BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780290|ref|YP_003064703.1| quinone oxidoreductase
[Candidatus Liberibacter asiaticus str. psy62]
         (332 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780290|ref|YP_003064703.1| quinone oxidoreductase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039967|gb|ACT56763.1| quinone oxidoreductase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 332

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/332 (100%), Positives = 332/332 (100%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP
Sbjct: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA
Sbjct: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE
Sbjct: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL
Sbjct: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA
Sbjct: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
           PVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP
Sbjct: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332


>gi|222147871|ref|YP_002548828.1| quinone oxidoreductase [Agrobacterium vitis S4]
 gi|221734859|gb|ACM35822.1| quinone oxidoreductase [Agrobacterium vitis S4]
          Length = 389

 Score =  417 bits (1073), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/330 (59%), Positives = 247/330 (74%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   MR+V    +G   VM +A  P+P P   EIL+KVEA GVNRPDV QR+G YPPP
Sbjct: 58  MTLPTHMRYVDTPSFGGPEVMTIAHGPLPAPAAGEILVKVEAAGVNRPDVAQRQGSYPPP 117

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K A+P+LGLEVAG +V LGE  + + IGD+VC L NGGGYAE+C+  +G +LP P+G++A
Sbjct: 118 KGASPVLGLEVAGTVVALGEGVSDFAIGDKVCGLANGGGYAEFCILPEGQSLPWPRGFDA 177

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AA++PE+FFTVWANLFQ A L  G+TVLIHGGSSGIGTTAIQLA  FGA V TT  S 
Sbjct: 178 VKAAAVPETFFTVWANLFQMAGLTEGETVLIHGGSSGIGTTAIQLARAFGADVLTTVGSA 237

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EK  ACLKLGA+ AINY  EDF E+++ ET G+G+DIILDM+GA Y  +++  L+K+G L
Sbjct: 238 EKAEACLKLGARRAINYRSEDFAEVVKAETDGKGVDIILDMIGASYFEKNIASLAKDGCL 297

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II+FLGG +A ++NL PI+ KR+T+TGST+R RT   K++IRD L    WPLL    +A
Sbjct: 298 SIIAFLGGAVAEKVNLGPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLASAWPLLEQGTVA 357

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVIHTVLP  KVA AH +ME S HIGKI+L
Sbjct: 358 PVIHTVLPFDKVADAHRLMEDSTHIGKIVL 387


>gi|159184482|ref|NP_353846.2| quinone oxidoreductase [Agrobacterium tumefaciens str. C58]
 gi|159139791|gb|AAK86631.2| quinone oxidoreductase [Agrobacterium tumefaciens str. C58]
          Length = 327

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 190/324 (58%), Positives = 248/324 (76%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +  +G   VM  +++P+P+P + EIL+KVEA GVNRPDV QR+G+YPPPK A+PI
Sbjct: 1   MRFIDLPSHGGPEVMQSSKAPLPKPARGEILVKVEAAGVNRPDVAQRQGIYPPPKGASPI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE+AG++V LGE    + +GD+VCAL NGGGYAEYC    G  LP PKGY+A++AA+L
Sbjct: 61  LGLEIAGEVVALGEGVDEFKLGDKVCALANGGGYAEYCAVPAGQALPFPKGYDAVKAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWANLFQ A L  G+TVLIHGG+SGIGTTAIQLA  FGA VY TA S EKC AC
Sbjct: 121 PETFFTVWANLFQMAGLTEGETVLIHGGTSGIGTTAIQLAKAFGAEVYATAGSAEKCEAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           +KLG K AINY +EDF EI++ ET G+G+D++LDM+GA Y  ++L  L+K+G L II+FL
Sbjct: 181 VKLGTKRAINYREEDFAEIVKSETGGKGVDVVLDMIGAAYFEKNLAALAKDGCLSIIAFL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A +++L PI+ KR+T+TGST+R RT   K++IRD L  ++WPL+ S  +APVI+ V
Sbjct: 241 GGATAEKVDLRPIMVKRLTVTGSTMRPRTADEKRAIRDELVEQVWPLIESGKVAPVINRV 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L +V  AH +ME S HIGKI++
Sbjct: 301 FTLEEVVDAHRLMESSNHIGKIVM 324


>gi|325292203|ref|YP_004278067.1| quinone oxidoreductase [Agrobacterium sp. H13-3]
 gi|325060056|gb|ADY63747.1| quinone oxidoreductase [Agrobacterium sp. H13-3]
          Length = 337

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 187/326 (57%), Positives = 250/326 (76%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           +KMR + +  +G   VM L+++P+P P + EIL++VEA GVNRPDV QR+G YPPPK+A+
Sbjct: 9   EKMRFIDLPSHGGPEVMQLSQAPLPTPARGEILVRVEAAGVNRPDVAQRQGAYPPPKDAS 68

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           PILGLE+AG++V LGE  + +  GD+VCAL NGGGYA+YC    G  LP PKGY+A++AA
Sbjct: 69  PILGLEIAGEVVALGEGVSEFKPGDKVCALANGGGYAQYCTVPAGQALPFPKGYDAVKAA 128

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           +LPE+FFTVWANLFQ A L  G++VLIHGG+SGIGTTAIQLA  FGA VY TA S EKC 
Sbjct: 129 ALPETFFTVWANLFQMAGLTEGESVLIHGGTSGIGTTAIQLAKAFGADVYATAGSAEKCE 188

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC+KLGAK AINY  EDF  +++ ET G+G+D++LDM+GA Y  +++  L+K+G L II+
Sbjct: 189 ACVKLGAKRAINYRDEDFTAVIKAETDGKGVDVVLDMIGAAYFEKNIAALAKDGCLSIIA 248

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FLGG +A +++L PI+ KR+T+TGST+R RT   K++IRD L  ++WPL+ S  +APVI+
Sbjct: 249 FLGGAVAEKVDLRPIMVKRLTVTGSTMRPRTADEKRAIRDELIEQVWPLIESGKVAPVIN 308

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
            V  L +V  AH +ME S HIGKI++
Sbjct: 309 KVFTLDEVVEAHRLMETSNHIGKIVM 334


>gi|327194323|gb|EGE61184.1| putative quinone oxidoreductase protein [Rhizobium etli CNPAF512]
          Length = 331

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/330 (57%), Positives = 246/330 (74%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           MP+ ++MR V +  +G   VM +   P+P P + ++L++ EAIGVNRPD+ QR+G YPPP
Sbjct: 1   MPLPQEMRFVDLKSFGTPEVMTIGRRPLPVPGEGQVLVRAEAIGVNRPDIAQRQGSYPPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K+A+PILGLE++G+IV +G   T   +GD+VC L NGG YAEYCL   G  LP PKGY+A
Sbjct: 61  KDASPILGLELSGEIVAVGPGVTDHAVGDKVCGLANGGAYAEYCLLPSGQVLPFPKGYDA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AA+LPE+FFTVWANLFQ A L  G+TVLIHGG+SGIGTTAIQLA  FGA VY TA S 
Sbjct: 121 VRAAALPETFFTVWANLFQMAGLTEGETVLIHGGTSGIGTTAIQLARAFGAEVYATAGSR 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC +LGAK AINY  EDF E+++ ET G+G+DIILDM+GA Y  ++L  L+K+G L
Sbjct: 181 EKCEACERLGAKRAINYRSEDFAEVIRAET-GQGVDIILDMIGAAYFERNLASLAKDGCL 239

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II+FLGG +A +INL+PI+ KR+T+TGST+R RT   K++IRD L  ++WPLL +  +A
Sbjct: 240 SIIAFLGGAVAEKINLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLAEVWPLLEAGTVA 299

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVIH V     V  AH ++E   HIGKI+L
Sbjct: 300 PVIHKVFAFEDVVAAHRLLEDGSHIGKIML 329


>gi|190890842|ref|YP_001977384.1| quinone oxidoreductase [Rhizobium etli CIAT 652]
 gi|190696121|gb|ACE90206.1| probable quinone oxidoreductase protein [Rhizobium etli CIAT 652]
          Length = 331

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 187/330 (56%), Positives = 246/330 (74%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           MP+ ++MR V +  +G   VM +   P+P P + ++L++  AIGVNRPD+ QR+G YPPP
Sbjct: 1   MPLPQEMRFVDLKSFGTPEVMAIGRRPLPVPGEGQVLVRAAAIGVNRPDIAQRQGSYPPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K+A+PILGLE++G+IV +G + T   +GD+VC L NGG YAEYCL   G  LP PKGY+A
Sbjct: 61  KDASPILGLELSGEIVAVGPDVTDHAVGDKVCGLANGGAYAEYCLLPSGQILPFPKGYDA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           +QAA+LPE+FFTVWANLFQ A L  G+TVLIHGG+SGIGTTAIQLA  FGA VY TA S 
Sbjct: 121 VQAAALPETFFTVWANLFQMAGLTEGETVLIHGGTSGIGTTAIQLARAFGAEVYATAGSP 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +KC AC +LGAK AINY  EDF E+++ ET G+G+DIILDM+GA Y  ++L  L+K+G L
Sbjct: 181 KKCEACERLGAKRAINYRSEDFAEVIRAET-GQGVDIILDMIGAAYFERNLASLAKDGCL 239

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II+FLGG +A +INL+PI+ KR+T+TGST+R RT   K++IRD L  ++WPLL +  +A
Sbjct: 240 SIIAFLGGAVAEKINLSPIMVKRLTVTGSTMRPRTTEEKRAIRDDLLAEVWPLLEAGTVA 299

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PV+H V     V  AH ++E   HIGKI+L
Sbjct: 300 PVVHKVFAFEDVVAAHRLLEDGSHIGKIML 329


>gi|209548385|ref|YP_002280302.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534141|gb|ACI54076.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 338

 Score =  401 bits (1030), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 187/330 (56%), Positives = 245/330 (74%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + ++MR V +  +G   VM +   P+P P + ++L++ EAIGVNRPDV QR+G YP P
Sbjct: 7   MSLPQEMRFVDLPSFGGPEVMTIGRRPLPVPGEGQVLVRAEAIGVNRPDVAQRQGSYPAP 66

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           ++A+PILGLE++G+IV +G   + + +GD+VC L NGG YAEYCL   G  LP PKGY+A
Sbjct: 67  RDASPILGLELSGEIVAIGLGVSGYRVGDKVCGLANGGAYAEYCLLPAGQILPFPKGYDA 126

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AA+LPE+FFTVWANLFQ A L  G+TVLIHGGSSGIGTTAIQLA  FGA VY TA S 
Sbjct: 127 VKAAALPETFFTVWANLFQMAGLTEGETVLIHGGSSGIGTTAIQLARAFGAEVYATAGSS 186

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC +LGAK AINY  EDF E+++ ET G+G+DIILDM+GA Y  ++L  L K+G L
Sbjct: 187 EKCAACERLGAKRAINYKSEDFAEVIKAET-GQGVDIILDMIGAAYFERNLASLGKDGCL 245

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II+FLGG IA ++NL+PI+ KR+T+TGST+R RT   K++IRD L  ++WPLL +  +A
Sbjct: 246 SIIAFLGGAIAEKVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSEVWPLLEAGTVA 305

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVIH V    +V  AH +ME   H+GKI+L
Sbjct: 306 PVIHKVFAFEEVVAAHRLMEDGSHVGKIML 335


>gi|116251043|ref|YP_766881.1| quinone oxidoreductase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255691|emb|CAK06772.1| putative quinone oxidoreductase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 332

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/330 (56%), Positives = 245/330 (74%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           MP+ + MR V +  +G   VM +   P+P PQ  ++L++ EAIGVNRPD+ QR+G YP P
Sbjct: 1   MPLPQDMRFVDLPSFGGPEVMTIGRRPLPVPQDGQVLVRAEAIGVNRPDIAQRQGSYPAP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K+A+PILGLE++GKIV +G       +GD+VC L NGG YAEYCL   G  LPIPK Y+A
Sbjct: 61  KDASPILGLELSGKIVAVGPGVRGHAVGDKVCGLANGGAYAEYCLLPAGQILPIPKAYDA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AA+LPE+FFTVWANLFQ A L  G+TVLIHGGSSGIGTTAIQLA  FGA VY TA S+
Sbjct: 121 VKAAALPETFFTVWANLFQMAGLTEGETVLIHGGSSGIGTTAIQLARAFGAEVYATAGSK 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC KLGAK AINY  EDF E+++ ET G G+DIILDM+GA Y  +++  L+K+G L
Sbjct: 181 EKCEACEKLGAKRAINYRTEDFAEVIKAET-GHGVDIILDMIGAAYFERNIASLAKDGCL 239

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II+FLGG +A ++NL+PI+ KR+T+TGST+R RT   K++IRD L  ++WPLL +  +A
Sbjct: 240 SIIAFLGGAVAEKVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSEVWPLLAAGTVA 299

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVIH V    +V  AH ++E+  H+GK++L
Sbjct: 300 PVIHKVFAFEEVVEAHRLLEEGSHVGKVML 329


>gi|218462610|ref|ZP_03502701.1| quinone oxidoreductase protein [Rhizobium etli Kim 5]
          Length = 331

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/330 (56%), Positives = 247/330 (74%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + ++MR V +  +G  +VM + + P+P P + EIL++ EAIGVNRPD+ QR+G YPPP
Sbjct: 1   MSLPQEMRFVDLKSFGGPDVMVIGKRPLPVPGEGEILLRAEAIGVNRPDIAQRQGSYPPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K+A+PILGLE+AG+IV +G       +GD+VC L NGG YAEYCL   G  LPIPKGY+A
Sbjct: 61  KDASPILGLELAGEIVAVGPGVVGHAVGDKVCGLANGGAYAEYCLLPAGQILPIPKGYDA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AA+LPE+FFTVWANLFQ A L  G++VLIHGG+SGIGTTAIQLA  FGA VY TA S+
Sbjct: 121 VKAAALPETFFTVWANLFQMAGLTDGESVLIHGGTSGIGTTAIQLARAFGAEVYATAGSK 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC +LGAK AINY  EDF ++++ +T G G+DIILDM+GA Y  ++L  L+K+G L
Sbjct: 181 EKCEACERLGAKRAINYRSEDFAKVIKADT-GHGVDIILDMIGAAYFERNLASLAKDGCL 239

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II+FLGG +A  +NL+PI+ KR+T+TGST+R RT   K++IRD L  ++WPLL +  IA
Sbjct: 240 SIIAFLGGAVAERVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSQVWPLLETGAIA 299

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVIH V     V  AH ++E+  HIGK++L
Sbjct: 300 PVIHKVFAFEAVVEAHRLIEEGSHIGKVVL 329


