...++.|++++.++.+|.
T Consensus       211 t~~T~hLin~~~l~~mk~ga~lVNtaR  237 (324)
T COG1052         211 TPETRHLINAEELAKMKPGAILVNTAR  237 (324)
T ss_pred             CHHHHHHCCHHHHHHCCCCEEEEECCC
T ss_conf             837665329999975689769996487


No 440
>PRK08526 threonine dehydratase; Provisional
Probab=72.74  E-value=1.5  Score=22.76  Aligned_cols=17  Identities=6%  Similarity=-0.036  Sum_probs=9.2

Q ss_pred             EEHHHHHHHHHHHHCCC
Q ss_conf             41899999999998299
Q gi|254780290|r  307 LPLGKVAMAHDIMEKSE  323 (332)
Q Consensus       307 ~~l~~i~~A~~~l~~g~  323 (332)
                      -+.++.++-.+.+++..
T Consensus       380 ~~~~h~~~l~~~l~~~G  396 (403)
T PRK08526        380 KGKEHQEEIRKILTEKG  396 (403)
T ss_pred             CCHHHHHHHHHHHHHCC
T ss_conf             99999999999999879


No 441
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NAD(P)+. This subfamily includes glutamate, leucine, phenylalanine, and valine DHs. Glutamate DH is a multi-domain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms.  Enzymes involved in ammonia assimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent.  As in other NAD+-dependent DHs, monomers in this family have 2 domains separated by a deep cleft. Here the c-terminal domain contains a modified NAD-binding Rossmann fold with 7 rather than the usual 6 beta strands and one strand anti-parral
Probab=72.53  E-value=0.66  Score=25.10  Aligned_cols=35  Identities=20%  Similarity=0.299  Sum_probs=30.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222113444443222221222222221112232
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE  180 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~  180 (332)
                      .|.+|.|+| .|.||..+.+++..+|++|+++..+.
T Consensus        22 ~g~~vaVqG-fGnVG~~~a~~l~~~GakvvavsD~~   56 (217)
T cd05211          22 EGLTVAVQG-LGNVGWGLAKKLAEEGGKVLAVSDPD   56 (217)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             799999989-88999999999998599899998578


No 442
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane]
Probab=72.44  E-value=0.55  Score=25.63  Aligned_cols=13  Identities=23%  Similarity=0.197  Sum_probs=6.2

Q ss_pred             EHHHH-HHHHHHHH
Q ss_conf             18999-99999998
Q gi|254780290|r  308 PLGKV-AMAHDIME  320 (332)
Q Consensus       308 ~l~~i-~~A~~~l~  320 (332)
                      +|+++ ++|++.-+
T Consensus       309 ~L~~ii~~aw~W~~  322 (329)
T COG1087         309 DLEDIIKDAWDWHQ  322 (329)
T ss_pred             CHHHHHHHHHHHHH
T ss_conf             89999998877766


No 443
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; InterPro: IPR012733   4-hydroxybenzoate 3-monooxygenase is a flavoprotein that converts its substrate to 3,4-dihydroxybenzoate, which subsequently enters the beta-ketioadipate pathway of aromatic degradation, using molecular oxygen and NADPH as shown below . 4-hydroxybenzoate + NADPH + O(2) = 3,4-dihydroxybenzoate + NADP(+) + H(2)O 4-hydroxybenzoate is an intermediate in the degradation of lignin and other aromatic plant compounds, and this enzyme is found extensively in soil bacteria.   This enzyme is a homodimer where each subunit is composed of three distinct domains: an N-terminal flavin-binding domain with a beta-alpha-beta fold, a small substrate-binding domain composed of a single alpha helix and beta-sheet, and a C-terminal helical domain . The active site is found at the interface of all three domains. Catalysis occurs by a two-step reaction. In the first step, flavin is reduced by NADPH. Subsequently, the reduced flavin is oxygenated to a hydroperoxide which transfers the hydroxyl group to the substrate, forming 3,4-dihydroxybenzoate.; GO: 0018659 4-hydroxybenzoate 3-monooxygenase activity, 0050660 FAD binding, 0043639 benzoate catabolic process.
Probab=71.67  E-value=0.59  Score=25.44  Aligned_cols=211  Identities=12%  Similarity=0.129  Sum_probs=92.8

Q ss_pred             CCEEEEEEECCCCCCCCEEEEEEEEEEEC--HHHHHHHCCCCCC--CCCCCCEECCCCCCCCCCCCCCC-----CCCCCC
Q ss_conf             53079998237877886289999999827--8789998688778--76687300330002322222212-----222223
Q gi|254780290|r   18 SNVMFLAESPIPQPQKEEILIKVEAIGVN--RPDVMQRKGLYPP--PKNANPILGLEVAGKIVDLGENT-----THWNIG   88 (332)
Q Consensus        18 ~~~l~~~~~~~P~~~~~~vlV~v~~~~in--~~D~~~~~G~~~~--~~~~p~v~G~e~~G~V~~vG~~v-----~~~~~G   88 (332)
                      .|.+.+|..     .++.|+=||.|-=|=  ..|++-..|.-..  ...++    |+  |++++....-     +...-|
T Consensus        26 Id~viLEr~-----~~dYVlgRIRAGvLE~g~v~LL~~agv~~Rm~~eG~~----H~--G~~ia~~g~~~riDl~~~tGG   94 (393)
T TIGR02360        26 IDTVILERK-----SRDYVLGRIRAGVLEQGTVDLLREAGVDERMDREGLV----HE--GIEIAFDGQRFRIDLKALTGG   94 (393)
T ss_pred             CCEEEEECC-----CHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCC----CC--CEEEECCCCEEECCHHHHCCC
T ss_conf             858997235-----7223433210123578999999872232234535873----25--654501782420007660589


Q ss_pred             CCCCCCCC-------------CCCC----CCCCCCCCCCCCCCC--CCCCCCCC---CCCCC---CCCCCCCCCCCCC--
Q ss_conf             33322112-------------2333----332211111112222--22232221---22222---2333222111222--
Q gi|254780290|r   89 DEVCALVN-------------GGGY----AEYCLSHQGHTLPIP--KGYNAIQA---ASLPE---SFFTVWANLFQTA--  141 (332)
Q Consensus        89 drV~~~~~-------------~G~~----ae~~~~~~~~~~~iP--~~~s~~~a---a~l~~---~~~tA~~~l~~~~--  141 (332)
                      ..|+.+..             -|+-    ++.+..+. .----|  -.++++..   ..+-|   +++-.||.+=+..  
T Consensus        95 ~~V~VYGQTEvtrDL~~ARe~~G~~~v~~a~~V~~HD-~~~~~P~gc~VT~~~dG~~~~~dCDfIAGCDGFHGvSR~siP  173 (393)
T TIGR02360        95 KTVMVYGQTEVTRDLYEAREQAGLKTVYDADDVRLHD-LAGDRPEGCHVTFERDGEEHRIDCDFIAGCDGFHGVSRASIP  173 (393)
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCCCC-CCCCCCCCCEEEEEECCCEEEEEEEEEECCCCCCCCCCCCCC
T ss_conf             7899976615778899999863895564114321126-567888952587778791777640267527888686544565


Q ss_pred             --CCCCCCCCC------CCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             --222222222------113444443222221222222221112--23221-1111122332222222221111222222
Q gi|254780290|r  142 --NLRSGQTVL------IHGGSSGIGTTAIQLASYFGATVYTTA--KSEEK-CLACLKLGAKHAINYLKEDFLEILQKET  210 (332)
Q Consensus       142 --~~~~g~~vl------V~ga~g~vG~~a~qla~~~G~~vi~~~--~~~~~-~~~~~~lGa~~vi~~~~~~~~~~i~~~t  210 (332)
                        .++.=|+|-      |.+-+-+|-.=.|.--+.+|   ||.|  ||+.+ +-.++--=-|++=|=+|+.|=++++...
T Consensus       174 ~~~~k~fErVYPFGWLGiLsetPPv~~ELIY~~h~RG---FALCSmRS~~rSRYY~Q~pL~D~vedWSDd~FW~ELK~Rl  250 (393)
T TIGR02360       174 AEVLKEFERVYPFGWLGILSETPPVSHELIYSNHERG---FALCSMRSETRSRYYVQVPLTDKVEDWSDDRFWEELKRRL  250 (393)
T ss_pred             HHHHHCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCC---HHHHHHCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHCC
T ss_conf             1241112450676200120578688644410367630---2455320365673588714568877887077899986137


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCC-------CCCCCEEEEEC
Q ss_conf             2221112222111111222221122-------34530479833
Q gi|254780290|r  211 QGRGIDIILDMVGAEYLNQHLTLLS-------KEGKLIIISFL  246 (332)
Q Consensus       211 ~g~g~Divid~~G~~~~~~~~~~l~-------~~G~iv~~G~~  246 (332)
                      ..+-++-.+   -++.+|+++.=|+       ..||+-.+|-.
T Consensus       251 p~e~A~~Lv---TGPSiEKSIAPLRSFV~EPM~yGrLFLaGDA  290 (393)
T TIGR02360       251 PEEAAERLV---TGPSIEKSIAPLRSFVAEPMRYGRLFLAGDA  290 (393)
T ss_pred             CHHHHHHCC---CCCCCHHHCCCCCCCCCCCCCCCCHHHHCCC
T ss_conf             866875405---6764122116787743386524651110464


No 444
>KOG2733 consensus
Probab=71.55  E-value=0.45  Score=26.20  Aligned_cols=10  Identities=20%  Similarity=0.275  Sum_probs=4.3

Q ss_pred             CCCCCCCCCC
Q ss_conf             3322222222
Q gi|254780290|r  190 GAKHAINYLK  199 (332)
Q Consensus       190 Ga~~vi~~~~  199 (332)
                      |+|..+-.++
T Consensus       243 gaD~SVV~RS  252 (423)
T KOG2733         243 GADKSVVRRS  252 (423)
T ss_pred             CCCHHHEEHH
T ss_conf             8863421057


No 445
>PRK13512 coenzyme A disulfide reductase; Provisional
Probab=71.51  E-value=1.1  Score=23.69  Aligned_cols=80  Identities=15%  Similarity=0.052  Sum_probs=44.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------------CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222113444443222221222222221112232211------------1111223322222222211112222222
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC------------LACLKLGAKHAINYLKEDFLEILQKETQ  211 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~------------~~~~~lGa~~vi~~~~~~~~~~i~~~t~  211 (332)
                      ...++++|.| +|-+|+=+...++.+|.+|..+.+++.=.            +.+++.|.+..++..-..+...-..+..
T Consensus       146 ~~~k~vvIIG-gG~IGlE~A~~l~~~G~~Vtlie~~~~~~~~~d~~~~~~~~~~l~~~gv~~~~~~~v~~i~~~~v~~~~  224 (438)
T PRK13512        146 NQVDKVLVVG-AGYVSLEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPYRLNEEIDAINGNEITFKS  224 (438)
T ss_pred             CCCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEECCEEEEEECCEEEEEE
T ss_conf             7997799989-558999999999972990899993573120049999999999998689999958779999797999932


Q ss_pred             C--CCCCCCCCCCCC
Q ss_conf             2--211122221111
Q gi|254780290|r  212 G--RGIDIILDMVGA  224 (332)
Q Consensus       212 g--~g~Divid~~G~  224 (332)
                      |  ..+|+|+-++|.
T Consensus       225 g~~~~~D~vi~a~G~  239 (438)
T PRK13512        225 GKVEHYDMIIEGVGT  239 (438)
T ss_pred             CCEEEECEEEEEEEC
T ss_conf             889740789996710


No 446
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional
Probab=71.29  E-value=0.49  Score=25.98  Aligned_cols=36  Identities=17%  Similarity=0.300  Sum_probs=26.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC
Q ss_conf             222222221134444432222212222222-2111223
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKS  179 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~  179 (332)
                      +..|++|+|+| +|.++.=++.-|+.+|++ |..+.+.
T Consensus       575 ~~~Gk~VvVIG-GGntAmD~artA~RlGAe~V~ivyRR  611 (760)
T PRK12778        575 VAFGKNVAVIG-GGNTAMDSVRTAKRLGAERAMIIYRR  611 (760)
T ss_pred             CCCCCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             22698899999-97609999999998399869997037


No 447
>pfam02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase. This is a family of 1-deoxy-D-xylulose 5-phosphate reductoisomerases. This enzyme catalyses the formation of 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose-5-phosphate in the presence of NADPH. This reaction is part of the terpenoid biosynthesis pathway.
Probab=71.22  E-value=0.31  Score=27.32  Aligned_cols=89  Identities=17%  Similarity=0.097  Sum_probs=47.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCC--C-CCCCCCCCCCCCCCCCCCCC---C----------------C
Q ss_conf             221134444432222212222--222211122322--1-11111223322222222211---1----------------1
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYF--GATVYTTAKSEE--K-CLACLKLGAKHAINYLKEDF---L----------------E  204 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~--G~~vi~~~~~~~--~-~~~~~~lGa~~vi~~~~~~~---~----------------~  204 (332)
                      |.|.|++|.+|.-++++.+..  ..+|++.+.+.+  + .+.++++....++-...+.+   .                +
T Consensus         1 I~IlGsTGSIG~~tL~Vi~~~~~~f~v~~Lsa~~N~~~L~~q~~~f~p~~v~i~~~~~~~~l~~~~~~~~~~~~i~~g~~   80 (129)
T pfam02670         1 ITILGSTGSIGTQTLDVIRRNPDRFEVVALSAGRNVELLAEQIKEFKPKYVAVADEEAAEELKEALAGAGLKTEVLAGEE   80 (129)
T ss_pred             CEEECCCCHHHHHHHHHHHHCCCCEEEEEEEECCCHHHHHHHHHHCCCCEEEECCHHHHHHHHHHCCCCCCCCEEEECHH
T ss_conf             98976786889999999995956718999983478999999999739979999589999999986324788737987889


Q ss_pred             CCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC
Q ss_conf             2222222221112222111-11122222112234
Q gi|254780290|r  205 ILQKETQGRGIDIILDMVG-AEYLNQHLTLLSKE  237 (332)
Q Consensus       205 ~i~~~t~g~g~Divid~~G-~~~~~~~~~~l~~~  237 (332)
                      .+.++.....+|+++..+. -.-++..+.+++.+
T Consensus        81 ~l~~~~~~~~~D~vi~AIsG~aGL~pt~~ai~~g  114 (129)
T pfam02670        81 GLCELAALPEADIVVNAIVGAAGLLPTLAAIKAG  114 (129)
T ss_pred             HHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHCC
T ss_conf             9999970778899998156501399999999869


No 448
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of  a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1).
Probab=71.04  E-value=0.64  Score=25.19  Aligned_cols=31  Identities=23%  Similarity=0.387  Sum_probs=23.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC
Q ss_conf             22222113444443222221222222-221112
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTA  177 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~  177 (332)
                      ..+|+|.| +||+|..+++++...|. ++..++
T Consensus        21 ~s~VlivG-~GGlGs~~~~~La~~Gvg~i~lvD   52 (228)
T cd00757          21 NARVLVVG-AGGLGSPAAEYLAAAGVGKLGLVD   52 (228)
T ss_pred             CCCEEEEC-CCHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             49789988-778899999999983997589997


No 449
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional
Probab=70.97  E-value=0.63  Score=25.24  Aligned_cols=16  Identities=19%  Similarity=0.683  Sum_probs=9.5

Q ss_pred             CCCCCEEEEEECCCCC
Q ss_conf             8776208999915688
Q gi|254780290|r    2 PICKKMRHVAMSGYGK   17 (332)
Q Consensus         2 ~~~~~Mka~v~~~~g~   17 (332)
                      |+|++||.+-+=+.|+
T Consensus         3 ~~~~~~k~ih~iGigG   18 (459)
T PRK00421          3 PLPRRIKRIHFVGIGG   18 (459)
T ss_pred             CCCCCCCEEEEEEECH
T ss_conf             8765678899998668


No 450
>COG1619 LdcA Uncharacterized proteins, homologs of microcin C7 resistance protein MccF [Defense mechanisms]
Probab=70.71  E-value=1.6  Score=22.54  Aligned_cols=14  Identities=14%  Similarity=0.109  Sum_probs=6.1

Q ss_pred             CCCCCEEEEEEEEEE
Q ss_conf             778862899999998
Q gi|254780290|r   30 QPQKEEILIKVEAIG   44 (332)
Q Consensus        30 ~~~~~~vlV~v~~~~   44 (332)
                      .++.++ +|++.+.+
T Consensus         6 ~lk~gd-~I~iIaPS   19 (313)
T COG1619           6 KLKEGD-EIGIIAPS   19 (313)
T ss_pred             CCCCCC-EEEEEECC
T ss_conf             368898-79998068


No 451
>PRK13255 thiopurine S-methyltransferase; Reviewed
Probab=70.59  E-value=2  Score=21.96  Aligned_cols=101  Identities=17%  Similarity=0.183  Sum_probs=53.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCC-------CCCCCCC---CCCCCCC
Q ss_conf             22222222221134444432222212222222211122322111-11122332222-------2222211---1122222
Q gi|254780290|r  141 ANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL-ACLKLGAKHAI-------NYLKEDF---LEILQKE  209 (332)
Q Consensus       141 ~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~-~~~~lGa~~vi-------~~~~~~~---~~~i~~~  209 (332)
                      ..+.++.+|||-+ ||- + .-+.++...|.+|+++.-++.-++ +-.+.+....+       .|+..++   ...+-++
T Consensus        33 L~~~~~~rVlVPl-CGK-s-~Dm~wLa~~G~~VvGvEls~~Av~~ff~e~~l~~~~~~~~~~~~y~~~~i~i~~gDfF~L  109 (218)
T PRK13255         33 LALPAGSRVLVPL-CGK-S-LDMLWLAEQGHEVLGVELSELAVEQFFAENGLTPQVRQSGEFEHYQAGEISLYCGDFFAL  109 (218)
T ss_pred             CCCCCCCEEEEEC-CCC-H-HHHHHHHHCCCEEEEEECHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCEEEEECCCCCC
T ss_conf             0878898699948-986-7-769999848972699835299999999973898630136760377538827996642027


Q ss_pred             CCC--CCCCCCCCCCC---------CCCCCCCCCCCCCCCCCEEEE
Q ss_conf             222--21112222111---------111222221122345304798
Q gi|254780290|r  210 TQG--RGIDIILDMVG---------AEYLNQHLTLLSKEGKLIIIS  244 (332)
Q Consensus       210 t~g--~g~Divid~~G---------~~~~~~~~~~l~~~G~iv~~G  244 (332)
                      +..  ..+|.|+|-..         ..+.+...++++++|++..+.
T Consensus       110 ~~~~~g~~DaIyDRaal~ALpp~~R~~Y~~~l~~ll~~g~~~LLit  155 (218)
T PRK13255        110 TAADLADVDAVYDRAALIALPEEMRERYVQQLAALLPAGCRGLLVT  155 (218)
T ss_pred             CHHHCCCCCEEEECCCEECCCHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             8635477488997538012898999999999998649987489999


No 452
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913    dTDP-4-dehydrorhamnose reductase (1.1.1.133 from EC) catalyzes the last of 4 steps in making dTDP-rhamnose, a precursor of LPS molecules such as core antigen and O-antigen.  dTDP-6-deoxy-L-mannose + NADP+ = dTDP-4-dehydro-6-deoxy-L-mannose + NADPH  ; GO: 0008831 dTDP-4-dehydrorhamnose reductase activity, 0045226 extracellular polysaccharide biosynthetic process.
Probab=70.45  E-value=0.75  Score=24.76  Aligned_cols=32  Identities=28%  Similarity=0.400  Sum_probs=17.2

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22211344444322222122222222111223
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKS  179 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~  179 (332)
                      +|||+||.|-+|.-..+-+-..|..+.++.++
T Consensus         1 rilitGa~GQlG~~L~~~l~~~g~~~~~~~~~   32 (317)
T TIGR01214         1 RILITGANGQLGRELVQQLSKPGRVVVALTRS   32 (317)
T ss_pred             CEEEECCCCHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             97887387567999999707888278643687


No 453
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional
Probab=70.42  E-value=0.72  Score=24.88  Aligned_cols=12  Identities=8%  Similarity=0.080  Sum_probs=4.6