>gi|222085211|ref|YP_002543741.1| quinone oxidoreductase protein [Agrobacterium radiobacter K84]
 gi|221722659|gb|ACM25815.1| quinone oxidoreductase protein [Agrobacterium radiobacter K84]
          Length = 332

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/330 (57%), Positives = 242/330 (73%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +  +MR V +  +G   VM +A  P+P  +  EIL++VEA GVNRPDV QR+G+YPPP
Sbjct: 1   MRLPSEMRFVDLPSFGAPEVMTIARKPLPVLKDGEILVRVEATGVNRPDVAQRQGIYPPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K+A+PILGLEVAG++VD+    T + IG++VC L NGG YAEYC+      L  P GY+A
Sbjct: 61  KDASPILGLEVAGEVVDVARGVTEFAIGNKVCGLANGGAYAEYCVLPASQALRFPNGYDA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AASLPE+FFTVWANLFQ A L  G++VLIHGGSSGIGTTAIQLA  FGATVY TA S+
Sbjct: 121 VRAASLPETFFTVWANLFQMAGLTEGESVLIHGGSSGIGTTAIQLAHAFGATVYATAGSK 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC KLGAK AINY  EDF E+++ ET G G+DIILDM+GA Y  ++L  L+K+G L
Sbjct: 181 EKCEACEKLGAKRAINYKDEDFAEVIKAET-GHGVDIILDMIGAAYFEKNLASLAKDGCL 239

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II+FLGG +A + NL PI+ KR+T+TGST+R RT   K++IRD L  ++WPLL+   IA
Sbjct: 240 SIIAFLGGAVAEKANLQPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSQVWPLLDEGTIA 299

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVI+       V  AH +ME S HIGKI+L
Sbjct: 300 PVIYKTFAFDDVIDAHRLMETSNHIGKIML 329


>gi|241203634|ref|YP_002974730.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857524|gb|ACS55191.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 332

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/330 (56%), Positives = 243/330 (73%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           MP+ ++M  V +  +G   VM +   P+P PQ  E+L++ EAIGVNRPD+ QR+G YP P
Sbjct: 1   MPLPQEMHFVDLPSFGGPEVMTIDRRPLPVPQDGEVLVRAEAIGVNRPDIAQRQGNYPAP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K A+PILGLE++G+IV +G   +   +GD+VC L NGG YAEYCL   G  LP PKGY+A
Sbjct: 61  KGASPILGLELSGEIVAVGPGVSGHAVGDKVCGLANGGAYAEYCLLPAGQILPFPKGYDA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AA+LPE+FFTVWANLFQ A L  G+TVLIHGGSSGIGTTAIQLA  FGA VY TA S+
Sbjct: 121 VKAAALPETFFTVWANLFQMAGLTEGETVLIHGGSSGIGTTAIQLARAFGAEVYATAGSK 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC KLGAK AINY  EDF E+++ ET G G+DIILDM+GA Y  +++  L+K+G L
Sbjct: 181 EKCEACEKLGAKRAINYRTEDFAEVIKAET-GHGVDIILDMIGASYFERNIASLAKDGCL 239

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II+FLGG I  ++NL+PI+ KR+T+TGST+R RT   K++IRD L  ++WPLL +  +A
Sbjct: 240 SIIAFLGGAIVEKVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSEVWPLLAAGTVA 299

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVIH V    +V  AH ++E   H+GK++L
Sbjct: 300 PVIHKVFAFDEVVEAHRLLEDGSHVGKVML 329


>gi|86356783|ref|YP_468675.1| quinone oxidoreductase protein [Rhizobium etli CFN 42]
 gi|86280885|gb|ABC89948.1| probable quinone oxidoreductase protein [Rhizobium etli CFN 42]
          Length = 331

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 180/330 (54%), Positives = 246/330 (74%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + ++MR V +  +G  +VM + + P+P   + E+L++ EAIGVNRPD+ QR+G YPPP
Sbjct: 1   MSLPQEMRFVDLKSFGGPDVMVIGKRPLPVAGEGEVLVRAEAIGVNRPDIAQRQGSYPPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K+A+PILGLE++G+IV +G   + + +GD+VC L NGG YAEYCL   G  LP PKGY+A
Sbjct: 61  KDASPILGLELSGEIVGVGPGVSGYAVGDKVCGLANGGAYAEYCLLPAGQILPFPKGYDA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AA+LPE+FFTVWANLFQ A L  G++VLIHGG+SGIGTTAIQLA  FGA VY TA S 
Sbjct: 121 VKAAALPETFFTVWANLFQMAGLTEGESVLIHGGTSGIGTTAIQLARAFGAEVYATAGST 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
            KC AC +LGAK  INY  EDF  +++ ET G+G+DIILDM+GA Y  +++  L+K+G L
Sbjct: 181 GKCEACERLGAKRGINYRSEDFAAVIKAET-GQGVDIILDMIGAAYFERNIASLAKDGCL 239

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II+FLGG +A ++NL+PI+ KR+T+TGST+R RT   K++IRD L  ++WPLL +  +A
Sbjct: 240 SIIAFLGGAVAEKVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSEVWPLLEAGTVA 299

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVIH V     VA AH ++E+  H+GK++L
Sbjct: 300 PVIHKVFAFEDVADAHRLLEEGSHVGKVML 329


>gi|227821281|ref|YP_002825251.1| putative quinone oxidoreductase [Sinorhizobium fredii NGR234]
 gi|227340280|gb|ACP24498.1| putative quinone oxidoreductase [Sinorhizobium fredii NGR234]
          Length = 335

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 239/330 (72%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M I  +M +V +   G +  M LA  P+P+ +  EILI+VEA GVNRPDV+QRKG YPPP
Sbjct: 1   MTIPTEMTYVDLPSPGGAENMVLARGPLPELKAGEILIRVEAFGVNRPDVLQRKGDYPPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+P+LGLEVAG++ DLG+    + +GD+VCAL NGGGYAE+C       L  PKGY+A
Sbjct: 61  PGASPVLGLEVAGEVADLGDGAAGFAVGDKVCALANGGGYAEFCAVPATQALAWPKGYDA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AA+LPE+FFTVWAN+F  A L++G+T+L+HGGSSGIGTTAIQLA   GA V+ TA S 
Sbjct: 121 VKAAALPETFFTVWANVFDMAGLKAGETILVHGGSSGIGTTAIQLARALGAEVFATAGSA 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
            KC AC  LGAKHAINY +EDF   + + T GRG+D+ILDMVG  Y  ++L  L+K+G+L
Sbjct: 181 AKCTACETLGAKHAINYREEDFKAAVLEATGGRGVDVILDMVGGRYFGRNLASLAKDGRL 240

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II FLGG    + ++  I++KR+ + GS LR RT   KQ+IRD L  ++WPLL +  +A
Sbjct: 241 SIIGFLGGARVEDASIVAILTKRLHVMGSALRPRTTGEKQAIRDGLVARVWPLLEAGDVA 300

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVIH VLPL +++ AH +ME+ +HIGKI++
Sbjct: 301 PVIHAVLPLEEISDAHRLMEEGDHIGKIVI 330


>gi|307304283|ref|ZP_07584035.1| NAD(P)H quinone oxidoreductase, PIG3 family [Sinorhizobium meliloti
           BL225C]
 gi|307321682|ref|ZP_07601072.1| NAD(P)H quinone oxidoreductase, PIG3 family [Sinorhizobium meliloti
           AK83]
 gi|306892646|gb|EFN23442.1| NAD(P)H quinone oxidoreductase, PIG3 family [Sinorhizobium meliloti
           AK83]
 gi|306902751|gb|EFN33344.1| NAD(P)H quinone oxidoreductase, PIG3 family [Sinorhizobium meliloti
           BL225C]
          Length = 333

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/330 (54%), Positives = 235/330 (71%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +  +M +V + G G    M LA  P+P+ +  +ILI+VEA G+NRPDV+QRKG YP P
Sbjct: 1   MTLPTEMTYVDLPGPGGPENMVLARGPLPEVRPGDILIRVEAFGINRPDVLQRKGDYPLP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+PILGLE AG++V LGE  T ++ GD+VCAL NGG YAEYC       L  PKGY+A
Sbjct: 61  AGASPILGLEAAGEVVALGEGATGFSTGDKVCALANGGAYAEYCAVPATQALRWPKGYDA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            +AA+LPE+FFTVWAN+F  A L+SG+T L+HGGSSGIGTTAIQLA  FGA V+ TA + 
Sbjct: 121 AKAAALPETFFTVWANVFDMARLKSGETFLVHGGSSGIGTTAIQLARAFGAEVFATAGNA 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
            KC AC  LGAK AINY +EDF  ++ +ET GRG+D+ILDMVG  Y ++++  L+K+G+L
Sbjct: 181 AKCEACEALGAKRAINYREEDFKAVVLQETGGRGVDVILDMVGGRYFDRNIGSLAKDGRL 240

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II+FLGG      N+ PI+ KR+ + GS LR RT   KQ+IRD L  K+WPLL    +A
Sbjct: 241 SIIAFLGGARVDGANIAPILMKRLQVMGSLLRPRTAAEKQAIRDGLAEKVWPLLEGGDVA 300

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVI  VLP  ++A AH +ME+ +HIGKI++
Sbjct: 301 PVIQAVLPFAEIAGAHRLMEEGDHIGKIVM 330


>gi|15964706|ref|NP_385059.1| putative oxidoreductase protein [Sinorhizobium meliloti 1021]
 gi|15073884|emb|CAC45525.1| Putative quinone oxidoreductase [Sinorhizobium meliloti 1021]
          Length = 327

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 232/324 (71%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M +V + G G    M LA  P+P+ +  +ILI+VEA G+NRPDV+QRKG YP P  A+PI
Sbjct: 1   MTYVDLPGPGGPENMVLARGPLPEVRPGDILIRVEAFGINRPDVLQRKGDYPLPAGASPI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE AG++V LGE  T ++ GD+VCAL NGG YAEYC       L  PKGY+A +AA+L
Sbjct: 61  LGLEAAGEVVALGEGATGFSTGDKVCALANGGAYAEYCAVPATQALRWPKGYDAAKAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWAN+F  A L+SG+T L+HGGSSGIGTTAIQLA  FGA V+ TA +  KC AC
Sbjct: 121 PETFFTVWANVFDMARLKSGETFLVHGGSSGIGTTAIQLARAFGAEVFATAGNAAKCEAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGAK AINY +EDF  ++ +ET GRG+D+ILDMVG  Y ++++  L+K+G+L II+FL
Sbjct: 181 EALGAKRAINYREEDFKAVVLQETGGRGVDVILDMVGGRYFDRNIGSLAKDGRLSIIAFL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG      N+ PI+ KR+ + GS LR RT   KQ+IRD L  K+WPLL    +APVI  V
Sbjct: 241 GGARVDGANIAPILMKRLQVMGSLLRPRTAAEKQAIRDGLAEKVWPLLEGGDVAPVIQAV 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LP  ++A AH +ME+ +HIGKI++
Sbjct: 301 LPFAEIAGAHRLMEEGDHIGKIVM 324


>gi|150395792|ref|YP_001326259.1| quinone oxidoreductase putative PIG3 [Sinorhizobium medicae WSM419]
 gi|150027307|gb|ABR59424.1| Quinone oxidoreductase putative PIG3 [Sinorhizobium medicae WSM419]
          Length = 333

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 232/330 (70%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +  +M +V + G G    M LA   +P+ +  +IL++VEA G+NRPDV+QRKG YP P
Sbjct: 1   MTLPTEMTYVDLPGPGGPENMVLARGAMPEVRTGDILVRVEAFGINRPDVLQRKGDYPLP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+PILGLEVAG++V LG   + ++IGD VCAL NGG YAEYC       L  PKGY+A
Sbjct: 61  AGASPILGLEVAGEVVALGHGASGFSIGDRVCALANGGAYAEYCAVPATQALLWPKGYDA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AA+LPE+FFTVWAN+F  A L+SG+T L+HGGSSGIGTTAIQLA   GA V+ TA S 
Sbjct: 121 VKAAALPETFFTVWANVFDMAGLKSGETFLVHGGSSGIGTTAIQLAKALGAEVFATAGSA 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
            KC AC  LGAK AINY +EDF  ++ +ET GRG D+ILDMVG  Y  +++  L+K+G+L
Sbjct: 181 AKCKACEALGAKRAINYREEDFRAVVLEETGGRGADVILDMVGGPYFERNIGSLAKDGRL 240

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
            II+FLGG      N+ PI+ KR+ I GS LR RT   KQ+IRD L  ++WPLL    +A
Sbjct: 241 SIIAFLGGARVEGGNIAPILMKRLRIMGSLLRPRTAAEKQAIRDGLAARVWPLLEGGEVA 300

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PV+  VLP  +++ AH +ME+ +HIGKI++
Sbjct: 301 PVVQAVLPFEEISDAHRLMEQGDHIGKIVM 330


>gi|296536057|ref|ZP_06898194.1| possible NADPH:quinone reductase [Roseomonas cervicalis ATCC 49957]
 gi|296263618|gb|EFH10106.1| possible NADPH:quinone reductase [Roseomonas cervicalis ATCC 49957]
          Length = 337

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 174/326 (53%), Positives = 236/326 (72%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           ++M  +A    G   V+     P+P P+++E+LI+V A GVNRPDV QRKGLYPPP  A+
Sbjct: 6   QQMTLIAHGQGGGPEVLVPQTGPLPAPREDEVLIRVMAAGVNRPDVQQRKGLYPPPPGAS 65

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           P++GLEVAG++V  G   T W +GD VCAL NGGGYAEYC + +  TLP P G++A++AA
Sbjct: 66  PVIGLEVAGEVVAAGAAVTRWKVGDRVCALTNGGGYAEYCTAPEAQTLPWPAGFDALRAA 125

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           +LPE++FTVWANLF    L +G+TVLIHGG+SGIG TAIQLA  FGA V  TA S  KC 
Sbjct: 126 ALPETYFTVWANLFGHGRLAAGETVLIHGGTSGIGVTAIQLAKAFGARVLATAGSAAKCE 185

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           A LKLGA  AI+Y  +DF+E +++ T GRG+D++LDMVGA+Y  ++L  ++K+G+L+II+
Sbjct: 186 AMLKLGADAAIDYKAQDFVEEVKRLTDGRGVDVLLDMVGADYFQRNLRCMAKDGRLVIIA 245

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FL G+ A +++L PI+ KR+T+TGST+R RT   K +I   L+ ++WPLL      PVIH
Sbjct: 246 FLSGHEAEKVDLRPIMVKRLTVTGSTMRPRTTAEKGAIAAELEARVWPLLARGEAGPVIH 305

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +V P  + A AH +ME S HIGKI+L
Sbjct: 306 SVFPFARAAEAHALMESSTHIGKIML 331


>gi|154252539|ref|YP_001413363.1| quinone oxidoreductase putative PIG3 [Parvibaculum lavamentivorans
           DS-1]
 gi|154156489|gb|ABS63706.1| Quinone oxidoreductase putative PIG3 [Parvibaculum lavamentivorans
           DS-1]
          Length = 332

 Score =  362 bits (930), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 169/326 (51%), Positives = 232/326 (71%), Gaps = 1/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           K M+ +A+   G   V+ L E   P+P   EILIKV A G+NRPD +QR GLYP P  + 
Sbjct: 6   KTMKAIAIREPGGPEVLELREIATPEPGHGEILIKVAAAGINRPDTIQRMGLYPAPPGSP 65

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
              GLEVAG++V  G   T W  GD+VCALV GGGYAEYCL+H+ H LP+P+G+   +AA
Sbjct: 66  ETPGLEVAGEVVATGPGVTMWKAGDKVCALVGGGGYAEYCLAHEAHALPVPQGFTMTEAA 125

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           +LPE+FFTVW N+F+   L+ G+T+L+HGGSSGIGTTAIQLAS FG+TV  TA S EKC 
Sbjct: 126 ALPETFFTVWTNVFERGALKPGETLLVHGGSSGIGTTAIQLASLFGSTVIATAGSAEKCA 185

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC KLGA  A+NY ++DF+   ++ T GRG+D+ILDMVG +Y+ +++   + +G+++ I+
Sbjct: 186 ACEKLGAHAAVNYREQDFVAEAKRLTDGRGVDVILDMVGGDYIARNIQACATDGRIVSIA 245

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FL G+ A E+N  P++ KR+T+TGSTLR R+   K ++  +L+ K+WPLL++  + P I 
Sbjct: 246 FLNGSTA-EVNFMPVMLKRLTLTGSTLRPRSIEEKAALASALKTKVWPLLDAGRVKPQID 304

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +V PL   A AH +MEKS HIGKI+L
Sbjct: 305 SVFPLADAAKAHALMEKSSHIGKIVL 330


>gi|148261849|ref|YP_001235976.1| alcohol dehydrogenase [Acidiphilium cryptum JF-5]
 gi|326405354|ref|YP_004285436.1| putative oxidoreductase [Acidiphilium multivorum AIU301]
 gi|146403530|gb|ABQ32057.1| Alcohol dehydrogenase, zinc-binding domain protein [Acidiphilium
           cryptum JF-5]
 gi|325052216|dbj|BAJ82554.1| putative oxidoreductase [Acidiphilium multivorum AIU301]
          Length = 333

 Score =  356 bits (913), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 171/330 (51%), Positives = 222/330 (67%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   M+HV     G   VM +   P+P+P+ +E+LI+VEA GVNRPDV QRKG YPPP
Sbjct: 1   MSLPDSMKHVTFDRPGGPEVMHVVTGPVPEPRDDEVLIRVEAAGVNRPDVQQRKGAYPPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+PILGLE AG +V  G    +W +GD V AL NGG YAEY        LP P G+ A
Sbjct: 61  PGASPILGLEAAGTVVACGAAVHNWRMGDRVTALCNGGAYAEYVAVPAAQCLPWPAGFGA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           I+AASLPE++FTVWANLF    L  G +VL+HGG+SGIG  A+Q+A   GA+VY TA S 
Sbjct: 121 IEAASLPETYFTVWANLFDLGRLAPGDSVLVHGGTSGIGVAALQMAHAHGASVYATAGSA 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
            KC ACL+LGA  AINY ++DFL  ++  T G G+D++LDMVGA Y  Q+L  L + G+L
Sbjct: 181 AKCNACLELGATAAINYREQDFLHEIKALTAGNGVDVVLDMVGAPYTQQNLRALRRGGRL 240

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           I I+F+GG+IA+ ++L PI+  R+T+TGST+R R+   K  I  +L+ + WP L S  I 
Sbjct: 241 IQIAFMGGSIASNLDLLPIMINRLTVTGSTMRPRSTAEKGGIAAALRERAWPWLESGKIR 300

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVI   +P G V  AH +ME+S HIGKIIL
Sbjct: 301 PVIAEAMPWGDVVRAHRLMEESGHIGKIIL 330


>gi|110635734|ref|YP_675942.1| zinc-binding alcohol dehydrogenase [Mesorhizobium sp. BNC1]
 gi|110286718|gb|ABG64777.1| Alcohol dehydrogenase, zinc-binding protein [Chelativorans sp.
           BNC1]
          Length = 335

 Score =  348 bits (892), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 167/328 (50%), Positives = 230/328 (70%), Gaps = 1/328 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I  KM  VA++ +G   V+   E P+P+P   EILIKV A GVNRPDV QRKG+YPPP  
Sbjct: 6   IPDKMTAVAITEHGGPMVLKPEERPVPKPGSGEILIKVRAAGVNRPDVAQRKGVYPPPPG 65

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLEV+G +   GE    W++GDEV AL  GGGYAE+C+ H+ + LPIP G+   +
Sbjct: 66  ASDLPGLEVSGIVAATGEGVERWHVGDEVTALTPGGGYAEFCVVHETNALPIPHGFTFTE 125

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA+LPE+FFTVW N+F+   L++G+T+L+HGG+SGIGTTAIQ+AS FGA V  TA S EK
Sbjct: 126 AAALPETFFTVWHNVFERGGLKAGETLLVHGGTSGIGTTAIQVASNFGARVIATAGSAEK 185

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C ACLKLGA  A+NY  EDF+  +++ T+GRG D+ILDMVG +Y++++    + +G+++ 
Sbjct: 186 CEACLKLGAARAVNYRAEDFVLAVKEATEGRGADVILDMVGGDYIDRNYAAAAMDGRIVQ 245

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           IS  GG+ A E + + ++ KR+T TGSTLR RT   K  I   L+  +WPLL +  +APV
Sbjct: 246 ISLQGGSKA-EADFSKLMVKRLTHTGSTLRPRTIKFKAHIAAELEAHVWPLLAARKVAPV 304

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           + T+ PL +   AH+ ME+  HIGKI+L
Sbjct: 305 MDTIFPLREAWRAHERMEEGAHIGKIVL 332


>gi|288958577|ref|YP_003448918.1| quinone oxidoreductase [Azospirillum sp. B510]
 gi|288910885|dbj|BAI72374.1| quinone oxidoreductase [Azospirillum sp. B510]
          Length = 342

 Score =  346 bits (888), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 162/326 (49%), Positives = 226/326 (69%), Gaps = 1/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
            +MR V ++  G   V+     P+PQP   EIL+KV A GVNRPD +QR+G Y PP  A+
Sbjct: 11  SQMRCVEITQPGGPEVLRPTNRPVPQPGPGEILVKVAAAGVNRPDTLQRQGRYDPPPGAS 70

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            + GLE++G++V +G+    W  GD VCALV GGGYAEYC+      LPIP   + I+AA
Sbjct: 71  DLPGLELSGRVVAIGDGVQDWAAGDTVCALVAGGGYAEYCVVPAVQALPIPGALSMIEAA 130

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           ++PE+FFTVW N+F+   L+ G+T+LIHGGSSGIGTTAIQLA  FGATV+TTA S++KC 
Sbjct: 131 AVPETFFTVWTNVFERGALKRGETLLIHGGSSGIGTTAIQLAKAFGATVFTTAGSDDKCR 190

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC  LGA  AINY  EDF+ ++++ T GRG+D++LDMVG +Y+ + + +++ +G+ + I+
Sbjct: 191 ACEDLGADRAINYRSEDFVAVIREATGGRGVDVVLDMVGGDYIARDIDIMAVDGRHVSIA 250

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FL G     +N+ P+++KR+T+TGSTLR R    K  I  +L+ ++WPLL +  I P IH
Sbjct: 251 FLQGA-KVSLNMAPMMTKRLTLTGSTLRARPVAEKGRIAAALREQVWPLLEAGGIKPRIH 309

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
            V PL +   AH +ME S HIGKI+L
Sbjct: 310 GVFPLERADEAHRLMESSAHIGKIVL 335


>gi|298293013|ref|YP_003694952.1| NAD(P)H quinone oxidoreductase, PIG3 family [Starkeya novella DSM
           506]
 gi|296929524|gb|ADH90333.1| NAD(P)H quinone oxidoreductase, PIG3 family [Starkeya novella DSM
           506]
          Length = 332

 Score =  345 bits (885), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 163/324 (50%), Positives = 225/324 (69%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +   + P+PQP   EIL+KV A GVNRPDVMQRKGLYPPP  A+ I
Sbjct: 8   MTAIGLPTPGGPEALVPEQRPVPQPGAGEILVKVAAAGVNRPDVMQRKGLYPPPPGASDI 67

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG++V LG   T W +GD+VCALV+GGGYA+YCL+ +G  LP+P G + ++AA+L
Sbjct: 68  PGLEIAGEVVALGAGVTRWQVGDKVCALVSGGGYAQYCLADEGAALPVPAGLSMVEAAAL 127

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW N+F  A L+SG++ L+HGG+SGIGTTAIQLA  FGATV+TTA S EKC  C
Sbjct: 128 PETFFTVWTNVFDLAGLKSGESFLVHGGTSGIGTTAIQLAKAFGATVFTTAGSAEKCEVC 187

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            KLGA  AI+Y  EDF+ ++ KE  G+G+++ILDMVG  Y+ ++    + +G+++ I+F+
Sbjct: 188 RKLGADVAIDYKAEDFVAVI-KEKTGKGVNVILDMVGGSYIARNYEAAAPQGRIVQIAFM 246

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G+   +I+   ++ KR++  GSTLR R    K  I  SL+ K+WPL+ +  + PV+   
Sbjct: 247 EGS-KVQIDYMRLMLKRLSHMGSTLRSRPKAEKAVIAASLREKVWPLIEAGKVKPVLDQT 305

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL K + AH  ME S HIGKI+L
Sbjct: 306 FPLEKASEAHARMETSAHIGKIML 329


>gi|220920508|ref|YP_002495809.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylobacterium
           nodulans ORS 2060]
 gi|219945114|gb|ACL55506.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylobacterium
           nodulans ORS 2060]
          Length = 335

 Score =  342 bits (878), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 164/324 (50%), Positives = 219/324 (67%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V  +G G   V+ +  +P+P+P   ++LI+V A GVNRPD  QR G YPPP  A  +
Sbjct: 8   MRQVRFNGAGGPEVIGIETAPVPKPGPGQVLIEVVAAGVNRPDCQQRAGKYPPPPGATDV 67

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG+I  LGE  T   +GDEVCALV  GGYAE+CL+     LP P   + I+AA L
Sbjct: 68  PGLEVAGRIAALGEGVTGLAVGDEVCALVISGGYAEFCLAEAPLCLPKPGPLSLIEAAGL 127

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+++TVW N+F+   L+ G+  L+HGGSSGIG TAIQLA +FGATVY TA S +KC  C
Sbjct: 128 PENYYTVWTNVFERGRLQKGERFLVHGGSSGIGYTAIQLAKHFGATVYATAGSADKCAFC 187

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            ++GA  AINY + DF E +++ T G+G+D+ILDMVGA YL ++L  L+ EG+L++I+FL
Sbjct: 188 ERMGADVAINYRETDFAEEVKRLTDGKGVDVILDMVGASYLERNLKSLALEGRLVVIAFL 247

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G      N+ PI+ KR+T TGSTLR RT   K +I + L+ ++WPLL S  +  VIH  
Sbjct: 248 QGFKVESFNMTPIMVKRLTFTGSTLRPRTTAQKAAIAEGLRREVWPLLESGALKAVIHAT 307

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL +   AH +ME S H+GKI+L
Sbjct: 308 FPLEQAREAHALMESSAHLGKIML 331


>gi|330990995|ref|ZP_08314949.1| Quinone oxidoreductase PIG3 [Gluconacetobacter sp. SXCC-1]
 gi|329761816|gb|EGG78306.1| Quinone oxidoreductase PIG3 [Gluconacetobacter sp. SXCC-1]
          Length = 355

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 219/331 (66%), Gaps = 3/331 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I   M+ +  S  G  + + +   P+P+P   E+L++V A G+NRPD+MQRKGLYPPP  
Sbjct: 14  IPDTMQAITYSEDGTPDSLRVTALPVPRPGAGEVLVRVMAAGINRPDIMQRKGLYPPPPG 73

Query: 63  ANPILGLEVAGKIVDLGEN---TTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYN 119
           A+P+LGLEVAG++V +G +         G  VCAL NGGGYA+YC    G  LP P G++
Sbjct: 74  ASPLLGLEVAGEVVAMGTDLPANAFPAPGARVCALTNGGGYAQYCTVPAGQCLPWPTGFD 133

Query: 120 AIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKS 179
           AI AASLPE+FFTVW+NLF TA L+ G++VL+HGG+SGIGTTAIQL    G TVY TA +
Sbjct: 134 AIHAASLPETFFTVWSNLFMTAGLKPGESVLVHGGTSGIGTTAIQLVRAMGGTVYATAGT 193

Query: 180 EEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGK 239
            EKC  C  LGAK AINY  EDF + ++  T G G+++ILDM+G  YL+ +L  L+  G+
Sbjct: 194 AEKCALCTTLGAKAAINYRTEDFPQRIRDLTGGAGVNVILDMIGGAYLDGNLRALATAGR 253

Query: 240 LIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVI 299
           L+II+  GG  A  +NL  I+++R+ +TG+TLR R    K  I   L+  +WPLL    I
Sbjct: 254 LVIIALQGGAKADGVNLARIMTRRLVVTGTTLRPRDAAYKAEIARQLEDHVWPLLGRRAI 313

Query: 300 APVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            P+IH   P  +VA AH +ME   H+GKI+L
Sbjct: 314 RPLIHATFPFARVADAHKLMENGTHMGKIML 344


>gi|82702500|ref|YP_412066.1| zinc-containing alcohol dehydrogenase superfamily protein
           [Nitrosospira multiformis ATCC 25196]
 gi|82410565|gb|ABB74674.1| Zinc-containing alcohol dehydrogenase superfamily [Nitrosospira
           multiformis ATCC 25196]
          Length = 331