Q ss_pred             EHHH-HHHHHHHH
Q ss_conf             1899-99999999
Q gi|254780290|r  308 PLGK-VAMAHDIM  319 (332)
Q Consensus       308 ~l~~-i~~A~~~l  319 (332)
                      +|+| +++.++.+
T Consensus       294 sleeGl~~tv~W~  306 (308)
T PRK11150        294 TVAEGVTEYMAWL  306 (308)
T ss_pred             CHHHHHHHHHHHH
T ss_conf             9999999999996


No 454
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed
Probab=70.37  E-value=0.84  Score=24.43  Aligned_cols=29  Identities=17%  Similarity=0.277  Sum_probs=16.7

Q ss_pred             CCCCCCCCCCCCC-CCCCCCCCCCCCCCCCE
Q ss_conf             2211122221111-11222221122345304
Q gi|254780290|r  212 GRGIDIILDMVGA-EYLNQHLTLLSKEGKLI  241 (332)
Q Consensus       212 g~g~Divid~~G~-~~~~~~~~~l~~~G~iv  241 (332)
                      +..+|.|+-| |. ..+....+.++..|.-+
T Consensus       178 ~~~~d~v~~C-GP~~Mmk~v~~~~~~~~v~~  207 (281)
T PRK06222        178 GEKVDRVFAI-GPVIMMKAVAELTKPYGIKT  207 (281)
T ss_pred             CCCCCEEEEE-CCHHHHHHHHHHHHHCCCCE
T ss_conf             6775389998-99999999999998769979


No 455
>PRK13228 consensus
Probab=70.36  E-value=0.71  Score=24.88  Aligned_cols=13  Identities=23%  Similarity=0.176  Sum_probs=8.0

Q ss_pred             CCCEEEEEECCCC
Q ss_conf             7620899991568
Q gi|254780290|r    4 CKKMRHVAMSGYG   16 (332)
Q Consensus         4 ~~~Mka~v~~~~g   16 (332)
                      |-+|||+.|.--|
T Consensus         5 pM~iKaViFDlDG   17 (232)
T PRK13228          5 PLPIKAVAIDLDG   17 (232)
T ss_pred             CCCCCEEEECCCC
T ss_conf             9998789999978


No 456
>pfam02719 Polysacc_synt_2 Polysaccharide biosynthesis protein. This is a family of diverse bacterial polysaccharide biosynthesis proteins including the CapD protein, WalL protein mannosyl-transferase and several putative epimerases (e.g. WbiI).
Probab=70.27  E-value=0.54  Score=25.68  Aligned_cols=31  Identities=23%  Similarity=0.433  Sum_probs=19.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCC
Q ss_conf             221134444432222212222222-2111223
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGAT-VYTTAKS  179 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~-vi~~~~~  179 (332)
                      |||+||+|-+|.-.+.-+...|.+ |+..+.+
T Consensus         1 ILVTGGaGFIGS~Lv~~Ll~~g~~~v~v~d~~   32 (280)
T pfam02719         1 VLVTGGGGSIGSELCRQILKFNPKKIILFSRD   32 (280)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             79974886799999999996899889999088


No 457
>PRK07190 hypothetical protein; Provisional
Probab=70.24  E-value=0.92  Score=24.17  Aligned_cols=13  Identities=15%  Similarity=0.018  Sum_probs=6.5

Q ss_pred             EEEEECHHHHHHH
Q ss_conf             9998278789998
Q gi|254780290|r   41 EAIGVNRPDVMQR   53 (332)
Q Consensus        41 ~~~~in~~D~~~~   53 (332)
                      .+.++++.-+.+.
T Consensus        45 RA~~l~~rtleil   57 (480)
T PRK07190         45 RADALNARTLQLL   57 (480)
T ss_pred             CEEEECHHHHHHH
T ss_conf             6757568999999


No 458
>PRK06436 glycerate dehydrogenase; Provisional
Probab=69.35  E-value=0.98  Score=23.98  Aligned_cols=36  Identities=31%  Similarity=0.453  Sum_probs=30.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122322
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE  181 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~  181 (332)
                      .|.++.|.| .|.+|....++++.+|++|++..++..
T Consensus       121 ~gktvGIiG-~G~IG~~vA~~~~afg~~V~~~~r~~~  156 (303)
T PRK06436        121 YNKSLGILG-YGGIGRRVALLAKAFGMNIYAYTRSYV  156 (303)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             188899989-765699999999977988999898532


No 459
>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase. The NAD binding domain of 6-phosphogluconate dehydrogenase adopts a Rossmann fold.
Probab=69.21  E-value=0.6  Score=25.40  Aligned_cols=87  Identities=21%  Similarity=0.142  Sum_probs=50.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CC
Q ss_conf             22211344444322222122222222111223221111112233222222222111122222222211122221111-11
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA-EY  226 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~-~~  226 (332)
                      +|-+.| .|.+|.....-+...|.+|++..+++++.+.+.+.|+..+ +    ++    .+..  +..|+||-|+.. +.
T Consensus         3 ~Ig~IG-lG~MG~~ma~~L~~~g~~v~v~d~~~~~~~~~~~~g~~~~-~----s~----~e~~--~~~dvIi~~l~~~~~   70 (163)
T pfam03446         3 KIGFIG-LGVMGSPMALNLLKAGYTVTVYNRTPEKVEELVAEGAVAA-A----SP----AEAA--ASADVVITMVPAGAA   70 (163)
T ss_pred             EEEEEE-EHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEC-C----CH----HHHH--HCCCEEEEECCCHHH
T ss_conf             899983-6798999999999779969999797887799998399553-9----99----9998--619999992587145


Q ss_pred             CCC-------CCCCCCCCCCCEEEEEC
Q ss_conf             222-------22112234530479833
Q gi|254780290|r  227 LNQ-------HLTLLSKEGKLIIISFL  246 (332)
Q Consensus       227 ~~~-------~~~~l~~~G~iv~~G~~  246 (332)
                      .+.       .+..++++-.++.++..
T Consensus        71 v~~V~~~~~gl~~~~~~g~iiid~sT~   97 (163)
T pfam03446        71 VDAVIFGEDGLLPGLKPGDIIIDGSTI   97 (163)
T ss_pred             HHEEECCCCCHHHHCCCCCEEEECCCC
T ss_conf             402202631332313589889867989


No 460
>pfam00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase.
Probab=69.02  E-value=0.88  Score=24.28  Aligned_cols=33  Identities=27%  Similarity=0.425  Sum_probs=29.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222221134444432222212222222211122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK  178 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~  178 (332)
                      .|.+|.|.| .|.||..+++++...|++|+++..
T Consensus        31 ~g~~v~IqG-fGnVG~~~a~~l~~~GakvvavsD   63 (237)
T pfam00208        31 EGKTVAVQG-FGNVGSYAAEKLLELGAKVVAVSD   63 (237)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             899999989-889999999999987996999982


No 461
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism]
Probab=69.01  E-value=0.5  Score=25.91  Aligned_cols=11  Identities=18%  Similarity=0.516  Sum_probs=4.3

Q ss_pred             EEEE-EECCCCC
Q ss_conf             0899-9915688
Q gi|254780290|r    7 MRHV-AMSGYGK   17 (332)
Q Consensus         7 Mka~-v~~~~g~   17 (332)
                      ||.+ ++-..|+
T Consensus         1 ~k~i~iLGSTGS   12 (385)
T COG0743           1 MKKLTILGSTGS   12 (385)
T ss_pred             CCEEEEEECCCC
T ss_conf             945999716873


No 462
>PRK12483 threonine dehydratase; Reviewed
Probab=68.98  E-value=1.9  Score=22.00  Aligned_cols=101  Identities=5%  Similarity=-0.033  Sum_probs=54.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCC----------
Q ss_conf             221222222333322112233333221111111222222232221222222333222111222----222----------
Q gi|254780290|r   79 GENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTA----NLR----------  144 (332)
Q Consensus        79 G~~v~~~~~GdrV~~~~~~G~~ae~~~~~~~~~~~iP~~~s~~~aa~l~~~~~tA~~~l~~~~----~~~----------  144 (332)
                      +.-.+.++|.-+|+|.-+.|+-+=+....+...+.+|.-=.+.+.++....+--.+..+.+..    -+.          
T Consensus       204 a~~~K~~~P~ikVIGVEpe~a~~m~~Sl~aG~~v~L~~v~tfaDG~AV~~vG~~tF~i~k~~VDdvv~Vs~deIcaAIkd  283 (521)
T PRK12483        204 AAYVKYLRPEIKVIGVEPDDSNCLQAALAAGERVVLGQVGLFADGVAVAQIGEHTFELCRHYVDEVVTVSTDELCAAIKD  283 (521)
T ss_pred             HHHHHHHCCCCEEEEEEECCCHHHHHHHHHCCEEECCCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHH
T ss_conf             99998619997089999678768999998398367688885267645577898899999861995799891799999999


Q ss_pred             --CCCCCCCCCCCCCCCCCCCC-CCC---CCCCCCCCCCCCC
Q ss_conf             --22222211344444322222-122---2222221112232
Q gi|254780290|r  145 --SGQTVLIHGGSSGIGTTAIQ-LAS---YFGATVYTTAKSE  180 (332)
Q Consensus       145 --~g~~vlV~ga~g~vG~~a~q-la~---~~G~~vi~~~~~~  180 (332)
                        ...++++ =.+|++++++++ ++.   ..|-+++++.+..
T Consensus       284 ife~tr~I~-EPAGAlalAglk~y~~~~~~~gk~~v~i~sGa  324 (521)
T PRK12483        284 IYDDTRSIT-EPAGALAVAGIKKYVEREGIEGQTLVAIDSGA  324 (521)
T ss_pred             HHHHCCEEE-CCCHHHHHHHHHHHHHHCCCCCCCEEEEECCC
T ss_conf             998266663-47056679999999985488767379995046


No 463
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated
Probab=68.73  E-value=0.56  Score=25.58  Aligned_cols=11  Identities=18%  Similarity=0.160  Sum_probs=4.5

Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999998
Q gi|254780290|r  310 GKVAMAHDIME  320 (332)
Q Consensus       310 ~~i~~A~~~l~  320 (332)
                      +++.+|.+..+
T Consensus       374 ~~~~~a~~~a~  384 (395)
T PRK09288        374 EDVEEAREKAK  384 (395)
T ss_pred             CCHHHHHHHHH
T ss_conf             99999999999