 Score =  339 bits (870), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 219/316 (69%), Gaps = 1/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+  A  P+PQP   EILIKV  +GVNRPD++QR+GLYPPP  A+ I GLEVAG+I
Sbjct: 10  GGPEVLRPAFHPVPQPGPGEILIKVATVGVNRPDILQRRGLYPPPPGASEIPGLEVAGEI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V+ GE T  +  G++VCALV GGGYAEYC  H+ + LPIP G   I+AA+LPE+FFTVW 
Sbjct: 70  VESGEGTIRFRPGEKVCALVAGGGYAEYCAVHESNALPIPSGLGMIEAAALPETFFTVWT 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ   L+SG+TVLIHGG+SGIGTTA  LA  FGA V TTA SEEKC AC+ LGA  AI
Sbjct: 130 NLFQRGKLKSGETVLIHGGTSGIGTTATMLAKAFGALVLTTAGSEEKCRACVALGADFAI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY  +DF+E ++K T G+G+D+ILD+V  +Y+ ++    +  G+++ +    G  A E+N
Sbjct: 190 NYRTQDFVEEVRKFTDGKGVDVILDVVAGDYVARNYKAAALNGRILQVGIQNGP-AMELN 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L P+++KR+T TGSTLR RT   K  I   L+ ++WPLL+   I P I     L + A A
Sbjct: 249 LMPMLAKRLTHTGSTLRSRTVPEKAQIAQELEQQVWPLLHEGKIKPQIFKTFRLEEAAEA 308

Query: 316 HDIMEKSEHIGKIILL 331
           H +ME   HIGKI+L+
Sbjct: 309 HVLMESGAHIGKIVLM 324


>gi|209543649|ref|YP_002275878.1| NAD(P)H quinone oxidoreductase, PIG3 family [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531326|gb|ACI51263.1| NAD(P)H quinone oxidoreductase, PIG3 family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 342

 Score =  339 bits (870), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 162/325 (49%), Positives = 218/325 (67%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V +   G  + M LA+ P+P P   E+L++V A GVNRPD+MQR+GLYPPP  A+PI
Sbjct: 14  MRAVVVRDPGPPDAMELADLPLPLPGPGEVLVRVMAAGVNRPDIMQRQGLYPPPPGASPI 73

Query: 67  LGLEVAGKIVDLGENTTHW-NIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           LGLE+AG++V  G     W   G  VCAL NGGGYAEYC    G  LP P+GY+AI+AA+
Sbjct: 74  LGLEIAGEVV-AGRPDGSWPATGTRVCALTNGGGYAEYCAVPAGQCLPWPEGYDAIRAAA 132

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+FFT W+NL  TA+L +G++VLIHGGS GIGT AIQ     GA  Y T  S EK   
Sbjct: 133 LPETFFTAWSNLAMTAHLAAGESVLIHGGSGGIGTAAIQTTRALGAIPYVTVGSAEKAAL 192

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C++LGA+ AI+Y  EDF+  +   T GRG+D++LD++G  YL+++L  L+ +G+L+II+ 
Sbjct: 193 CVRLGAEAAIDYRSEDFVARIGTLTGGRGVDVVLDVIGGPYLDRNLRCLAPDGRLVIIAL 252

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
            GG  A ++ +  I+++R+T+TG+TLR R    K  + D L+  IWP L    IAPVIH 
Sbjct: 253 QGGAKAQDVGVARIMTRRLTVTGTTLRPRDTAYKAQVADGLRRTIWPGLADGTIAPVIHA 312

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             P  +VA AH +ME   H GKI+L
Sbjct: 313 TFPFARVAEAHKLMESGAHSGKIVL 337


>gi|144898124|emb|CAM74988.1| Zinc-containing alcohol dehydrogenase superfamily [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 330

 Score =  338 bits (868), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 228/326 (69%), Gaps = 1/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + M  + ++  G ++V+  A+ P+P+P K ++LIKV A G+NRPDV+QR+G YP P  A+
Sbjct: 4   ETMTCIEITTPGDAHVLKPAQRPLPRPAKGQVLIKVAAAGINRPDVLQRQGAYPAPPGAS 63

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            + GLEV+G +  LGE    W +GD VCAL  GGGYA++  +   H LPIP     + AA
Sbjct: 64  DLPGLEVSGTVAGLGEGVDQWRLGDSVCALTAGGGYAQFVTADARHCLPIPDDLEFVAAA 123

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           +LPE+ FTVW N+F+   L++G+  L+HGG SGIGTTAIQLA   GATV+ TA  + KC 
Sbjct: 124 ALPETLFTVWHNVFERGGLKAGEKFLVHGGGSGIGTTAIQLAKALGATVFATAGGKAKCE 183

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC+KLGA   I+Y  EDF+E+++ ET G+G+D+ILDMVG +YL +++  L  +G+L+ I+
Sbjct: 184 ACVKLGADRVIDYQTEDFVEVIKAETGGKGVDVILDMVGGDYLPRNVKCLGFDGRLVNIA 243

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FL G +A E+N+ P++ KR+T+TGSTLR ++D AK  + + L+  + PL+ +  + P+IH
Sbjct: 244 FLKGPVA-EMNMMPVMLKRLTLTGSTLRPQSDAAKARMAEGLKTTVLPLVAAGRVRPLIH 302

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
            V PL + A AH++ME + H+GKI+L
Sbjct: 303 AVFPLDQAAQAHELMESNTHVGKIVL 328


>gi|288960092|ref|YP_003450432.1| zinc-containing alcohol dehydrogenase [Azospirillum sp. B510]
 gi|288912400|dbj|BAI73888.1| zinc-containing alcohol dehydrogenase [Azospirillum sp. B510]
          Length = 332

 Score =  338 bits (866), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 152/326 (46%), Positives = 223/326 (68%), Gaps = 1/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + M  + +S  GK  V+  A  P+P P   EI I VEA GVNRPDV+QR G Y PP    
Sbjct: 5   RTMMAIEVSQPGKPEVLIPARRPVPDPAPGEIRIAVEAAGVNRPDVLQRLGKYNPPPGIT 64

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            I GLEVAG I  LG+    W++GD VCAL+ GGGYAE+C+      LPIP G +  +AA
Sbjct: 65  DIPGLEVAGTIDALGDGVEGWSVGDAVCALLAGGGYAEFCVVPAAQCLPIPAGLSMAEAA 124

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           +LPE+FFTVW+N+F+   L+ G+ +L+HGG+SGIGTTAIQL + FGA V+ TA+  EKC 
Sbjct: 125 ALPETFFTVWSNVFERGALQPGEALLVHGGTSGIGTTAIQLGAAFGARVFATARGAEKCA 184

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           ACL+LGA+ AI+Y ++DF+ ++++ T G G++++LD+VG +Y+ + +  L+ EG+ + I 
Sbjct: 185 ACLRLGAERAIDYAEDDFVAVVKEATGGAGVNVVLDIVGGDYVARSIDALAVEGRYVCIG 244

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           F+ G  A  +N  P+++KR+ +TGSTLR R    K+++ D L+ ++WPL+    + PV+H
Sbjct: 245 FVRGATAN-VNFFPVMTKRLVLTGSTLRARPIAYKRAVADQLKARVWPLIAEGKVRPVVH 303

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
            V PL   A AH +ME ++H+GK++L
Sbjct: 304 EVFPLANAADAHRLMESNQHVGKLVL 329


>gi|317404160|gb|EFV84605.1| zinc-containing alcohol dehydrogenase superfamily protein
           [Achromobacter xylosoxidans C54]
          Length = 331

 Score =  338 bits (866), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 161/315 (51%), Positives = 222/315 (70%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  + + LAE  +  P   ++LI+V   GVNRPDV+QR G YPPP  A+P LGLEVAG I
Sbjct: 14  GAPDCLRLAEREMAAPAGRQVLIEVVYAGVNRPDVLQRSGSYPPPPGASPYLGLEVAGTI 73

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V +G + T W +GD VCAL  GGGYA+YCL+ + H LP+P+G + + AA++PE++FTVW 
Sbjct: 74  VAVGPDATRWQVGDRVCALTPGGGYAQYCLADERHCLPVPRGLDLLSAAAIPENYFTVWT 133

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+ A L +G+  L+HGGSSGIG TAIQLA  FGA V+TT  ++EK  ACLK GA HA+
Sbjct: 134 NVFERARLAAGEKFLVHGGSSGIGLTAIQLARAFGAEVWTTVGNQEKAEACLKAGAHHAV 193

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
            Y   DF   +++ T G+G+D+ILDMVG  Y+N+++ LL+  G+L+ I+FL G+ A EI+
Sbjct: 194 LYRDTDFEADIRQATGGQGVDVILDMVGGAYINKNIRLLAVNGRLVQIAFLEGSKA-EID 252

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
             PI++KR++ TGSTLR R+D  K +I  +L  K+ PL+      P+IH V PL + A A
Sbjct: 253 ALPIMTKRLSFTGSTLRPRSDEDKGAIAQALADKVLPLMEQGRCLPLIHQVFPLEQAAQA 312

Query: 316 HDIMEKSEHIGKIIL 330
           H +ME S+HIGKI+L
Sbjct: 313 HALMESSKHIGKIML 327


>gi|162146348|ref|YP_001600807.1| quinone oxidoreductase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161784923|emb|CAP54466.1| Quinone oxidoreductase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 329

 Score =  337 bits (865), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 161/325 (49%), Positives = 219/325 (67%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V +   G  + M LA+ P+P+P   E+L++V A GVNRPD+MQR+GLYPPP  A+PI
Sbjct: 1   MRAVVVRDPGPPDAMELADLPLPRPGPGEVLVRVMAAGVNRPDIMQRQGLYPPPPGASPI 60

Query: 67  LGLEVAGKIVDLGENTTHW-NIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           LGLE+AG++V  G     W   G  VCAL NGGGYAEYC    G  LP P+GY+AI+AA+
Sbjct: 61  LGLEIAGEVV-AGRPDGSWPATGTRVCALTNGGGYAEYCAVPAGQCLPWPEGYDAIRAAA 119

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+FFT W+NL  TA+L +G++VLIHGGS GIGT AIQ A    A  Y T  S EK   
Sbjct: 120 LPETFFTAWSNLAMTAHLAAGESVLIHGGSGGIGTAAIQTARALRAIPYVTVGSAEKAAL 179

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C++LGA+ AI+Y  E+F+  +   T GRG+D++LD++G  YL+++L  L+ +G+L+II+ 
Sbjct: 180 CVRLGAEAAIDYRSENFVARIGTLTGGRGVDVVLDVIGGPYLDRNLRCLAPDGRLVIIAL 239

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
            GG  A ++ +  I+++R+T+TG+TLR R    K  + D L+  IWP L    IAPVIH 
Sbjct: 240 QGGAKAQDVGVARIMTRRLTVTGTTLRPRDTAYKAQVADGLRRTIWPGLADGTIAPVIHA 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             P  +VA AH +ME   H GKI+L
Sbjct: 300 TFPFARVAEAHKLMESGAHSGKIVL 324


>gi|149201306|ref|ZP_01878281.1| alcohol dehydrogenase, zinc-containing [Roseovarius sp. TM1035]
 gi|149145639|gb|EDM33665.1| alcohol dehydrogenase, zinc-containing [Roseovarius sp. TM1035]
          Length = 327

 Score =  337 bits (865), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 170/328 (51%), Positives = 227/328 (69%), Gaps = 4/328 (1%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + K M+ V ++  G   V+ L   PIP P+  E++I++   GVNRPD +QR GLY PP  
Sbjct: 1   MTKTMQAVEITQAGGPEVLQLTTRPIPAPRAGEVVIRLAYAGVNRPDALQRAGLYAPPPT 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE AG+IV LG   THW +GD+VCAL+ GGGYAEY  +   H LP+P G +  Q
Sbjct: 61  ASDLPGLEGAGEIVALGAGVTHWTLGDQVCALLPGGGYAEYVATPAAHCLPVPHGLSLEQ 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA LPE+FFTVW+N+FQ   L+ G+  L+HGGSSGIGTTAIQLA  FGA V+TTA S EK
Sbjct: 121 AACLPETFFTVWSNVFQRGALKGGERFLVHGGSSGIGTTAIQLAHTFGARVFTTAGSAEK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C  C+ LGA+ AINY +EDF E+L  E    G D+ILDMVG +YL +++  L+ +G+L+ 
Sbjct: 181 CQVCMDLGAERAINYREEDFTEVLSAEG---GADLILDMVGGDYLPRNVKALADDGRLVQ 237

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+FL G    E+N + ++ +R+TITGSTLR ++D+AK  I +SL+  +WPLL +  IAPV
Sbjct: 238 IAFLQGP-KIELNFSQVMMRRLTITGSTLRPQSDLAKARIAESLRTHVWPLLEAGKIAPV 296

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           + +  PL K A AH  ME S HIGKI+L
Sbjct: 297 MDSEYPLAKAAAAHARMESSGHIGKIVL 324


>gi|83592392|ref|YP_426144.1| zinc-containing alcohol dehydrogenase superfamily protein
           [Rhodospirillum rubrum ATCC 11170]
 gi|83575306|gb|ABC21857.1| Zinc-containing alcohol dehydrogenase superfamily [Rhodospirillum
           rubrum ATCC 11170]
          Length = 334

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 226/330 (68%), Gaps = 2/330 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           P+  +MR V ++G G   V+ +A  P+P P   E+LI V A GVNRPDV QR+G YPPP 
Sbjct: 4   PLPDQMRCVEIAGAGGPEVLKMAARPLPVPGDGEVLIAVAAAGVNRPDVFQRQGSYPPPP 63

Query: 62  NANPILGLEVAGKIVDLGENTTH-WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
            A+ + GLEVAG IV +G      W IGD VCAL++GGGYA+Y  +     +P+P+    
Sbjct: 64  GASDLPGLEVAGTIVAIGAKAGEGWRIGDRVCALLSGGGYAQYASADAALCMPVPQTLGL 123

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            +AA+LPE+FFTVW NLFQ A L+ G+++L+HGGSSGIGTTAIQ+A  FG TVY TA + 
Sbjct: 124 DEAAALPETFFTVWHNLFQRARLQEGESLLVHGGSSGIGTTAIQMAKAFGVTVYVTAGTP 183

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC  LGA  AINY  ED+  ++++ T GRG+D++LDMVG +Y+++ L +L+++G+ 
Sbjct: 184 EKCAACEALGADRAINYRTEDYPTVIKELTGGRGVDVVLDMVGGDYIDRDLRILAEDGRH 243

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+FL G+  T ++L  ++ KR+T+TGSTLR R    K  I  +L+ K+WPLL    + 
Sbjct: 244 VNIAFLQGSKVT-VDLMRMMLKRLTLTGSTLRSRPATVKAGIARALEEKVWPLLEQGKLR 302