No 464
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=68.67  E-value=0.69  Score=24.97  Aligned_cols=21  Identities=19%  Similarity=0.256  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHCCCCCCEEEE
Q ss_conf             999999999982998132898
Q gi|254780290|r  310 GKVAMAHDIMEKSEHIGKIIL  330 (332)
Q Consensus       310 ~~i~~A~~~l~~g~~~GKvVi  330 (332)
                      +++++|.+...+-...|-+|+
T Consensus       366 ~~l~eAv~~a~~~a~~gd~VL  386 (418)
T PRK00683        366 KDLQEAVSCAQEIAQPGDVIL  386 (418)
T ss_pred             CCHHHHHHHHHHHCCCCCEEE
T ss_conf             989999999998478989899


No 465
>PRK12831 putative oxidoreductase; Provisional
Probab=68.45  E-value=1  Score=23.86  Aligned_cols=37  Identities=22%  Similarity=0.354  Sum_probs=26.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222113444443222221222222221112232
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE  180 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~  180 (332)
                      +..|++|+|+| .|.++.-++..|+.+|++|+.+.+..
T Consensus       278 ~~~Gk~VvVIG-GGntA~D~arta~R~GaeV~ivyrr~  314 (464)
T PRK12831        278 IKVGKKVAVVG-GGNVAMDAARTALRLGAEVHIVYRRS  314 (464)
T ss_pred             CCCCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             22587789988-85568999998874297799970457


No 466
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated
Probab=68.03  E-value=0.71  Score=24.91  Aligned_cols=31  Identities=23%  Similarity=0.354  Sum_probs=23.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCC
Q ss_conf             22222113444443222221222222-221112
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTA  177 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~  177 (332)
                      ..+|||.| +||+|..+++++...|. ++..++
T Consensus       138 ~a~VlivG-~GGLGs~~a~yLA~aGVG~i~lvD  169 (379)
T PRK08762        138 RARVLLIG-AGGLGSPAAFYLAAAGVGHLRIAD  169 (379)
T ss_pred             HCCEEEEC-CCHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             39789988-875579999999983797589762


No 467
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional
Probab=67.94  E-value=0.74  Score=24.80  Aligned_cols=71  Identities=15%  Similarity=0.218  Sum_probs=50.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222113444443222221222222221112232211111122332222-2222211112222222221112222111
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI-NYLKEDFLEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi-~~~~~~~~~~i~~~t~g~g~Divid~~G  223 (332)
                      .|+|.| -|-+|+...++++..|.++++++.++++.+.+++.|....+ |.++.+    +.+..+-+.+.+++-++.
T Consensus       401 ~VII~G-~GRvGq~var~L~~~gi~~vviD~d~~~V~~~r~~G~~v~yGDat~~~----vL~~AGi~~Ar~vViaid  472 (615)
T PRK03562        401 RVIIAG-FGRFGQIVGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMD----LLESAGAAKAEVLINAID  472 (615)
T ss_pred             CEEEEE-CCCCHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEEEECCCCHH----HHHHCCCCCCCEEEEEEC
T ss_conf             989990-280469999999978998799979999999999679908976899999----998679140688999949


No 468
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism]
Probab=67.66  E-value=1.1  Score=23.52  Aligned_cols=91  Identities=19%  Similarity=0.257  Sum_probs=56.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222222113444443222221222222221112232211111122332222222221111222222222111222211
Q gi|254780290|r  143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMV  222 (332)
Q Consensus       143 ~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~  222 (332)
                      +-+|++++|.| =|-+|-=..+-++.+||+|++|.-.|-+.-.+.--|++. ..          ++..... .|+++.++
T Consensus       206 liaGK~vVV~G-YG~vGrG~A~~~rg~GA~ViVtEvDPI~AleA~MdGf~V-~~----------m~~Aa~~-gDifiT~T  272 (420)
T COG0499         206 LLAGKNVVVAG-YGWVGRGIAMRLRGMGARVIVTEVDPIRALEAAMDGFRV-MT----------MEEAAKT-GDIFVTAT  272 (420)
T ss_pred             EECCCEEEEEC-CCCCCHHHHHHHHCCCCEEEEEECCCHHHHHHHHCCCEE-EE----------HHHHHHC-CCEEEECC
T ss_conf             11486699963-564436699986228986999824817889986357188-78----------6674421-89899866


Q ss_pred             CC-CCC-CCCCCCCCCCCCCEEEEEC
Q ss_conf             11-112-2222112234530479833
Q gi|254780290|r  223 GA-EYL-NQHLTLLSKEGKLIIISFL  246 (332)
Q Consensus       223 G~-~~~-~~~~~~l~~~G~iv~~G~~  246 (332)
                      |. +.+ ...+..++.+..++..|..
T Consensus       273 GnkdVi~~eh~~~MkDgaIl~N~GHF  298 (420)
T COG0499         273 GNKDVIRKEHFEKMKDGAILANAGHF  298 (420)
T ss_pred             CCCCCCCHHHHHHCCCCEEEECCCCC
T ss_conf             88575789999726488499626564


No 469
>TIGR00036 dapB dihydrodipicolinate reductase; InterPro: IPR011770   Dihydrodipicolinate reductase is an enzyme found in bacteria and higher plants which is involved in the biosynthesis of diaminopimelic acid, a component of bacterial cell walls, and the essential amino acid L-lysine. It catalyses the the reduced pyridine nucleotide-dependent reduction of the alpha,beta-unsaturated cyclic imine, dihydrodipicolinate, to generate tetrahydrodipicolinate as shown below : 2,3-dihydrodipicolinate + NAD(P)H = 2,3,4,5-tetrahydrodipicolinate + NAD(P)(+) As this enzyme is not found in mammals it is a potential target for the development of novel antibacterial and herbicidal compounds.   The structures of the Escherichia coli (P04036 from SWISSPROT) and Mycobacterium tuberculosis (P72024 from SWISSPROT) enzymes have been determined , . The enzyme is a homotetramer where each monomer is composed of two domains, an N-terminal NAD(P)H-binding domain which forms a Rossman fold, and a C-terminal substrate-binding domain that forms an open, mixed alpha-beta sandwich.Tetramerisation occurs exclusively through interactions between C-terminal domain residues. Both enzymes show relatively little preference for either NADH or NADPH as cofactor. Conformational changes upon substrate binding bring the cofactor and substrate into close proximity and allow catalysis to occur. ; GO: 0008839 dihydrodipicolinate reductase activity, 0009089 lysine biosynthetic process via diaminopimelate, 0005737 cytoplasm.
Probab=67.48  E-value=0.69  Score=24.97  Aligned_cols=112  Identities=13%  Similarity=0.197  Sum_probs=64.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCC--CCCCCC-CCCC-CCCCC-CC---CCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222113444443222221222--222221-1122-32211-11---112233222-222222111122222222211122
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASY--FGATVY-TTAK-SEEKC-LA---CLKLGAKHA-INYLKEDFLEILQKETQGRGIDII  218 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~--~G~~vi-~~~~-~~~~~-~~---~~~lGa~~v-i~~~~~~~~~~i~~~t~g~g~Div  218 (332)
                      +|.|.||+|-+|..++|-+..  -|.+++ |+++ +.+++ +-   +-..|--.+ +.   .++.......+....+|+.
T Consensus         3 kvav~GA~GRMG~~~ik~~~~~ye~l~Lv~A~~~~~~~~~G~D~GEl~g~g~~gv~v~---~~~~~~~~l~~~~~~~DVl   79 (281)
T TIGR00036         3 KVAVAGAAGRMGRELIKAVLQAYEGLKLVAAFERHGSSLQGTDIGELAGIGKVGVPVT---DDLEAVLVLAFTETKPDVL   79 (281)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCCEEEECCCCCCCCHH---HHHHHHHHHHHHCCCCCEE
T ss_conf             3588478873469999999974898167888861688856654202422554784100---0578899987402368647


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCC
Q ss_conf             22111111222221122345304798337875432224334305
Q gi|254780290|r  219 LDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISK  262 (332)
Q Consensus       219 id~~G~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~  262 (332)
                      +|.+-.+.....++.+...|.-..+|.++-+....-.+.++..+
T Consensus        80 iDFT~p~g~~~~~~~a~~~Gv~~V~GTTGf~e~~~~~~~~~a~~  123 (281)
T TIGR00036        80 IDFTTPEGVVENVKIALENGVRLVVGTTGFSEEDLQELRDLAEK  123 (281)
T ss_pred             EECCCCHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             87386056789999999668855771668998999999999986


No 470
>PRK06847 hypothetical protein; Provisional
Probab=67.44  E-value=1  Score=23.80  Aligned_cols=11  Identities=27%  Similarity=0.528  Sum_probs=6.5

Q ss_pred             CEEEEEECCCC
Q ss_conf             20899991568
Q gi|254780290|r    6 KMRHVAMSGYG   16 (332)
Q Consensus         6 ~Mka~v~~~~g   16 (332)
                      +||.|++-+.|
T Consensus         3 ~~kkV~IVGaG   13 (375)
T PRK06847          3 AVKKVLIVGGG   13 (375)
T ss_pred             CCCEEEEECCC
T ss_conf             99879999966


No 471
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]
Probab=67.17  E-value=0.46  Score=26.14  Aligned_cols=60  Identities=25%  Similarity=0.294  Sum_probs=41.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222222222113444443222221222-222-221112232211111122332222222
Q gi|254780290|r  139 QTANLRSGQTVLIHGGSSGIGTTAIQLASY-FGA-TVYTTAKSEEKCLACLKLGAKHAINYL  198 (332)
Q Consensus       139 ~~~~~~~g~~vlV~ga~g~vG~~a~qla~~-~G~-~vi~~~~~~~~~~~~~~lGa~~vi~~~  198 (332)
                      +.+++..-+.+.+.-+..-+-+.++++|+. +|. ++++.++++.+.+.++.+|++++++..
T Consensus        60 ~~agi~~aD~vva~t~~d~~N~i~~~la~~~~gv~~viar~~~~~~~~~~~~~g~~~ii~Pe  121 (225)
T COG0569          60 EEAGIDDADAVVAATGNDEVNSVLALLALKEFGVPRVIARARNPEHEKVLEKLGADVIISPE  121 (225)
T ss_pred             HHCCCCCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHCCCCEEECHH
T ss_conf             86798638999998088679999999999873998499995694167789867994897558


No 472
>TIGR02371 ala_DH_arch alanine dehydrogenase; InterPro: IPR012742   This enzyme, a homologue of bacterial ornithine cyclodeaminases and marsupial mu-crystallins, is a homodimeric NAD-dependent alanine dehydrogenase found in Archaeoglobus fulgidus and several other archaea..
Probab=67.14  E-value=2.1  Score=21.84  Aligned_cols=90  Identities=14%  Similarity=0.072  Sum_probs=47.2

Q ss_pred             CCCCCCCCCC-CCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHHHHHHHH
Q ss_conf             1112222111-111222221122345304798337875432224334305321677751240001137899999999999
Q gi|254780290|r  214 GIDIILDMVG-AEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWP  292 (332)
Q Consensus       214 g~Divid~~G-~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~  292 (332)
                      ++|+++-++- .... .-.+.+++|-|++-+|-=...+ .++++  .+.++.++.--                   .+.+
T Consensus       194 ~cDilVTtTPsRkPv-VkA~WV~eGTHInAiGADapGK-qELDp--eiLk~aki~vD-------------------dleQ  250 (327)
T TIGR02371       194 DCDILVTTTPSRKPV-VKADWVEEGTHINAIGADAPGK-QELDP--EILKKAKIVVD-------------------DLEQ  250 (327)
T ss_pred             CCCEEEEECCCCCCE-EEEECCCCCCCEEEECCCCCCC-CCCCH--HHHHCCCEEEE-------------------CHHH
T ss_conf             786799856898960-7542259888255105788883-10036--87632706885-------------------1332


Q ss_pred             HHHCCCCCCCCE-EEEEHHHHHHHHHHHHCCCCCC
Q ss_conf             998698310212-4741899999999998299813
Q gi|254780290|r  293 LLNSHVIAPVIH-TVLPLGKVAMAHDIMEKSEHIG  326 (332)
Q Consensus       293 ~i~~g~l~p~i~-~~~~l~~i~~A~~~l~~g~~~G  326 (332)
                      ...+|.++..++ +..+.+|+.-.+=....|+.-|
T Consensus       251 A~HsGEiNVp~skg~i~v~D~~a~lGeVi~Glk~G  285 (327)
T TIGR02371       251 AKHSGEINVPISKGVIRVDDVHASLGEVIVGLKEG  285 (327)
T ss_pred             CCCCCEEEECCCCCEEEEECCCCCCCCEEEECCCC
T ss_conf             00176471021377233211012104378624789


No 473
>PRK13886 conjugal transfer protein TraL; Provisional
Probab=66.92  E-value=0.82  Score=24.49  Aligned_cols=91  Identities=19%  Similarity=0.209  Sum_probs=45.6

Q ss_pred             CCCCCCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCC--CCCCC--CCCCCCCCCCCCCCCCCCC
Q ss_conf             21134444432-----22221222222221112232211111--12233222--22222--2111122222222211122
Q gi|254780290|r  150 LIHGGSSGIGT-----TAIQLASYFGATVYTTAKSEEKCLAC--LKLGAKHA--INYLK--EDFLEILQKETQGRGIDII  218 (332)
Q Consensus       150 lV~ga~g~vG~-----~a~qla~~~G~~vi~~~~~~~~~~~~--~~lGa~~v--i~~~~--~~~~~~i~~~t~g~g~Div  218 (332)
                      +|.++-||||-     +.+|+....+..+.+++..|.+..++  +.+.+..+  ++-++  +.--+.+.+..-...-|+|
T Consensus         6 ~vlqgKGGVGKS~va~~LaQY~~~~~~~~~~iDTDpvN~tf~~ykal~v~~i~I~e~~~i~~r~FD~l~E~i~~~~~~~V   85 (241)
T PRK13886          6 MVLQGKGGVGKSMIAATIAQYKAGKGQKPLCIDTDPVNATFEGYKALNVRRLNIMDGDEINTRNFDALVEMIASTEGDVI   85 (241)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCEE
T ss_conf             98558886309999999999998359998556089997053421436755777523886566666899999856899889


Q ss_pred             CCCCCCCC------C--CCCCCCCCCCCCC
Q ss_conf             22111111------2--2222112234530
Q gi|254780290|r  219 LDMVGAEY------L--NQHLTLLSKEGKL  240 (332)
Q Consensus       219 id~~G~~~------~--~~~~~~l~~~G~i  240 (332)
                      +|.-....      +  +..+.++...|+=
T Consensus        86 ID~GAstfvPL~~Yl~eN~v~~ll~e~G~~  115 (241)
T PRK13886         86 IDNGASSFVPLSHYLISNQVPALLQDMGHE  115 (241)
T ss_pred             EECCHHHHHHHHHHHHHCCHHHHHHHCCCE
T ss_conf             988517677899999878869999977973


No 474
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]
Probab=66.80  E-value=2.7  Score=21.11  Aligned_cols=91  Identities=15%  Similarity=0.150  Sum_probs=45.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222211344444322222122222222111223221111112233222222222111122222222211122221111
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGA  224 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~  224 (332)
                      .|.+|||.| +|.++.-=+.+....|++|++++.+.  ...++.+..+.-+...+..|.....     .++++||=+++.
T Consensus        11 ~~k~VlvvG-gG~va~rKa~~ll~~ga~v~Vvs~~~--~~el~~~~~~~~i~~~~~~~~~~~~-----~~~~lviaAt~d   82 (210)
T COG1648          11 EGKKVLVVG-GGSVALRKARLLLKAGADVTVVSPEF--EPELKALIEEGKIKWIEREFDAEDL-----DDAFLVIAATDD   82 (210)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECCCC--CHHHHHHHHHCCCCHHHCCCCHHHH-----CCCEEEEEECCC
T ss_conf             997799989-98999999999974699799987874--4999999983485310022363653-----682499991699


Q ss_pred             CCC-CCCCCCCCCCCCCEEE
Q ss_conf             112-2222112234530479
Q gi|254780290|r  225 EYL-NQHLTLLSKEGKLIII  243 (332)
Q Consensus       225 ~~~-~~~~~~l~~~G~iv~~  243 (332)
                      ..+ +......+..+.++..
T Consensus        83 ~~ln~~i~~~a~~~~i~vNv  102 (210)
T COG1648          83 EELNERIAKAARERRILVNV  102 (210)
T ss_pred             HHHHHHHHHHHHHHCCCEEE
T ss_conf             89999999999993993560


No 475
>PRK12770 putative glutamate synthase subunit beta; Provisional
Probab=66.30  E-value=1.1  Score=23.53  Aligned_cols=33  Identities=24%  Similarity=0.238  Sum_probs=21.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2222222113444443222221222222221112
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTA  177 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~  177 (332)
                      ..|++++|.|+ |.+|+-....++.+|++++.+.
T Consensus       169 ~~gk~vvVvGg-G~~a~e~A~~~~~~Ga~~v~l~  201 (350)
T PRK12770        169 VEGKKVVVVGA-GLTAVDAALEAKLLGAEKVYMA  201 (350)
T ss_pred             CCCCEEEEECC-CHHHHHHHHHHHHCCCCEEEEE
T ss_conf             58988999898-6456799999997599689999


No 476
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase. The NAD-binding domain of methylene-tetrahydrofolate dehydrogenase (m-THF DH).  M-THF is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. M-THF DH is a component of an unusual monofunctional enzyme; in eukaryotes, m-THF DH is typically found as part of a multifunctional protein.  NADP-dependent m-THF DHs in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional DH/cyclodrolase form. In bacteria, monofunctional DH, as well as bifunctional DH/cyclodrolase are found. In addition, yeast (S. cerevisiae) also express an monofunctional DH. This family contains only the monofunctional
Probab=66.00  E-value=3.3  Score=20.51  Aligned_cols=95  Identities=19%  Similarity=0.157  Sum_probs=55.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222211344444322222122222222111223221111112233222---22222211112222222221112222
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHA---INYLKEDFLEILQKETQGRGIDIILD  220 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~v---i~~~~~~~~~~i~~~t~g~g~Divid  220 (332)
                      -.|+++.|.|-+--||.=..+++...||.|+....+- -..+.+....++.   +-....+..+.++      ..|+++-
T Consensus        60 l~Gk~vvVIGRS~iVGkPla~LL~~~~ATVt~~d~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~aDIvI~  132 (197)
T cd01079          60 LYGKTITIINRSEVVGRPLAALLANDGARVYSVDING-IQVFTRGESIRHEKHHVTDEEAMTLDCLS------QSDVVIT  132 (197)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHCCCEEEEECCCC-EEEEECCCCCCCEEEEECCCCHHHHHHCC------CCCEEEE
T ss_conf             8999899989873154889999973899677503442-14640466522124564142100565423------4799998


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEE
Q ss_conf             1111112222211223453047983
Q gi|254780290|r  221 MVGAEYLNQHLTLLSKEGKLIIISF  245 (332)
Q Consensus       221 ~~G~~~~~~~~~~l~~~G~iv~~G~  245 (332)
                      .+|...+..--+.+++|..++.+|.
T Consensus       133 avg~p~~~i~~~~vk~GaivIDvg~  157 (197)
T cd01079         133 GVPSPNYKVPTELLKDGAICINFAS  157 (197)
T ss_pred             CCCCCCCCCCHHHCCCCCEEEEECC
T ss_conf             8787766566755448968998168


No 477
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional
Probab=65.92  E-value=0.99  Score=23.94  Aligned_cols=30  Identities=27%  Similarity=0.374  Sum_probs=23.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             222221134444432222212222222-2111
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGAT-VYTT  176 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~-vi~~  176 (332)
                      ..+|+|.| +||+|..+++++...|.. +..+
T Consensus        32 ~s~VlivG-~GGlG~~~~~~La~aGvg~i~lv   62 (245)
T PRK05690         32 AARVLVVG-LGGLGCAAAQYLAAAGVGTLTLV   62 (245)
T ss_pred             HCCEEEEC-CCHHHHHHHHHHHHCCCCEEEEE
T ss_conf             19789987-77778999999998599659999