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P IH    L   A AH +ME+S+HIGKI+L
Sbjct: 303 PPIHARFALEDAAEAHRLMERSDHIGKIVL 332


>gi|85706118|ref|ZP_01037213.1| alcohol dehydrogenase, zinc-containing [Roseovarius sp. 217]
 gi|85669282|gb|EAQ24148.1| alcohol dehydrogenase, zinc-containing [Roseovarius sp. 217]
          Length = 327

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 225/328 (68%), Gaps = 4/328 (1%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + K M+ V ++  G   V+     PIP P+  E++I++   GVNRPD +QR GLY PP  
Sbjct: 1   MTKTMQAVEITQAGGPEVLQPTTRPIPTPRAGEVVIRLAYAGVNRPDALQRAGLYAPPPT 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE AG+IV LG   + W +GD+VCAL+ GGGYA+Y  +   H LP+P G +  Q
Sbjct: 61  ASDLPGLEGAGEIVALGAGVSDWALGDQVCALLPGGGYADYVATPAAHCLPVPHGLSLKQ 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA LPE+FFTVW+N+FQ   LR+G+  L+HGGSSGIGTTAIQLA  FGA V+TTA S EK
Sbjct: 121 AACLPETFFTVWSNVFQRGGLRAGERFLVHGGSSGIGTTAIQLAHTFGARVFTTAGSAEK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C  C +LGA+ AINY  EDF E+L  E    G D+ILDMVG +YL +++  L+ +G+L+ 
Sbjct: 181 CRVCEELGAERAINYHDEDFTEVLSAEG---GADLILDMVGGDYLPRNVKALADDGRLVQ 237

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+FL G    E+N + ++ +R+TITGSTLR ++D+AK  I ++L+  +WPLL +  IAPV
Sbjct: 238 IAFLQGP-KIELNFSQVMMRRLTITGSTLRPQSDLAKARIAEALRAHVWPLLEAGRIAPV 296

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           + +  PL + A AH  ME S HIGKI+L
Sbjct: 297 MDSEFPLTEAAAAHARMESSGHIGKIVL 324


>gi|120609947|ref|YP_969625.1| alcohol dehydrogenase [Acidovorax citrulli AAC00-1]
 gi|120588411|gb|ABM31851.1| Alcohol dehydrogenase, zinc-binding domain protein [Acidovorax
           citrulli AAC00-1]
          Length = 334

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 156/332 (46%), Positives = 230/332 (69%), Gaps = 6/332 (1%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           +   MR V ++G G   V+ LAE P+P+P   E+LI+V A G+NRPDV+QRKG Y PP  
Sbjct: 1   MATTMRAVEIAGSGGPEVLRLAERPVPRPGVGELLIRVAASGINRPDVLQRKGHYAPPPG 60

Query: 63  ANPILGLEVAGKIVDLGENTTH----WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGY 118
           A+ + GLEVAG I + G+ +        +GD VCALV GGGYAE+C++     LP+P+G+
Sbjct: 61  ASDLPGLEVAGTIAE-GDGSAMAAAGLKVGDRVCALVAGGGYAEWCVAPVAQCLPVPEGW 119

Query: 119 NAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK 178
           + ++AASLPE+FFTVW+N+F    L +G+T+L+ GGSSGIG TAIQL   FGATV  TA 
Sbjct: 120 SDVEAASLPETFFTVWSNVFDRGRLAAGETLLVQGGSSGIGVTAIQLGRAFGATVIVTAG 179

Query: 179 SEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEG 238
           S+EKC  CL+LGA HAINY  +DF+   ++ T GRG+D++LDMV  +Y+ + +  L+++G
Sbjct: 180 SDEKCRTCLELGAHHAINYKTQDFVAEARRITDGRGVDVVLDMVAGDYVAREVECLAEDG 239

Query: 239 KLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHV 298
           +L+II+  GG + +  +   ++ +R+T+TGSTLR R+   K +I  +L+ ++WPLL +  
Sbjct: 240 RLVIIAVQGG-VQSSFDAGLVLRRRLTVTGSTLRPRSVAFKGAIAAALRERVWPLLVART 298

Query: 299 IAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           + PV+H+  P  + + AH +ME S+H GKI+L
Sbjct: 299 VRPVVHSTFPAAEASRAHALMESSQHAGKIVL 330


>gi|118588363|ref|ZP_01545772.1| putative NADPH quinone oxidoreductase [Stappia aggregata IAM 12614]
 gi|118439069|gb|EAV45701.1| putative NADPH quinone oxidoreductase [Stappia aggregata IAM 12614]
          Length = 334

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 168/325 (51%), Positives = 230/325 (70%), Gaps = 1/325 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           +M  VA+S  G+ +V+   E  IP+  + EILIKV A GVNRPDV+QRKG YPPPK A+ 
Sbjct: 7   RMTAVAISEPGEPDVLRAEERSIPELGQGEILIKVAAAGVNRPDVLQRKGAYPPPKGASD 66

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           + GLEV+G++V LGE  T   IGD+V AL  GGGYA YC + +GH LP+PKG++ ++AA+
Sbjct: 67  LPGLEVSGEVVALGEGATRHKIGDKVMALTPGGGYATYCKAPEGHALPVPKGFSMVEAAA 126

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           +PE+FFTVW N+F    L+SG+  L+HGG+SGIGTTAIQLA  FGA V+TT  S EK  A
Sbjct: 127 VPETFFTVWTNVFDRCGLKSGERFLVHGGTSGIGTTAIQLAKAFGAEVFTTVGSAEKVEA 186

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
             KLGA HAINY +E+F +++ + T G G+++ILDMVG +Y+ ++    + EG++  I+ 
Sbjct: 187 VRKLGADHAINYREEEFEKVILEITGGEGVNVILDMVGGDYVERNWKAAAIEGRICQIAT 246

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           L G IA  +N + ++ KR+T TGSTLR R+D  K +I +SL+ K+ PLL S  +APV+ +
Sbjct: 247 LNG-IAENVNFSRLMVKRLTHTGSTLRPRSDAFKTAIGESLKEKVLPLLESGKVAPVMDS 305

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL + A AH  ME S HIGKI+L
Sbjct: 306 TYPLAEAAEAHRRMEGSGHIGKIVL 330


>gi|149916168|ref|ZP_01904690.1| probable zinc-binding dehydrogenase [Roseobacter sp. AzwK-3b]
 gi|149810023|gb|EDM69872.1| probable zinc-binding dehydrogenase [Roseobacter sp. AzwK-3b]
          Length = 330

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 165/303 (54%), Positives = 213/303 (70%), Gaps = 1/303 (0%)

Query: 28  IPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNI 87
           +P+P   E+LI+V A GVNRPD+ QR+G YPPP     +LGLEVAG+IV  G     ++ 
Sbjct: 26  VPEPAPGEVLIRVAAAGVNRPDLRQRQGGYPPPPGITEVLGLEVAGEIVSCGAGVRRFSH 85

Query: 88  GDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQ 147
           GD+VCALV GGGYAEYC++ +   LP P G  AI+AA++PE+FFTVW NLF+   L  G 
Sbjct: 86  GDKVCALVAGGGYAEYCVAPEEQVLPWPAGLTAIEAAAIPETFFTVWTNLFRIGRLAEGD 145

Query: 148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQ 207
           TVLIHGG+SGIGTTAIQLA  FGATVY TA + EKC AC  LGA  AINY  E F E + 
Sbjct: 146 TVLIHGGASGIGTTAIQLARAFGATVYATAGTGEKCQACRDLGATEAINYKTERFEEEIL 205

Query: 208 KETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITIT 267
           ++T+GRG+D+ILDM+ AEYL ++L  L+  G+L+II+FLGG  A E+N+  +I KR ++ 
Sbjct: 206 RQTEGRGVDVILDMICAEYLERNLASLAVAGRLVIIAFLGGGKA-EVNIEGMIRKRQSLC 264

Query: 268 GSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGK 327
           GSTLR +T   K  I   LQ K+WPLL +  + PVIH+V PL +   AH  +E   H+GK
Sbjct: 265 GSTLRPQTPQEKGLIAADLQRKVWPLLENGTVKPVIHSVHPLDRACDAHAELEAGGHVGK 324

Query: 328 IIL 330
           I+L
Sbjct: 325 IVL 327


>gi|326316096|ref|YP_004233768.1| NAD(P)H quinone oxidoreductase, PIG3 family [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323372932|gb|ADX45201.1| NAD(P)H quinone oxidoreductase, PIG3 family [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 334

 Score =  336 bits (862), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 156/328 (47%), Positives = 227/328 (69%), Gaps = 6/328 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++G G   V+ LAE P+P+P   E+LI+V A G+NRPDV+QRKG Y PP  A+ +
Sbjct: 5   MRAVEIAGSGGPEVLRLAERPVPRPGAGELLIRVAASGINRPDVLQRKGHYAPPPGASDL 64

Query: 67  LGLEVAGKIVDLGEN----TTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG I + G+           GD VCALV GGGYAE+C++     LP+P+G++ ++
Sbjct: 65  PGLEVAGTIAE-GDGPAMAAAGLKAGDRVCALVAGGGYAEWCVAPVAQCLPVPEGWSDVE 123

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AASLPE+FFTVW+N+F    L +G+T+L+ GGSSGIG TAIQL   FGATV  TA S+EK
Sbjct: 124 AASLPETFFTVWSNVFDRGRLAAGETLLVQGGSSGIGVTAIQLGRAFGATVIVTAGSDEK 183

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C  CL+LGA HAINY  +DF+   ++ T GRG+D++LDMV  +Y+ + +  L+++G+L+I
Sbjct: 184 CRTCLELGAHHAINYKTQDFVAEARRITDGRGVDVVLDMVAGDYVAREVECLAEDGRLVI 243

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+  GG + +  +   ++ +R+T+TGSTLR R+   K +I  +L+ ++WPLL +  + PV
Sbjct: 244 IAVQGG-VKSSFDAGLVLRRRLTVTGSTLRPRSVAFKGAIAAALRERVWPLLAARTVRPV 302

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +H+  P  + + AH +ME S+H GKI+L
Sbjct: 303 VHSTFPAAEASRAHALMESSQHAGKIVL 330


>gi|89056380|ref|YP_511831.1| zinc-binding alcohol dehydrogenase [Jannaschia sp. CCS1]
 gi|88865929|gb|ABD56806.1| Alcohol dehydrogenase zinc-binding protein [Jannaschia sp. CCS1]
          Length = 327

 Score =  335 bits (860), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 222/325 (68%), Gaps = 4/325 (1%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           KMR V +S  G  +V+   E P+P P  E+I I ++  GVNRPD +QR G Y PP  A+ 
Sbjct: 4   KMRAVEISEPGGPDVLRPCERPVPVPGAEQIAITIDHAGVNRPDALQRAGSYAPPPGASD 63

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           + GLE +G++ ++G   T W++GD+VCAL+ GGGYAE+ ++HQ H LP+P G +  QAA+
Sbjct: 64  LPGLEASGRVAEIGPGVTRWSVGDKVCALLPGGGYAEHVVTHQDHALPVPDGLSMAQAAA 123

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+FFTVW+N+F  A LR+GQ  L+HGGSSGIGTTAIQLA   GA V+TTA S EKC A
Sbjct: 124 LPETFFTVWSNVFMRAGLRAGQRFLVHGGSSGIGTTAIQLAHALGARVFTTAGSAEKCAA 183

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL+LGA+ AINY   DF+  ++      G D+ILDMVG +YL +++  L+ +G L  I+F
Sbjct: 184 CLELGAEQAINYRDADFVAAMRDVG---GADVILDMVGGDYLPRNIKALADDGHLQQIAF 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           L G    E+N   ++ +R+TI+GSTLR ++D AK +I   L+ K+WPLL++  IAPV+  
Sbjct: 241 LQGP-KVELNFAQLMVRRLTISGSTLRPQSDAAKAAIAQELREKVWPLLSAGRIAPVMDQ 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
              L   A AH  ME S HIGKI+L
Sbjct: 300 TFALENAADAHARMESSAHIGKIVL 324


>gi|293606939|ref|ZP_06689286.1| NADPH:quinone reductase [Achromobacter piechaudii ATCC 43553]
 gi|292814671|gb|EFF73805.1| NADPH:quinone reductase [Achromobacter piechaudii ATCC 43553]
          Length = 331

 Score =  335 bits (859), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 220/315 (69%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  + M +A+  + +P   ++LI+V   GVNRPDV+QR G YPPP  A+P LGLEV+G I
Sbjct: 14  GSPDCMQVAQRDMAEPVGRQVLIEVAYAGVNRPDVLQRSGSYPPPPGASPYLGLEVSGTI 73

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           + +G   T W +GD VCAL +GGGYA+YCL+ + H LP+P+G + + AA++PE++FTVW 
Sbjct: 74  IGVGPEVTAWKVGDTVCALTSGGGYAQYCLADERHCLPVPRGMDLLTAAAIPENYFTVWT 133

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  A L +G+  L+HGGSSGIG TAIQLA  FGA V+TT  ++ K  ACLK GA HA+
Sbjct: 134 NVFDRARLSAGEKFLVHGGSSGIGLTAIQLARAFGAQVWTTVGNQAKADACLKAGAHHAV 193

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
            Y   DF   ++ +TQG G+D+ILDMVG  Y+N+++ LL+  G+L+ I+FL G+ A EI+
Sbjct: 194 LYRDTDFEAQVRSDTQGAGVDVILDMVGGSYINKNIKLLAVNGRLVQIAFLEGSKA-EID 252

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
             PI++KR+  TGSTLR R+D  K +I  SL  K+ PL+      P+IH V PL + A A
Sbjct: 253 ALPIMTKRLQFTGSTLRPRSDDDKGAIARSLADKVLPLMEQGQCLPLIHEVFPLAEAARA 312

Query: 316 HDIMEKSEHIGKIIL 330
           H +ME S+HIGKI+L
Sbjct: 313 HALMESSKHIGKIML 327


>gi|170740246|ref|YP_001768901.1| PIG3 family NAD(P)H quinone oxidoreductase [Methylobacterium sp.
           4-46]
 gi|168194520|gb|ACA16467.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylobacterium sp.
           4-46]
          Length = 335

 Score =  335 bits (859), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 165/331 (49%), Positives = 219/331 (66%), Gaps = 1/331 (0%)

Query: 1   MP-ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPP 59
           MP I + MR V  +G G   V+ +  +P+P+P   ++LI V A GVNRPD  QR G YPP
Sbjct: 1   MPAIPETMRQVRFTGAGGPEVIGIETAPVPRPGPGQVLIAVAAAGVNRPDCQQRAGKYPP 60