No 478
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional
Probab=65.90  E-value=0.76  Score=24.70  Aligned_cols=78  Identities=18%  Similarity=0.195  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---------------------CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222221134444432222212222222211122---------------------322111111223322222222211
Q gi|254780290|r  144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK---------------------SEEKCLACLKLGAKHAINYLKEDF  202 (332)
Q Consensus       144 ~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~---------------------~~~~~~~~~~lGa~~vi~~~~~~~  202 (332)
                      ..+.+|.|+| +|+-|+.+...+..+|.+|.....                     -+...+.++++|++-..|..-.. 
T Consensus       430 ~~~gKVAVIG-sGPAGLs~A~~Lar~G~~VTVfEal~~~GGvL~YGIPeFRLPK~IV~~EI~~l~~lGVef~~n~~VGk-  507 (993)
T PRK12775        430 EKIGKVAIVG-SGPAGLAAAADLTRYGVETTVYEALHVLGGVLQYGIPSFRLPRDIIDREIQRLKDIGVKFETNKVVGK-  507 (993)
T ss_pred             CCCCCEEEEC-CCHHHHHHHHHHHHCCCCEEEEECCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHCCEEEECCCEECC-
T ss_conf             7898089978-37889999999997799648971688899726843777678889999999999878949983888656-


Q ss_pred             CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             112222222221112222111
Q gi|254780290|r  203 LEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       203 ~~~i~~~t~g~g~Divid~~G  223 (332)
                      .-.+.++...+|+|.||=.+|
T Consensus       508 ditl~eL~~e~gyDAVFIg~G  528 (993)
T PRK12775        508 TFTIPQLMNDRGFDAVFVAAG  528 (993)
T ss_pred             CCCHHHHHHCCCCCEEEEECC
T ss_conf             078999953459898999558


No 479
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed
Probab=65.71  E-value=0.67  Score=25.08  Aligned_cols=54  Identities=19%  Similarity=0.153  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2211122222222222211344444322222122222222111223221111112
Q gi|254780290|r  134 WANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK  188 (332)
Q Consensus       134 ~~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~  188 (332)
                      ..+|.+..---.+.+++|.| +||.+.+++..++..|++++.+.|+.+|.+.+.+
T Consensus       320 ~~~L~~~~~~~~~~~~~vlG-aGGaarAi~~~l~~~g~~i~I~nRt~~ka~~La~  373 (477)
T PRK09310        320 FSLLKQKNISLNNQHVAIVG-AGGAAKAIATTLARQGAELLIFNRTKAHAEALAS  373 (477)
T ss_pred             HHHHHHHCCCCCCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             99999709994446224424-7507999999998679979999799899999998


No 480
>PRK09224 threonine dehydratase; Reviewed
Probab=65.41  E-value=2.8  Score=21.01  Aligned_cols=168  Identities=13%  Similarity=0.074  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCC-------------------------
Q ss_conf             211344444322222122222222111---2232211111122332222222221-------------------------
Q gi|254780290|r  150 LIHGGSSGIGTTAIQLASYFGATVYTT---AKSEEKCLACLKLGAKHAINYLKED-------------------------  201 (332)
Q Consensus       150 lV~ga~g~vG~~a~qla~~~G~~vi~~---~~~~~~~~~~~~lGa~~vi~~~~~~-------------------------  201 (332)
                      +|...+|.-|+....-|+.+|++.+.+   ...+.|.+.++.+|++.++--.+-+                         
T Consensus        71 VV~aSaGNHAqgvA~AA~~lgi~atIvMP~ttP~~Kv~~vr~~GaeVvl~G~~~dea~~~A~~la~e~g~~fIhPfDdp~  150 (504)
T PRK09224         71 VITASAGNHAQGVALSAARLGIKAVIVMPVTTPDIKVDAVRALGGEVVLHGDSFDEAYAHAIELAEEEGLTFIHPFDDPD  150 (504)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHCCCEEECCCCCHH
T ss_conf             89989767999999999986998899978999799999999649979995999899999999999864978506778886


Q ss_pred             -------CCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEE
Q ss_conf             -------11122222222211122221111----1122222112234530479833787543222433430532167775
Q gi|254780290|r  202 -------FLEILQKETQGRGIDIILDMVGA----EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGST  270 (332)
Q Consensus       202 -------~~~~i~~~t~g~g~Divid~~G~----~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~  270 (332)
                             ..-++.+...+. .|.||-++|+    .-+...++.++|+=+++-+     +....-.+..-+..+..+.-..
T Consensus       151 VIaGQGTiglEIleQ~~~~-~D~V~vpVGGGGLiaGia~~~K~~~P~ikVIGV-----Epe~a~~m~~Sl~aG~~v~l~~  224 (504)
T PRK09224        151 VIAGQGTIAMEILQQHPHP-LDAIFVPVGGGGLIAGVAAYIKQLRPEIKVIGV-----EPEDSACLKAALEAGERVELPQ  224 (504)
T ss_pred             HHHCCCHHHHHHHHHCCCC-CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEE-----EECCCHHHHHHHHCCCEEECCC
T ss_conf             8626755999999857688-888999558437889999999863998738999-----9568757999997697565476


Q ss_pred             ECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             12400011378999999999999986983102124741899999999998299813289839
Q gi|254780290|r  271 LRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP  332 (332)
Q Consensus       271 ~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~P  332 (332)
                      ...+.|-..-......-.++.+-.-...      -+.+=+++-.|.+.+-+..   |+|+-|
T Consensus       225 v~~fADG~AV~~vG~~tF~i~k~~VDdv------v~V~~deIcaAikdi~e~~---r~I~EP  277 (504)
T PRK09224        225 VGLFADGVAVKRIGEETFRLCQEYVDDV------ITVDTDEICAAIKDVFEDT---RSIAEP  277 (504)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHCCCCE------EEECHHHHHHHHHHHHHHC---CEEECC
T ss_conf             6743576200667678998875248962------7988789999999999836---765346


No 481
>PRK06382 threonine dehydratase; Provisional
Probab=65.36  E-value=2.3  Score=21.54  Aligned_cols=167  Identities=15%  Similarity=0.063  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCC-------------------------
Q ss_conf             21134444432222212222222211122---32211111122332222222221-------------------------
Q gi|254780290|r  150 LIHGGSSGIGTTAIQLASYFGATVYTTAK---SEEKCLACLKLGAKHAINYLKED-------------------------  201 (332)
Q Consensus       150 lV~ga~g~vG~~a~qla~~~G~~vi~~~~---~~~~~~~~~~lGa~~vi~~~~~~-------------------------  201 (332)
                      +|...+|.-|+....-|+.+|.+.+.+..   ++.|.+.++.+|++.++--.+-+                         
T Consensus        70 VVaaSaGNHaqgvA~aa~~lgi~a~IvmP~~tp~~Kv~~~r~~GA~Vil~g~~~dea~~~A~~~a~e~g~~~Ihpfdd~~  149 (400)
T PRK06382         70 VITASAGNHAQGVAYAASINGIDAKIVMPEYTIPQKVNAVEAYGAHVILTGRDYDEAHRYADKIAMDENRTFIEAFNDRW  149 (400)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCEECCCCCCHH
T ss_conf             79958994699999999983998899917889999999998559789997776469999999999983976258889846


Q ss_pred             -------CCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEE
Q ss_conf             -------11122222222211122221111----1122222112234530479833787543222433430532167775
Q gi|254780290|r  202 -------FLEILQKETQGRGIDIILDMVGA----EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGST  270 (332)
Q Consensus       202 -------~~~~i~~~t~g~g~Divid~~G~----~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~  270 (332)
                             ..-++.+....  +|.++-++|+    .-...+++.++|+=+++-+     +....-.+..-+..+..+.-..
T Consensus       150 vIaGqGTiglEIleq~pd--~D~vvvpvGGGGLisGia~a~K~~~P~ikViGV-----Epe~a~~~~~sl~~g~~v~~~~  222 (400)
T PRK06382        150 VISGQGTIGLEIMEDLPD--LDQIIVPVGGGGLISGIALAAKHINPNVKIIGI-----ESELSDSMKASLREGKIVAHTS  222 (400)
T ss_pred             HHHCCHHHHHHHHHHCCC--CCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEE-----CCCCCHHHHHHHHCCCCCCCCC
T ss_conf             870730599999986689--998999368715889999999985999759997-----9689878999987799620588


Q ss_pred             ECCCHHCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             12400011378999999999999986983102124741899999999998299813289839
Q gi|254780290|r  271 LRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP  332 (332)
Q Consensus       271 ~~~~~~~~~~~~~~~~~~~~~~~i~~g~l~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~P  332 (332)
                      ..+..|-........+-..+.+-+-..      --+.+=+++..|+..+.+..   |+|+-|
T Consensus       223 ~~tiaDGiav~~~G~~tf~i~~~~vD~------vv~V~e~eI~~A~~~l~e~~---k~vvEp  275 (400)
T PRK06382        223 GVSICDGISVKYPGDLTFDIAKNYVDD------IVTVTEESVSKAIYKLFERE---KIVAEP  275 (400)
T ss_pred             CCEEECCCCCCCCCCCCHHHHHHCCCC------EEEECHHHHHHHHHHHHHHC---CEEEEC
T ss_conf             773642403565551159999840897------79989999999999999963---958826


No 482
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated
Probab=65.30  E-value=1.1  Score=23.52  Aligned_cols=32  Identities=22%  Similarity=0.174  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             221134444432222212222222211122322
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE  181 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~  181 (332)
                      |+|.| +|++|+++..++...|.+++.+++.+.
T Consensus         5 V~IVG-aGP~GL~LA~lLar~GI~~vVlEr~~~   36 (392)
T PRK08243          5 VAIIG-AGPAGLLLGQLLHLAGIDSVVLERRSR   36 (392)
T ss_pred             EEEEC-CCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             99999-779999999999977998899976899


No 483
>PRK12549 shikimate 5-dehydrogenase; Reviewed
Probab=65.24  E-value=0.58  Score=25.48  Aligned_cols=84  Identities=10%  Similarity=-0.026  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2111222222222222113444443222221222222-221112232211111122332222222221111222222222
Q gi|254780290|r  135 ANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGR  213 (332)
Q Consensus       135 ~~l~~~~~~~~g~~vlV~ga~g~vG~~a~qla~~~G~-~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~  213 (332)
                      .+|.+...-..+++++|.| +||.+.+++.-+...|+ +++.+.|+.+|.+.+.+.=....-+.......+.-.....  
T Consensus       116 ~~l~~~~~~~~~~~vlilG-aGGaa~ai~~al~~~g~~~i~I~nR~~~r~~~l~~~l~~~~~~~~~~~~~~~~~~~~~--  192 (284)
T PRK12549        116 EGFRRGLPDASLERVVQLG-AGGAGAAVAHALLTLGVERLTLFDVDPARAQALADELNARFPAARVTAGSDLAAALAA--  192 (284)
T ss_pred             HHHHHHCCCCCCCEEEEEC-CCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEECHHHHHHHHH--
T ss_conf             9999746453557189965-6616899999999769998999979889999999999865798637641676765421--