Query: 60  PKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYN 119
           P  A  I GLEVAG++V  GE  T  + GDEVCALV  GGYAEYC++     LP P+  +
Sbjct: 61  PPGATEIPGLEVAGRVVARGEGVTGLSEGDEVCALVISGGYAEYCVAEAPLCLPRPRPLS 120

Query: 120 AIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKS 179
            ++AASLPE+ +TVW N+F+   L  G+  L+HGGSSGIG TAIQLA + GAT+Y TA S
Sbjct: 121 LLEAASLPENIYTVWTNVFERGRLAPGERFLVHGGSSGIGYTAIQLAKHAGATIYATAGS 180

Query: 180 EEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGK 239
            EKC  C  +GA  AINY + DF E +++ T G+G+D+ILDMVGA YL ++L  L+ EG+
Sbjct: 181 AEKCAFCETMGADAAINYREADFAEEVKRLTGGKGVDLILDMVGAAYLERNLKSLALEGR 240

Query: 240 LIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVI 299
           L++I+F+ G      N+ PI+ KR+T TGSTLR RT   K +I + L+ ++WP L S   
Sbjct: 241 LVVIAFMQGFKVDGFNMTPIMVKRLTFTGSTLRPRTTAQKAAIAEGLRREVWPWLESGGF 300

Query: 300 APVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            PVIH   PL +   AH +ME S H+GKI+L
Sbjct: 301 RPVIHATFPLEQAREAHALMESSAHLGKIML 331


>gi|296114578|ref|ZP_06833231.1| NAD(P)H quinone oxidoreductase, PIG3 family protein
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295978934|gb|EFG85659.1| NAD(P)H quinone oxidoreductase, PIG3 family protein
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 340

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 161/327 (49%), Positives = 215/327 (65%), Gaps = 3/327 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V  +  G  +VM ++E P P P + E+L++V A GVNRPD+MQRKGLYPPP  A+P+
Sbjct: 9   MQAVTYAEPGPPDVMAISEVPTPTPGRGEVLVRVMAAGVNRPDIMQRKGLYPPPPGASPL 68

Query: 67  LGLEVAGKIVDLG---ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           LGLE+AG+++  G    +     IG  VCAL NGGGYA+YC+   G  LP P G++A+ A
Sbjct: 69  LGLEIAGEVIARGPGIADDAFPAIGARVCALSNGGGYAQYCVVPAGQCLPWPVGFDALHA 128

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A+LPE+FFTVW+NLF TA+LR+G  VL+HGGSSGIGT AIQL    G   Y TA +  KC
Sbjct: 129 AALPETFFTVWSNLFMTAHLRAGDRVLVHGGSSGIGTVAIQLVRQMGGIPYVTAGTAAKC 188

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             C  +GA+ AINY ++DF+  + + T GRG+DIILDMVG  YL ++L  L+ +G+L+II
Sbjct: 189 ELCTTIGAEAAINYHEDDFVARIAELTDGRGVDIILDMVGGAYLERNLRCLAPDGRLVII 248

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           +  GG  A  + L  I+++R+ +TG+TLR R    K  I   L    WPLL    I P+I
Sbjct: 249 ALQGGARAENVGLARIMTRRLVVTGTTLRPRDTAYKAEIARQLHQHAWPLLEKKTIRPLI 308

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           H   P  +V  AH +ME   H GKIIL
Sbjct: 309 HATFPFAQVVDAHKLMENGTHSGKIIL 335


>gi|260461515|ref|ZP_05809762.1| NAD(P)H quinone oxidoreductase, PIG3 family [Mesorhizobium
           opportunistum WSM2075]
 gi|259032585|gb|EEW33849.1| NAD(P)H quinone oxidoreductase, PIG3 family [Mesorhizobium
           opportunistum WSM2075]
          Length = 336

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 226/328 (68%), Gaps = 1/328 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I  +M  +A+S  G   V+      +PQP   EILIKV A GVNRPDV QRKG YPPP  
Sbjct: 7   IPARMTAIAISEPGGPRVLKPEMRDVPQPGPGEILIKVHAAGVNRPDVQQRKGAYPPPPG 66

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE +G++  LG+  + W IGD VCAL  GGGYAEY   H G  LP+P G+   +
Sbjct: 67  ASDLPGLEASGEVAALGDEISRWRIGDRVCALTPGGGYAEYVKVHAGSVLPLPAGFTHTE 126

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA++PE++FTVW N+F+   L+ G+T+L+HGGSSGIGTTAIQLAS FGA V TTA S+EK
Sbjct: 127 AAAVPENYFTVWHNVFERGGLKKGETLLVHGGSSGIGTTAIQLASAFGAYVVTTAGSKEK 186

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C ACLKLGA  AINY +EDF+  +++ T G+G ++ILDMVG +Y+ ++    + EG+++ 
Sbjct: 187 CDACLKLGADRAINYREEDFVTAVKEATDGKGANVILDMVGGDYVQRNYEAAAVEGRIVQ 246

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+   G +A+  + + I+ KR+T TGSTLR RT   K +I  +L+ ++WPLL +  +APV
Sbjct: 247 IAVQAGAVAS-ADFSKIMVKRLTHTGSTLRPRTVEFKAAIAAALEAQVWPLLGTRKVAPV 305

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +  + PL +   AH+ ME+ EHIGKI+L
Sbjct: 306 MDMIFPLSEAWRAHERMEEGEHIGKIVL 333


>gi|153008506|ref|YP_001369721.1| quinone oxidoreductase putative PIG3 [Ochrobactrum anthropi ATCC
           49188]
 gi|151560394|gb|ABS13892.1| Quinone oxidoreductase putative PIG3 [Ochrobactrum anthropi ATCC
           49188]
          Length = 334

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 158/325 (48%), Positives = 228/325 (70%), Gaps = 1/325 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           +M  + +S  G ++++   +  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ 
Sbjct: 8   QMTAIEISEPGGAHMLRPVQRSVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASD 67

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLE+AG IV +G     +  GD+V AL+ GGGYAEY ++H+ + LP+P GY  I+AA+
Sbjct: 68  IPGLEIAGDIVAMGSGVKRFKTGDQVVALLAGGGYAEYAVAHETNALPLPAGYGYIEAAA 127

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           +PE+FFTVW N+F+   LR G+  L+HGGSSGIGTTAIQLA  FGATV  TA S+EKC A
Sbjct: 128 IPETFFTVWHNVFERGGLRKGEVFLVHGGSSGIGTTAIQLAKAFGATVIATAGSKEKCEA 187

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CLKLGA  A+NY +EDF+E++++ T+G+G ++ILDMVG +Y++++    +++G+++ I+F
Sbjct: 188 CLKLGADRAVNYGQEDFVEVVKEMTRGKGANVILDMVGGDYVDRNYKAAAEDGRIVQIAF 247

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           L G  AT  N   ++SKR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  
Sbjct: 248 LNGAKAT-ANFAILMSKRLTHTGSTLRPRPVDFKAGIARELETKVWPLLARRRVAPVMDM 306

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
           +  L     AH+ ME+  HIGKI+L
Sbjct: 307 IFSLKDAWRAHERMEEGRHIGKIVL 331


>gi|152981242|ref|YP_001352077.1| NADPH2:quinone reductase [Janthinobacterium sp. Marseille]
 gi|151281319|gb|ABR89729.1| NADPH2:quinone reductase [Janthinobacterium sp. Marseille]
          Length = 325

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 161/324 (49%), Positives = 225/324 (69%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + ++  G  +V+ L E P+P+P+  E+LIKV A G+NRPDV+QR G YP PK A+ +
Sbjct: 1   MRAIEITQPGPPDVLKLCERPMPEPKAGEVLIKVHAAGINRPDVLQRTGNYPVPKGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG+IV      + + IGD +CAL  GGGYAEYC +     LPIPKG +A++AASL
Sbjct: 61  PGLEVAGEIVGGDLTGSGFKIGDMICALAQGGGYAEYCTAPVEQCLPIPKGLDAVEAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    L   +T+L+ GG+SGIG TAIQ+A+  G  V+ TA S++K  AC
Sbjct: 121 PETFFTVWSNVFDRVGLTGDETLLVQGGTSGIGVTAIQIATALGHRVFATAGSDDKARAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             +GA+  INY  EDF+EI++  T G+G+D+ILDMVG +Y+ + +  L+ +G+L+ I+ L
Sbjct: 181 EVMGAERGINYKTEDFVEIVKAATGGKGVDVILDMVGGDYVPREIRCLADDGRLVFIALL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GGN A E++L  I+ +R+TITGSTLR R    K +I   L+ ++WPL+ +  I PVI+  
Sbjct: 241 GGNKA-EVSLGQILLRRLTITGSTLRPRPVAFKAAIAKQLRERVWPLIEAGKIKPVIYQT 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH +ME S HIGKIIL
Sbjct: 300 FPLEEAAQAHALMESSTHIGKIIL 323


>gi|239832827|ref|ZP_04681156.1| NAD(P)H quinone oxidoreductase, PIG3 family [Ochrobactrum
           intermedium LMG 3301]
 gi|239825094|gb|EEQ96662.1| NAD(P)H quinone oxidoreductase, PIG3 family [Ochrobactrum
           intermedium LMG 3301]
          Length = 334

 Score =  333 bits (854), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 158/325 (48%), Positives = 226/325 (69%), Gaps = 1/325 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           +M  + +S  G+ +++   +  +P+P++ EIL++V A GVNRPDV+QR G Y PP  A+ 
Sbjct: 8   QMTAIEISEPGRPHMLRPVQRSVPEPKESEILVRVRAAGVNRPDVLQRLGQYAPPPGASD 67

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLE+AG IV +G     + +GD+V AL+ GGGYAEY + H+ + LP+P GY  I+AA+
Sbjct: 68  IPGLEIAGDIVAVGSGVKRFKLGDQVVALLAGGGYAEYAVVHESNALPLPSGYGYIEAAA 127

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           +PE+FFTVW N+ +   L+ G+T+L+HGGSSGIGTTAIQLA  FGATV  TA S+EKC A
Sbjct: 128 IPETFFTVWHNVIERGGLKKGETLLVHGGSSGIGTTAIQLAKAFGATVIATAGSKEKCDA 187

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CLKLGA  A+NY  EDF+E+++  T+GRG D+ILDMVG +Y++++    +++G+++ I+F
Sbjct: 188 CLKLGADRAVNYRDEDFVEVVKDVTKGRGADVILDMVGGDYVDRNYKAAAEDGRIVQIAF 247

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           L G  AT  N   +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  
Sbjct: 248 LNGAKATA-NFALLMTKRLTHTGSTLRPRPVEFKAGIARELEAKVWPLLAQRRVAPVMDM 306

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
           +  L     AH+ ME+  HIGKI+L
Sbjct: 307 IFSLKDAWRAHERMEEGRHIGKIVL 331


>gi|258543382|ref|YP_003188815.1| alcohol dehydrogenase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634460|dbj|BAI00436.1| alcohol dehydrogenase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637518|dbj|BAI03487.1| alcohol dehydrogenase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640570|dbj|BAI06532.1| alcohol dehydrogenase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643627|dbj|BAI09582.1| alcohol dehydrogenase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646682|dbj|BAI12630.1| alcohol dehydrogenase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649735|dbj|BAI15676.1| alcohol dehydrogenase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652723|dbj|BAI18657.1| alcohol dehydrogenase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655779|dbj|BAI21706.1| alcohol dehydrogenase [Acetobacter pasteurianus IFO 3283-12]
          Length = 343

 Score =  333 bits (854), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 170/327 (51%), Positives = 220/327 (67%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +  +  G  +V+ L    +PQP + E+L++V A GVNRPD+MQRKGLYPPP  A+P 
Sbjct: 11  MKAICFTQAGAPDVLHLETIQVPQPGRGEVLVRVMAAGVNRPDIMQRKGLYPPPPGASPR 70

Query: 67  LGLEVAGKIVDLG---ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           LGLE+AG++V  G   E  T   IG  +CAL NGGGYAEYCL   G  LP P+G+NAI+A
Sbjct: 71  LGLEIAGEVVAHGLPQEGVTMPAIGSRICALANGGGYAEYCLVPAGQCLPWPEGFNAIEA 130

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A+LPE+FFTVW+NLF    L     VLIHGGSSGIGTTAIQL   FG T + TA ++EKC
Sbjct: 131 AALPETFFTVWSNLFMPTMLPKNARVLIHGGSSGIGTTAIQLVKAFGGTPFATAGTDEKC 190

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             C +LGA+ AINY  EDF E + + T+G G+++ILDMVG  Y  ++L  L+ +GKLIII
Sbjct: 191 ALCEQLGAQ-AINYKTEDFAERIAELTKGEGVNVILDMVGGPYFERNLKSLAFDGKLIII 249

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           +  GG  A + NL  I++ R+ +TGSTLR R   +K  I   L+ K+WPLL +  I P+I
Sbjct: 250 ALQGGAKAEQANLVRIMTHRLIVTGSTLRPRDSASKARIAQDLKAKVWPLLTNRTIRPLI 309

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           H   PL + A AH  ME   H+GKIIL
Sbjct: 310 HQTFPLAQAAAAHQAMEDGHHLGKIIL 336


>gi|182678230|ref|YP_001832376.1| PIG3 family NAD(P)H quinone oxidoreductase [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182634113|gb|ACB94887.1| NAD(P)H quinone oxidoreductase, PIG3 family [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 338

 Score =  333 bits (853), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 158/330 (47%), Positives = 224/330 (67%), Gaps = 1/330 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I  +MR +   G G   V+ + E+ +P P + ++LI+V A G+NRPD +QR G YPPP  
Sbjct: 5   IPDRMRQIYFDGKGGPEVIRVGEAEVPTPGRGKVLIEVAAAGINRPDCVQRAGFYPPPPG 64

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            + I GLEVAGKIV LGE  + W IGDEVCAL+  GGYAEY L+     LP+PKG + I+
Sbjct: 65  ESEIPGLEVAGKIVKLGEGVSQWQIGDEVCALLGSGGYAEYALADAALCLPVPKGLSLIE 124

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA+LPE++FTV+ N+F    L+ G+  LIHGGSSGIG+TAIQLA  FGA V+TTA S EK
Sbjct: 125 AAALPETYFTVYDNVFTRGRLQPGENFLIHGGSSGIGSTAIQLAKQFGAKVFTTAGSAEK 184

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGR-GIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           C  C  LGA HAI+Y   DF+E ++K T  +  ID+ILDMVG  Y+ ++L+LL+ +G+++
Sbjct: 185 CAFCRTLGADHAIDYKTSDFVEEIRKITDNKYPIDVILDMVGGSYIAKNLSLLNFDGRMV 244

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I+FL        +  P++ +R+T+TGSTLR R    K  I ++L+  +WPLL+  ++ P
Sbjct: 245 QIAFLQSPKVASFDFLPLMLRRLTMTGSTLRARALGQKIEIAEALRELVWPLLDQGLVKP 304

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
           ++H   PL +   +H++ME S H+GKI+L+
Sbjct: 305 MVHATFPLEEARQSHELMESSAHLGKILLV 334


>gi|319781116|ref|YP_004140592.1| NAD(P)H quinone oxidoreductase, PIG3 family [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317167004|gb|ADV10542.1| NAD(P)H quinone oxidoreductase, PIG3 family [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 336

 Score =  332 bits (850), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 163/328 (49%), Positives = 226/328 (68%), Gaps = 1/328 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I  +M  +A+S  G   V+      +PQP   EILIKV A GVNRPDV QRKG YPPP  
Sbjct: 7   IPARMTAIAISEPGGPRVLKPETRDVPQPGPGEILIKVHAAGVNRPDVQQRKGAYPPPPG 66

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE +G++  LG++ + W IGD VCAL  GGGYAEY   H G  LP+P G+   +
Sbjct: 67  ASDLPGLEASGEVAALGDDISRWRIGDRVCALTPGGGYAEYVKVHAGSVLPLPAGFTHTE 126

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA++PE++FTVW N+F+   L+ G+T+L+HGGSSGIGTTAIQLAS FGA V TTA S+EK
Sbjct: 127 AAAVPENYFTVWHNVFERGGLKKGETLLVHGGSSGIGTTAIQLASAFGAYVITTAGSKEK 186

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C ACLKLGA  AINY + DF+  +++ T G+G ++ILDMVG +Y+ ++    + EG+++ 
Sbjct: 187 CDACLKLGADRAINYREADFVAAVKEATGGKGANVILDMVGGDYVARNYEAAAVEGRIVQ 246

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+   G +A+  + + I+ KR+T TGSTLR RT   K +I  +L+ ++WPLL +  +APV
Sbjct: 247 IAVQAGAVAS-ADFSKIMVKRLTHTGSTLRPRTVEFKAAIAAALEAQVWPLLGTRKVAPV 305

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +  + PL +   AH+ ME+ EHIGKI+L
Sbjct: 306 MDMIFPLSEAWRAHERMEEGEHIGKIVL 333


>gi|170698106|ref|ZP_02889186.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia ambifaria
           IOP40-10]
 gi|170136964|gb|EDT05212.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia ambifaria
           IOP40-10]
          Length = 339

 Score =  332 bits (850), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 168/334 (50%), Positives = 225/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ LAE P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLAERPRPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV     D   N     +GD VCAL+ GGGYAEY ++     LP+P G   I
Sbjct: 61  PGLEVAGEIVGGDLSDAALNPFGLKLGDRVCALLAGGGYAEYAVAPLPQCLPVPDGLTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRALLGAGEGGEQETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A S +KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGSADKCRACEALGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVAGSYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A E+NLN I+ +R+T+TGSTLR R    K  I   L+ ++WPLL  
Sbjct: 241 GGRLVLIALLGGAKA-EVNLNEILRRRLTVTGSTLRPRPVEFKARIAAQLKARVWPLLAD 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP G+ A AH +ME  EHIGKI+L
Sbjct: 300 GRIKPVIYRVLPAGEAAQAHALMESGEHIGKIVL 333


>gi|163758830|ref|ZP_02165917.1| alcohol dehydrogenase, zinc-containing [Hoeflea phototrophica
           DFL-43]
 gi|162284120|gb|EDQ34404.1| alcohol dehydrogenase, zinc-containing [Hoeflea phototrophica
           DFL-43]
          Length = 338

 Score =  332 bits (850), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 222/324 (68%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +   G   ++  A  P P     ++LIKV A GVNRPD +QR+G YPPP  A+ I
Sbjct: 13  MRAIEIREPGGPEMLVPASRPTPTASDTQLLIKVAAAGVNRPDCLQRQGAYPPPPGASDI 72

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG++V  G+  + +  G++VCALV GGGYAE+C+  + + LP P G   I+AA++
Sbjct: 73  PGLEIAGEVVATGKAVSRFKTGEKVCALVPGGGYAEFCVVDETNALPAPNGLTMIEAAAI 132

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW N+FQ   L++G++ L+HGG+SGIGTTAIQLA  FGA V+ TA SE KC A 
Sbjct: 133 PETFFTVWHNVFQRGGLKAGESFLVHGGTSGIGTTAIQLAKAFGAKVFATAGSEAKCAAM 192

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA  AINY + DF+E+L++ET G+G+D+ILDMVG +Y+N++    + EG+++ I+FL
Sbjct: 193 LDLGADLAINYKESDFVEVLKEETGGKGVDLILDMVGGDYINRNYQAAAVEGRIVQIAFL 252

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  A E++ + ++ KR+T TGSTLR R    K  I   L+  +WPLLN   + PV+ ++
Sbjct: 253 NGRKA-EVDFSLLMMKRLTHTGSTLRARDIAFKAKIASELRQHVWPLLNERKVLPVMDSI 311

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH  ME  +HIGKI+L
Sbjct: 312 YPLEQAAAAHQRMEDGDHIGKIVL 335


>gi|209965153|ref|YP_002298068.1| oxidoreductase, zinc-binding dehydrogenase family [Rhodospirillum
           centenum SW]
 gi|209958619|gb|ACI99255.1| oxidoreductase, zinc-binding dehydrogenase family [Rhodospirillum
           centenum SW]
          Length = 335

 Score =  332 bits (850), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 224/330 (67%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + ++MR V + G G   V+   E P+P+P   E+LI+V A GVNRPDV+QR GLYPPP
Sbjct: 3   MAVPERMRAVEIGGAGGPEVLRPVERPVPRPGPGELLIRVAAAGVNRPDVLQRLGLYPPP 62

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+ + GLEVAG +  +GE  + W  GD +CALV GGGYA YC++     LPIP+G +A
Sbjct: 63  PGASDLPGLEVAGTVAAVGEGVSGWREGDALCALVAGGGYAAYCVAPAPQCLPIPRGLSA 122

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AA +PE+FFTVW+N+F+   L+  +++L+HGG+SGIGTTAIQLA  FGA V+ TA S 
Sbjct: 123 VEAAGVPETFFTVWSNVFERGALKPTESLLVHGGTSGIGTTAIQLAKAFGARVFATAGSP 182

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
            K  AC +LGA   I+Y  EDF+ ++++ T G G+D++LDMVG +YL +++  L+ +G+ 
Sbjct: 183 AKARACEELGADRGIDYKAEDFVVVVKELTGGTGVDVVLDMVGGDYLARNVDCLAPDGRH 242

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+F  G   T +NL  ++ KR+ +TGSTLR R    K  I  +LQ K+WPLL   ++ 
Sbjct: 243 VSIAFQRGPKGT-LNLMWVMQKRLVLTGSTLRPRPVAEKGRIAVALQEKVWPLLEEGLVR 301

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I+   PL + A AH ++E  EH+GKIIL
Sbjct: 302 PRIYRTFPLEQAAAAHALIESGEHVGKIIL 331


>gi|83951270|ref|ZP_00960003.1| alcohol dehydrogenase, zinc-containing [Roseovarius nubinhibens
           ISM]
 gi|83839169|gb|EAP78465.1| alcohol dehydrogenase, zinc-containing [Roseovarius nubinhibens
           ISM]
          Length = 330

 Score =  331 bits (849), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 223/326 (68%), Gaps = 4/326 (1%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           K M  V ++  G   V+ + + P+P+    E++I+V   GVNRPD +QR GLY PP +A+
Sbjct: 3   KAMTAVEITQPGGPEVLQITQRPMPEAGPGEVVIRVAWAGVNRPDALQRAGLYAPPPSAS 62

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            + GLE +G+IV LGE    W +GD+VCAL+ GGGYAEY  +   H LP+P+G    +AA
Sbjct: 63  DLPGLEASGEIVALGEGVGDWALGDQVCALLPGGGYAEYVTTPAAHCLPVPEGMGLREAA 122

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
            LPE+FFTVW+N+F    L++G+  L+HGGSSGIGTTAIQLA  FGA V+ TA SE KC 
Sbjct: 123 CLPETFFTVWSNVFMRGGLQAGERFLVHGGSSGIGTTAIQLAKAFGARVFATAGSEAKCA 182

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC  LGA   INY  EDF EIL+ E    G ++ILDMVG +YL +++  L+ EG+L+ I+
Sbjct: 183 ACRDLGADRVINYRDEDFSEILRAEG---GANLILDMVGGDYLPRNVRALADEGRLVQIA 239

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FL G    E+N   ++ +R+TITGSTLR ++D+AK  I ++L+ ++WPLL +  IAPV+ 
Sbjct: 240 FLKGP-KVELNFAQVMMRRLTITGSTLRPQSDLAKARIAEALRREVWPLLAAGRIAPVMD 298

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +  PLG+ + AH  ME  +HIGKI+L
Sbjct: 299 SDYPLGEASQAHAHMEAGDHIGKIVL 324


>gi|254511804|ref|ZP_05123871.1| alcohol dehydrogenase, zinc-containing [Rhodobacteraceae bacterium
           KLH11]
 gi|221535515|gb|EEE38503.1| alcohol dehydrogenase, zinc-containing [Rhodobacteraceae bacterium
           KLH11]
          Length = 330

 Score =  331 bits (849), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 227/330 (68%), Gaps = 4/330 (1%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           MP+ + MR V ++  G  +V+ L E P+P+P   ++++KV   GVNRPD +QR G Y PP
Sbjct: 1   MPMSQTMRAVEITQPGGPDVLHLTERPVPEPAMGQVVLKVAYAGVNRPDALQRAGAYDPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+ + GLE +G++V +G       IGD+VCAL+ GGGYAEY  +   H LP+P G   
Sbjct: 61  PGASDLPGLEASGEVVAVGAGVEGLAIGDQVCALLPGGGYAEYVATPAAHCLPVPSGMGL 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            +AA LPE+FFTVW+N+F    L++G+  L+HGGSSGIGTTAIQLA+ FGA V+ TA S 
Sbjct: 121 KEAACLPETFFTVWSNVFTRGGLKAGERFLVHGGSSGIGTTAIQLANAFGARVFATAGSA 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC++LGA+ AINY  EDF+  ++ E    G ++ILDMVG +Y+ +++  L+++G+L
Sbjct: 181 EKCEACIRLGAEKAINYRDEDFVAAMRAEG---GANLILDMVGGDYIPRNVKALAEDGRL 237

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+FL G + +E+N + ++ KR+T+TGSTLR ++D+AK  I   LQ  +WPLL +  +A
Sbjct: 238 VQIAFLQGPV-SELNFSLMMVKRLTLTGSTLRPQSDLAKARIAQDLQEAVWPLLAAGKVA 296

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PV+ +   L   A AH+ ME S HIGKI+L
Sbjct: 297 PVMDSEFDLADAAAAHERMESSGHIGKIVL 326


>gi|307825805|ref|ZP_07656021.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylobacter
           tundripaludum SV96]
 gi|307733113|gb|EFO03974.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylobacter
           tundripaludum SV96]
          Length = 327

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 174/330 (52%), Positives = 228/330 (69%), Gaps = 5/330 (1%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           MP  K+M  + +    ++ V+  A+  IP P   ++LIKV A GVNRPDVMQR+GLYPPP
Sbjct: 1   MPFPKQMIAIEI----ENGVLKPAKRTIPTPPANQVLIKVSAAGVNRPDVMQRQGLYPPP 56

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
            +A  I GLEVAG I  LG+N  H N GD+VCALV GGGYAEYCL+     LPIP+G + 
Sbjct: 57  PDAPDIPGLEVAGTIQALGDNIHHLNKGDKVCALVTGGGYAEYCLASAALCLPIPEGLSF 116

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
             AA+LPE+FFTVW+N+F  A L+ G+T+L+HGG+SGIGTTAIQLA  F A V  TA SE
Sbjct: 117 TLAAALPETFFTVWSNVFDRAQLQPGETLLVHGGTSGIGTTAIQLAKAFNAKVIVTAGSE 176

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
            KC  CL+LGA  AINY ++DF++ +++ T  RG+D+ILDM+G +Y  ++L  ++ + +L
Sbjct: 177 AKCEFCLQLGADAAINYKEQDFVDEIKRLTDNRGVDVILDMIGGDYFPRNLKCMADDARL 236

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+   G  A EINL P++ KR+ ITGSTLR R D  K +I   L  K+WPLL S  I 
Sbjct: 237 VQIAIQNGPKA-EINLLPVMLKRLIITGSTLRARDDTFKAAIAAKLLEKVWPLLASGQIK 295

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVIH+   L   A+AH +ME S H+GKIIL
Sbjct: 296 PVIHSTFALTDAALAHQLMESSRHVGKIIL 325


>gi|171316300|ref|ZP_02905521.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia ambifaria
           MEX-5]
 gi|171098526|gb|EDT43327.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia ambifaria
           MEX-5]
          Length = 339

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 167/334 (50%), Positives = 226/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ LAE P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLAERPRPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV     D   N     +GD VCAL+ GGGYAEY ++     LP+P+G   I
Sbjct: 61  PGLEVAGEIVGGDLSDAALNPFGLKLGDRVCALLAGGGYAEYAVAPLPQCLPVPEGLTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRALLGAGEGGEQETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A + +KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGNADKCRACEALGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVAGSYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A E+NLN I+ +R+T+TGSTLR R    K  I   L+ ++WPLL  
Sbjct: 241 GGRLVLIALLGGAKA-EVNLNEILRRRLTVTGSTLRPRPVEFKARIAAQLKARVWPLLAD 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP G+ A AH +ME  EHIGKI+L
Sbjct: 300 GRIKPVIYRVLPAGEAAQAHALMESGEHIGKIVL 333


>gi|50084895|ref|YP_046405.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter sp.
           ADP1]
 gi|49530871|emb|CAG68583.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter sp.
           ADP1]
          Length = 333

 Score =  330 bits (847), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 221/324 (68%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MRH+ +S  G  +V+ + E+ +P+ + +EILI+V+A G+NRPDV+QRKGLYP PK+  PI
Sbjct: 8   MRHIEISQSGDPDVLHIVETSLPKIKIDEILIEVKAFGINRPDVLQRKGLYPMPKDVTPI 67