Q ss_pred             CCCCCCCCC
Q ss_conf             111222211
Q gi|254780290|r  214 GIDIILDMV  222 (332)
Q Consensus       214 g~Divid~~  222 (332)
                       +|++++|+
T Consensus       193 -~d~iINaT  200 (284)
T PRK12549        193 -ADGLVHAT  200 (284)
T ss_pred             -CCEEEECC
T ss_conf             -38266578


No 484
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886    Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5.1.3.2 from EC) interconverts UDP-glucose and UDP-galactose which are precursors of glucose- and galactose-containing exopolysaccharides (EPS). A set of related proteins, some of which are tentatively identified as UDP-glucose-4-epimerase in Thermotoga maritima, Bacillus halodurans, and several archaea, but deeply branched from this set and lacking experimental evidence, are excluded and described by a separate model. ; GO: 0003978 UDP-glucose 4-epimerase activity, 0006012 galactose metabolic process.
Probab=65.06  E-value=1.3  Score=23.08  Aligned_cols=85  Identities=18%  Similarity=0.193  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC----CCCCCCC
Q ss_conf             222113444443222221222222221112----23221111112-23322222222211112222222----2211122
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTA----KSEEKCLACLK-LGAKHAINYLKEDFLEILQKETQ----GRGIDII  218 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~----~~~~~~~~~~~-lGa~~vi~~~~~~~~~~i~~~t~----g~g~Div  218 (332)
                      +|||+||+|=||+=.+.-+...|.+|++.+    ++++.+...++ .|-+-.|---|-.=.+.+.+...    ...+|.|
T Consensus         1 ~iLVTGGAGYIGSHt~~~Ll~~G~ev~vlDNLs~G~~~~l~~~~~~~G~~~~fv~gDL~D~~~l~~~f~kqql~~~idAV   80 (341)
T TIGR01179         1 KILVTGGAGYIGSHTVRQLLESGYEVVVLDNLSNGSAEALKRGEEITGKEVTFVEGDLRDRELLRRVFEKQQLEHKIDAV   80 (341)
T ss_pred             CEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCCCEECCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             92686146644358878876359728998157888488750023414853205871751579999998774311675467


Q ss_pred             CCCCCCCCCCCCCC
Q ss_conf             22111111222221
Q gi|254780290|r  219 LDMVGAEYLNQHLT  232 (332)
Q Consensus       219 id~~G~~~~~~~~~  232 (332)
                      |-..|......+..
T Consensus        81 iHFAg~~~VgESv~   94 (341)
T TIGR01179        81 IHFAGLIAVGESVQ   94 (341)
T ss_pred             EEECCCCCCHHHHH
T ss_conf             52011212525575


No 485
>PRK02118 V-type ATP synthase subunit B; Provisional
Probab=64.95  E-value=4  Score=19.94  Aligned_cols=117  Identities=16%  Similarity=0.028  Sum_probs=0.0

Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCC----------------------CCCCCCCC---CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             00330002322222212222223333----------------------22112233---333221111111222222232
Q gi|254780290|r   66 ILGLEVAGKIVDLGENTTHWNIGDEV----------------------CALVNGGG---YAEYCLSHQGHTLPIPKGYNA  120 (332)
Q Consensus        66 v~G~e~~G~V~~vG~~v~~~~~GdrV----------------------~~~~~~G~---~ae~~~~~~~~~~~iP~~~s~  120 (332)
                      |++.+.--+++++=++.+++++|++|                      .|-.-+|+   ..++.-+....+-|+......
T Consensus        42 VI~~~~d~v~iqvfe~T~Gi~~G~~V~~tG~~l~V~vg~~lLGRV~DglGrPiDggp~~~~~~~~i~~~~inP~~R~~p~  121 (432)
T PRK02118         42 VLKLDGDKVTLQVFGGTSGISTGDEVVFLGRPMQVTFSDNLLGRRFNGTGKPIDGGPELEGEPIEIGGPSVNPVKRIVPR  121 (432)
T ss_pred             EEEEECCEEEEEECCCCCCCCCCCEEEECCCCCEEEECHHHCCCEECCCCCCCCCCCCCCCCEEECCCCCCCCHHHCCCC
T ss_conf             99981998999984698789999999968997678828654378644767615899878898861369998964206887


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             221222222333222111222222222222113444-443222221222222221112232211111122
Q gi|254780290|r  121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSS-GIGTTAIQLASYFGATVYTTAKSEEKCLACLKL  189 (332)
Q Consensus       121 ~~aa~l~~~~~tA~~~l~~~~~~~~g~~vlV~ga~g-~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~l  189 (332)
                      +       ...|...++--...+..|+++.|++++| +-..++.|+++...+.+++.+.=-++...+.++
T Consensus       122 e-------~l~TGI~aID~l~~l~rGQKi~IFsgsG~gks~L~~~Ia~~a~~dvvV~~~iGer~~e~~~f  184 (432)
T PRK02118        122 E-------MIRTGIPMIDVFNTLVKSQKIPIFSSSGEPYNALLARIALQAEADIIILGGMGLTFDDYLFF  184 (432)
T ss_pred             C-------CCCCCCEEEECCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEEEEECCEEECHHHHHH
T ss_conf             6-------77889678542367405856987447999763999999885389989640332441258999


No 486
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]
Probab=64.88  E-value=1.9  Score=22.03  Aligned_cols=91  Identities=16%  Similarity=0.119  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22222113444443222221222222221112232211111122332222222221111222222222111222211111
Q gi|254780290|r  146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAE  225 (332)
Q Consensus       146 g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~~~~~~~i~~~t~g~g~Divid~~G~~  225 (332)
                      +++|+|.| .|..|+.++.+++..|++|++.+.++.-...........-+.+.......     -....+|+|+=+.|-+
T Consensus         7 ~~kv~V~G-LG~sG~a~a~~L~~~G~~v~v~D~~~~~~~~~~~~~~~~~i~~~~g~~~~-----~~~~~~d~vV~SPGi~   80 (448)
T COG0771           7 GKKVLVLG-LGKSGLAAARFLLKLGAEVTVSDDRPAPEGLAAQPLLLEGIEVELGSHDD-----EDLAEFDLVVKSPGIP   80 (448)
T ss_pred             CCEEEEEE-CCCCCHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHCCCCEEECCCCCH-----HCCCCCCEEEECCCCC
T ss_conf             99799992-66510999999997798699983898765323444420372231376411-----0013477899899999


Q ss_pred             CCCCCCCCCCCCCCCEE
Q ss_conf             12222211223453047
Q gi|254780290|r  226 YLNQHLTLLSKEGKLII  242 (332)
Q Consensus       226 ~~~~~~~~l~~~G~iv~  242 (332)
                      .....+...+..|.-+.
T Consensus        81 ~~~p~v~~A~~~gi~i~   97 (448)
T COG0771          81 PTHPLVEAAKAAGIEII   97 (448)
T ss_pred             CCCHHHHHHHHCCCCEE
T ss_conf             98889999998699377


No 487
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=64.61  E-value=9.7  Score=17.39  Aligned_cols=165  Identities=13%  Similarity=0.089  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCC---------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22333222111222222222222113444-44322---------222122222222111223221111112233222222
Q gi|254780290|r  128 ESFFTVWANLFQTANLRSGQTVLIHGGSS-GIGTT---------AIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINY  197 (332)
Q Consensus       128 ~~~~tA~~~l~~~~~~~~g~~vlV~ga~g-~vG~~---------a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~  197 (332)
                      .+|+=.-+...+-......++|+|.|... -+|+.         ++.-+|..|.+++.+-.||+-.             +
T Consensus       535 T~Y~YSTY~~e~e~~~~~~~kvlvlGsGp~rIGqgiEFDY~~v~a~~alk~~G~~~imIN~NPETV-------------S  601 (1063)
T PRK05294        535 TPYMYSTYEEECESNPSDRKKVMILGGGPNRIGQGIEFDYCCVHAALALREAGYETIMVNCNPETV-------------S  601 (1063)
T ss_pred             CCEEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCC-------------C
T ss_conf             872676457777767778863799657773204442300679999999996598158953781111-------------1


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHC
Q ss_conf             22211112222222221112222111111222221122345304798337875432224334305321677751240001
Q gi|254780290|r  198 LKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDI  277 (332)
Q Consensus       198 ~~~~~~~~i~~~t~g~g~Divid~~G~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~  277 (332)
                      +|-|..+++-           |+.+..+.....++.-++.|.++.+|    ...+.--..++...++.+.|..       
T Consensus       602 TD~d~sDrLY-----------FEplt~E~V~~I~~~E~p~gvi~qfG----GQt~~nla~~L~~~g~~ilGts-------  659 (1063)
T PRK05294        602 TDYDTSDRLY-----------FEPLTLEDVLEIIEKEKPKGVIVQFG----GQTPLKLAKALEAAGVPILGTS-------  659 (1063)
T ss_pred             CCCCCCCEEE-----------ECCCCHHHHHHHHHHHCCCEEEEECC----CCCHHHHHHHHHHCCCCEECCC-------
T ss_conf             5656676145-----------43688999999999758987999738----8367899999998799477788-------


Q ss_pred             CHHHHHHHHHHHHHHHHHCCCC-CCCCEEEEEHHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             1378999999999999986983-102124741899999999998299813289839
Q gi|254780290|r  278 AKQSIRDSLQLKIWPLLNSHVI-APVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP  332 (332)
Q Consensus       278 ~~~~~~~~~~~~~~~~i~~g~l-~p~i~~~~~l~~i~~A~~~l~~g~~~GKvVi~P  332 (332)
                      .......+-+.+..+++.+=.+ +|.-....+++++.+.-+.+-=     -|+|+|
T Consensus       660 ~~~Id~aEDR~~F~~~l~~l~i~qp~~~~a~s~~ea~~~a~~iGy-----PvlvRP  710 (1063)
T PRK05294        660 PDAIDLAEDRERFQKLLEKLGIKQPPNGTATSVEEALEIAEEIGY-----PVLVRP  710 (1063)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCEECCHHHHHHHHHHCCC-----CEEECC
T ss_conf             788787875888999998659999997076689999999986498-----668434


No 488
>PRK07574 formate dehydrogenase; Provisional
Probab=64.56  E-value=6.3  Score=18.65  Aligned_cols=157  Identities=13%  Similarity=-0.000  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------------------CCCCCCC
Q ss_conf             2222221134444432222212222222211122322111111223322222222------------------2111122
Q gi|254780290|r  145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLK------------------EDFLEIL  206 (332)
Q Consensus       145 ~g~~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~vi~~~~------------------~~~~~~i  206 (332)
                      .|+++-|.| .|.+|+...+.|+.+|++|+..++.....+..+++|+....+-.+                  ..+...-
T Consensus       191 ~GKTlGIVG-~GrIG~~VArra~aFgm~Vl~yDp~~l~~~~e~~lg~~~~~sldeLl~~sDvVslh~PLt~eT~~Lin~~  269 (385)
T PRK07574        191 EGMTVGTVG-AGRIGLAVLRRLKPFDVTLHYTDRHRLPAEVEQELGLTYHPDVDSLVSVCDVVTIHCPLHPETEHLFDKD  269 (385)
T ss_pred             CCCEEEEEC-CCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHCCCCCCCCHHHHHHHCCEEEECCCCCHHHHHHCCHH
T ss_conf             899899989-7889999999999779989985886698899997198656899999862896998667985774010299


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEEECCCHHCCHHHHHHHH
Q ss_conf             22222221112222111111222221122345304798337875432224334305321677751240001137899999
Q gi|254780290|r  207 QKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSL  286 (332)
Q Consensus       207 ~~~t~g~g~Divid~~G~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~  286 (332)
                      .=..-..|.=+|=-+-|+-.=+.++--.=..|++.-+|.=--...+...-++++...-.+.-..+..........+....
T Consensus       270 ~l~~MK~ga~LVNtARG~iVDe~AL~~AL~sG~i~gaglDV~~~EP~p~dhPl~~lpNv~lTPHiaG~t~~Aq~R~a~g~  349 (385)
T PRK07574        270 VLSRMKRGSYLVNTARGKIVDRDAVVEALESGHLAGYAGDVWFPQPAPADHPWRTMPRNAMTPHISGTTLSAQARYAAGT  349 (385)
T ss_pred             HHHCCCCCCEEEECCCCHHCCHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHCCCCCEECCCCCCCCHHHHHHHHHHH
T ss_conf             99438998189988861101999999999729804999678998899899802229961688854548699999999989


Q ss_pred             HHHHHHHHHCCCCCCC
Q ss_conf             9999999986983102
Q gi|254780290|r  287 QLKIWPLLNSHVIAPV  302 (332)
Q Consensus       287 ~~~~~~~i~~g~l~p~  302 (332)
                      ...+.++++...+++.
T Consensus       350 ~~~l~~~~~g~p~r~~  365 (385)
T PRK07574        350 REILECFFEGRPIRDE  365 (385)
T ss_pred             HHHHHHHHCCCCCCCC
T ss_conf             9999999659999974


No 489
>PRK10262 thioredoxin reductase; Provisional
Probab=64.54  E-value=1  Score=23.89  Aligned_cols=92  Identities=17%  Similarity=0.179  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2221134444432222212222222211122322111111223322----222222211112222222221112222111
Q gi|254780290|r  148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKH----AINYLKEDFLEILQKETQGRGIDIILDMVG  223 (332)
Q Consensus       148 ~vlV~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~lGa~~----vi~~~~~~~~~~i~~~t~g~g~Divid~~G  223 (332)
                      .|+|+| +|+.|+.|.-+|..+|.+++.+...+.--.+....-.++    ..+.+-+++.+.+.+.....+.+++++.+.
T Consensus         8 dviIIG-~GPAGLsAA~~a~r~g~~~~lie~~~~GG~l~~~~~i~n~pg~~~~i~G~~l~~~~~~q~~~~~~~i~~~~v~   86 (321)
T PRK10262          8 KLLILG-SGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHIN   86 (321)
T ss_pred             EEEEEC-CCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHCCEEEECCCC
T ss_conf             099999-7689999999999869967999605968742005603561788876477999999999999708748941231


Q ss_pred             C-CCCCCCCCCCCCCCCC
Q ss_conf             1-1122222112234530
Q gi|254780290|r  224 A-EYLNQHLTLLSKEGKL  240 (332)
Q Consensus       224 ~-~~~~~~~~~l~~~G~i  240 (332)
                      . +..+..+.+....|.+
T Consensus        87 ~i~~~~~~f~v~t~~g~~  104 (321)
T PRK10262         87 KVDLQNRPFRLTGDSGEY  104 (321)
T ss_pred             EEEEECCCEEEECCCCEE
T ss_conf             577403651997589889


No 490
>KOG1200 consensus
Probab=64.45  E-value=1.1  Score=23.60  Aligned_cols=42  Identities=36%  Similarity=0.419  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCC
Q ss_conf             22113444443222221222222221112-2322111111223
Q gi|254780290|r  149 VLIHGGSSGIGTTAIQLASYFGATVYTTA-KSEEKCLACLKLG  190 (332)
Q Consensus       149 vlV~ga~g~vG~~a~qla~~~G~~vi~~~-~~~~~~~~~~~lG  190 (332)
                      .+|+||++++|.+..|.....|+++.+.+ .+..-.+.++.+|
T Consensus        17 ~~vtGg~sGIGrAia~~la~~Garv~v~dl~~~~A~ata~~L~   59 (256)
T KOG1200          17 AAVTGGSSGIGRAIAQLLAKKGARVAVADLDSAAAEATAGDLG   59 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC
T ss_conf             4873487507799999997469679975032244799986268


No 491
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase. Members of this family are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species. The diversity in the roles of methylation is matched by the almost bewildering number of methyltransferase enzymes that catalyse the methylation reaction. Although several classes of methyltransferase enzymes are known, the great majority of methylation reactions are catalysed by the S-adenosylmethionine-dependent methyltransferases.
Probab=64.07  E-value=0.92  Score=24.16  Aligned_cols=97  Identities=11%  Similarity=0.049  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCC-
Q ss_conf             11344444322222122222222111223221111112----2332-222222221111222222222111222-2111-
Q gi|254780290|r  151 IHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK----LGAK-HAINYLKEDFLEILQKETQGRGIDIIL-DMVG-  223 (332)
Q Consensus       151 V~ga~g~vG~~a~qla~~~G~~vi~~~~~~~~~~~~~~----lGa~-~vi~~~~~~~~~~i~~~t~g~g~Divi-d~~G-  223 (332)
                      |...-+=+|-+.+.-++.--.+|+.++.|+.-++.+++    .|.+ ..+.....|.-+.+.++-.+..||+|| |... 
T Consensus       127 vLn~Fsytg~fsv~A~~~GA~~v~~vD~S~~al~~a~~N~~lN~~~~~~~~~~~~D~f~~l~~~~~~~~fD~VilDPPsf  206 (286)
T pfam10672       127 VLNLFAYTCGFSVAAIAGGASQVVNVDMARGSLSKGRDNHRLNGHDLGRVSFLGHDIFKSWGKIKKLGPYDLVIIDPPSF  206 (286)
T ss_pred             EEEECCCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEEEHHHHHHHHHHCCCCCCEEEECCCCC
T ss_conf             25311478699999876798779999198899999999999769995436999830999999986179998799879998


Q ss_pred             -----------CCCCCCCCCCCCCCCCCEEEEECC
Q ss_conf             -----------111222221122345304798337
Q gi|254780290|r  224 -----------AEYLNQHLTLLSKEGKLIIISFLG  247 (332)
Q Consensus       224 -----------~~~~~~~~~~l~~~G~iv~~G~~~  247 (332)
                                 .+....+++++++||.+++|++..
T Consensus       207 ~k~~~~~~~~Y~~l~~~a~~ll~~gG~L~~~s~s~  241 (286)
T pfam10672       207 QKGSFALTKDYKKILRRLPELLVEGGTVLACVNSP  241 (286)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             88724788789999999998608996899981886


No 492
>PRK08198 threonine dehydratase; Provisional
Probab=64.00  E-value=2.6  Score=21.17  Aligned_cols=167  Identities=11%  Similarity=0.067  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCC-------------------------
Q ss_conf             21134444432222212222222211122---32211111122332222222221-------------------------
Q gi|254780290|r  150 LIHGGSSGIGTTAIQLASYFGATVYTTAK---SEEKCLACLKLGAKHAINYLKED-------------------------  201 (332)
Q Consensus       150 lV~ga~g~vG~~a~qla~~~G~~vi~~~~---~~~~~~~~~~lGa~~vi~~~~~~-------------------------  201 (332)
                      +|...+|.-|+....-|+.+|++.+.+..   ++.|.+..+++|++.++--.+-+                         
T Consensus        75 VVaaSaGNHaqgvA~aa~~~gi~a~IvmP~~ap~~Ki~~~r~~GA~Vil~G~~~~ea~~~A~~~a~e~g~~~ihpfdd~~  154 (406)
T PRK08198         75 VVAASAGNHAQGVAYAASLLGIKATIVMPETAPLSKVQATKSYGAEVVLHGDVYDEALAAALELAEETGATFVHPFDDPD  154 (406)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHCCCEEECCCCCHH
T ss_conf             79977876999999999981998899936778899999998479889996998689999999999743867538989954


Q ss_pred             -------CCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHCCCCEEEEEE
Q ss_conf             -------11122222222211122221111----1122222112234530479833787543222433430532167775
Q gi|254780290|r  202 -------FLEILQKETQGRGIDIILDMVGA----EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGST  270 (332)
Q Consensus       202 -------~~~~i~~~t~g~g~Divid~~G~----~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~i~g~~  270 (332)
                             ..-++.+....  +|.++-++|+    .-...+++.++|+=+++-+     +....-.+..-+..+..+.-..
T Consensus       155 viaGqGTiglEileq~p~--~D~vvvpvGGGGLiaGia~a~K~~~P~ikViGV-----Epe~a~~~~~Sl~ag~~v~~~~  227 (406)
T PRK08198        155 VIAGQGTIGLEILEDLPD--VDTVVVPIGGGGLISGVATAVKALRPNVRVIGV-----QAEGAPAMPLSLAAGRPVELES  227 (406)
T ss_pred             HHCCHHHHHHHHHHHCCC--CCEEEECCCCHHHHHHHHHHHHHHCCCCCEEEE-----EECCCHHHHHHHHCCCCEECCC
T