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +  +GEN + + +GD VCAL NGGGYAEYC   +  TLPIP   + I+AA++
Sbjct: 68  PGLEVAGIVTAIGENVSQFKVGDRVCALTNGGGYAEYCAVPETQTLPIPSNLSYIEAAAI 127

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVWANLF    L  G+T LIHGG+SGIGTTA+ L    G   + T  S++K  A 
Sbjct: 128 PETYFTVWANLFDIGQLSVGETALIHGGASGIGTTALTLCHAMGIKTFCTVGSDDKVDAL 187

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            K+    AINY K +F E++ ++TQ +G+D+ILD+VG +Y  Q++  L ++G+L+I+ F+
Sbjct: 188 NKITT--AINYKKHNFEEVILEQTQNKGVDVILDIVGGKYFQQNMNTLKRDGRLVILGFM 245

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E +L  +I KR  +TGST+R RTD  K  I  SL+  +WPLL+     P+I+  
Sbjct: 246 GGRYAKEFDLQQLILKRAKVTGSTMRARTDQEKSEITQSLRQHVWPLLSEGKSLPLIYKS 305

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
                ++ AH  ME+SEHIGKI++
Sbjct: 306 FSFEDISKAHTCMEESEHIGKIVI 329


>gi|23014290|ref|ZP_00054113.1| COG0604: NADPH:quinone reductase and related Zn-dependent
           oxidoreductases [Magnetospirillum magnetotacticum MS-1]
          Length = 330

 Score =  330 bits (847), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 169/326 (51%), Positives = 228/326 (69%), Gaps = 1/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + M  V +S  G   V+     P+PQP+  E+LIKV A G+NRPDV+QR G YP P  A+
Sbjct: 4   ETMTCVEISTPGGPEVLVPITRPLPQPKPGEVLIKVAAAGINRPDVLQRAGAYPAPPGAS 63

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            + GLEVAG IV LGE  T   +G EVCAL  GGGYA+YC     H LPIPKGY+ I+AA
Sbjct: 64  DLPGLEVAGTIVALGEGVTSPALGAEVCALAPGGGYAQYCTVDARHCLPIPKGYDMIRAA 123

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           +LPE+FFTVW N+ +   L+SG   L+HGG+ GIGTTAIQLA   GATV+ TA  E KC 
Sbjct: 124 ALPETFFTVWHNVVERGQLKSGDRFLVHGGAGGIGTTAIQLAKALGATVFATANGEAKCT 183

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC +LGA  AI+Y   DF+E+++ ET+G+GID+ILDMVG +Y+ +++  L+ +G+L+ I+
Sbjct: 184 ACRELGADMAIDYSTADFVEVIRAETKGKGIDVILDMVGGDYMARNIKSLAADGRLVSIA 243

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FL G+ A E+N+ P++ KR+T+TGSTLR +++ AK  +   L   IWPLL+   IAP+IH
Sbjct: 244 FLRGSSA-ELNMMPVMLKRLTLTGSTLRPQSNDAKARMARGLAETIWPLLDKGAIAPLIH 302

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
            V PL + A AH +ME + H+GKI+L
Sbjct: 303 AVFPLAEAAKAHALMESNAHMGKIVL 328


>gi|13473234|ref|NP_104801.1| NADPH quinone oxidoreductase [Mesorhizobium loti MAFF303099]
 gi|14023982|dbj|BAB50587.1| NADPH quinone oxidoreductase [Mesorhizobium loti MAFF303099]
          Length = 326

 Score =  330 bits (847), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 164/324 (50%), Positives = 223/324 (68%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  +A+S  G   V+      +PQP   EILIKV A GVNRPDV QRKG YPPP  A+ +
Sbjct: 1   MTAIAISVPGGPRVLKPETRDVPQPGPGEILIKVHAAGVNRPDVQQRKGAYPPPPGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G++  LG+  + W IGD VCAL  GGGYAEY   H G  LP+P G+   +AA++
Sbjct: 61  PGLEVSGEVAALGDEISRWRIGDRVCALTPGGGYAEYVKVHSGSVLPLPAGFTHTEAAAV 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVW N+F+   L+ G+T+L+HGGSSGIGTTAIQLAS FGA V TTA S+EKC AC
Sbjct: 121 PENYFTVWHNVFERGALKKGETLLVHGGSSGIGTTAIQLASAFGAYVITTAGSKEKCDAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           LKLGA  AINY +EDF+  +++ T G+G  +ILDMVG +Y+ ++    + EG+++ I+  
Sbjct: 181 LKLGADRAINYREEDFVTAVKEATDGKGATVILDMVGGDYVQRNYEAAAVEGRIVQIAVQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G +A+  + + I+ KR+T TGSTLR RT   K +I  +L+ ++WPLL +  +APV+  +
Sbjct: 241 AGAVAS-ADFSKIMVKRLTHTGSTLRPRTVEFKAAIAAALEAQVWPLLGTRKVAPVMDMI 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL     AH+ ME+ EHIGKI+L
Sbjct: 300 YPLTDAWRAHERMEEGEHIGKIVL 323


>gi|115352341|ref|YP_774180.1| alcohol dehydrogenase [Burkholderia ambifaria AMMD]
 gi|172061212|ref|YP_001808864.1| PIG3 family NAD(P)H quinone oxidoreductase [Burkholderia ambifaria
           MC40-6]
 gi|115282329|gb|ABI87846.1| Alcohol dehydrogenase, zinc-binding domain protein [Burkholderia
           ambifaria AMMD]
 gi|171993729|gb|ACB64648.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia ambifaria
           MC40-6]
          Length = 339

 Score =  330 bits (847), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 167/334 (50%), Positives = 225/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ LAE P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLAERPRPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV     D   N     +GD VCAL+ GGGYAEY ++     LP+P G   I
Sbjct: 61  PGLEVAGEIVGGDLSDAALNPFGLKLGDRVCALLAGGGYAEYAVAPLPQCLPVPDGLTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRALLGAGEGGEQETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A + +KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGNADKCRACEALGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVAGSYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A E+NLN I+ +R+T+TGSTLR R    K  I   L+ ++WPLL  
Sbjct: 241 GGRLVLIALLGGAKA-EVNLNEILRRRLTVTGSTLRPRPVEFKARIAAQLKARVWPLLAD 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP G+ A AH +ME  EHIGKI+L
Sbjct: 300 GRIKPVIYRVLPAGEAAQAHALMESGEHIGKIVL 333


>gi|329113973|ref|ZP_08242740.1| Quinone oxidoreductase [Acetobacter pomorum DM001]
 gi|326696720|gb|EGE48394.1| Quinone oxidoreductase [Acetobacter pomorum DM001]
          Length = 343

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 170/327 (51%), Positives = 218/327 (66%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +  +  G  +V+ L    +PQP + E+L++V A GVNRPD+MQRKGLYPPP  A P 
Sbjct: 11  MKAICFTQAGAPDVLHLETIQVPQPGRGEVLVRVMAAGVNRPDIMQRKGLYPPPPGACPR 70

Query: 67  LGLEVAGKIVDLG---ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           LGLE+AG++V  G   +  T   IG  VCAL NGGGYAEYCL   G  LP P+G+NAI+A
Sbjct: 71  LGLEIAGEVVAHGLPQDGVTMPAIGSRVCALANGGGYAEYCLVPAGQCLPWPEGFNAIEA 130

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A+LPE+FFTVW+NLF    L     VLIHGGSSGIGTTAIQL   FG T + TA ++EKC
Sbjct: 131 AALPETFFTVWSNLFMPTMLPKDARVLIHGGSSGIGTTAIQLVKAFGGTPFATAGTDEKC 190

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             C +LGA+ AINY  EDF E + + T+G G+++ILDMVG  Y  ++L  L+ +GKLIII
Sbjct: 191 ALCEQLGAQ-AINYKTEDFAERIAELTKGEGVNVILDMVGGPYFERNLKSLAFDGKLIII 249

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           +  GG  A + NL  I++ R+ +TGSTLR R   +K  I   L+ K+WPLL +  I P I
Sbjct: 250 ALQGGAKAEQANLVRIMTHRLIVTGSTLRPRDSASKARIAQDLKEKVWPLLTNRTIRPFI 309

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           H   PL + A AH  ME   H+GKIIL
Sbjct: 310 HQTFPLAQAAAAHQAMEDGHHLGKIIL 336


>gi|226362122|ref|YP_002779900.1| oxidoreductase [Rhodococcus opacus B4]
 gi|226240607|dbj|BAH50955.1| putative oxidoreductase [Rhodococcus opacus B4]
          Length = 337

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 215/324 (66%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  V ++  G  +V+    +P+P P  +E+L++V+A GVNRPDVMQR+G YP P   N  
Sbjct: 10  MTEVVITEPGGPDVLQPRRAPVPTPHGDEVLVRVKAAGVNRPDVMQRRGEYPMPPVVNQT 69

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG+IV +G + T + +GD VC L  GGGYAEYCL     TLP+P G  A +AA++
Sbjct: 70  PGLEIAGEIVAVGSSVTRFAVGDTVCGLTEGGGYAEYCLLSASQTLPVPHGMTASEAAAI 129

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWAN+F      +G T+L+HGG+SGIG+TA+ LA+ FG     T    EKC A 
Sbjct: 130 PETFFTVWANVFHIGRAAAGDTLLVHGGTSGIGSTALMLATEFGIRTIATDDGPEKCKAI 189

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L+LGA+ AI++ ++DF E +   T GRGID+ILD+VG  YL +++  L+ +G+L+ I FL
Sbjct: 190 LELGAEFAIDFREQDFAEAVLDLTDGRGIDLILDIVGGAYLERNIASLATDGRLLSIGFL 249

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +A ++NL  I  KR T+TGST+R RT   K  I   LQ K+WP L +    P+IH V
Sbjct: 250 GGEVAPQVNLLTIALKRATLTGSTMRSRTAHEKAVIATDLQAKVWPALAAGRCRPIIHDV 309

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH +ME   HIGKI+L
Sbjct: 310 FPLARAADAHRMMESGRHIGKIVL 333


>gi|167562174|ref|ZP_02355090.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia oklahomensis EO147]
 gi|167569419|ref|ZP_02362293.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia oklahomensis C6786]
          Length = 339

 Score =  330 bits (845), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 163/334 (48%), Positives = 228/334 (68%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLTERPQPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV--DLGENTTH---WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV  DL +  T+     +GD VCAL++GGGYAEY  +     LP+PKG   +
Sbjct: 61  PGLEVAGEIVGGDLSDPATNPFGLKLGDRVCALLSGGGYAEYVAAPLAQCLPVPKGLTDV 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGAGEGGAQETFLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A +++KC AC +LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + LT L+ 
Sbjct: 181 AGTDDKCRACERLGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVAGAYVPRELTALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG   +EINL  I+ +R+T+TGSTLR R    K  I   L+ ++WPL+  
Sbjct: 241 GGRLVVIALLGG-AKSEINLGEILRRRLTVTGSTLRPRPVEFKARIAAQLKARVWPLIED 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + PVI+ VLP  + + AH +ME SEH+GKI+L
Sbjct: 300 GRVKPVIYRVLPAAQASDAHALMESSEHVGKIML 333


>gi|300723074|ref|YP_003712372.1| putative oxydoreductase protein [Xenorhabdus nematophila ATCC
           19061]
 gi|297629589|emb|CBJ90192.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Xenorhabdus
           nematophila ATCC 19061]
          Length = 334

 Score =  330 bits (845), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 164/329 (49%), Positives = 217/329 (65%), Gaps = 1/329 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I   M  V +   G+  V+ L    +P+   EEILIKV A GVNRPDV+QR+G YPPP  
Sbjct: 6   IPDNMTVVKIDHPGEPEVLTLENVSVPKLHPEEILIKVAAAGVNRPDVLQRRGYYPPPPG 65

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ I GLE++G +V LG N  H+ +GD+VCALV GGGYAEYC  H+ + LP+PKGY+ ++
Sbjct: 66  ASDIPGLEISGTVVALGSNVKHYAVGDQVCALVAGGGYAEYCKVHESNALPVPKGYSLLE 125

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA+LPE+FFTVW NLFQ   L++G+ VLIHGG+SGIGT A  LA  F A V TT  SEEK
Sbjct: 126 AAALPETFFTVWVNLFQRGKLKAGEAVLIHGGTSGIGTVATMLAKAFKAYVITTVGSEEK 185

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
             A L LGA  +INY  EDF+E   + T G G D+I+D++  +Y+ ++    + EG++I 
Sbjct: 186 RQASLALGADVSINYRTEDFIEKTHQVTHGHGADVIVDLIAGDYVAKNFQAAAVEGRIIQ 245

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I    G    E+NL P++ KR+++TGSTLR R+   K  I   LQ K+WPLL   +I P 
Sbjct: 246 IGVQNGK-TKELNLMPLLQKRLSMTGSTLRSRSIEDKARIASELQEKVWPLLEQGLIKPH 304

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
           I    PL + A AH +ME S HIGKI+L+
Sbjct: 305 IFKTFPLKEAAQAHTLMESSTHIGKIMLV 333


>gi|148559074|ref|YP_001259588.1| alcohol dehydrogenase [Brucella ovis ATCC 25840]
 gi|161619664|ref|YP_001593551.1| PIG3 family NAD(P)H quinone oxidoreductase [Brucella canis ATCC
           23365]
 gi|163845314|ref|YP_001622969.1| zinc-binding alcohol dehydrogenase [Brucella suis ATCC 23445]
 gi|254700396|ref|ZP_05162224.1| zinc-binding alcohol dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|254703513|ref|ZP_05165341.1| zinc-binding alcohol dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|254708398|ref|ZP_05170226.1| zinc-binding alcohol dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|254708749|ref|ZP_05170560.1| zinc-binding alcohol dehydrogenase [Brucella pinnipedialis B2/94]
 gi|254714594|ref|ZP_05176405.1| zinc-binding alcohol dehydrogenase [Brucella ceti M644/93/1]
 gi|254717492|ref|ZP_05179303.1| zinc-binding alcohol dehydrogenase [Brucella ceti M13/05/1]
 gi|256030275|ref|ZP_05443889.1| zinc-binding alcohol dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|256061773|ref|ZP_05451908.1| zinc-binding alcohol dehydrogenase [Brucella neotomae 5K33]
 gi|256160448|ref|ZP_05458137.1| zinc-binding alcohol dehydrogenase [Brucella ceti M490/95/1]
 gi|256255655|ref|ZP_05461191.1| zinc-binding alcohol dehydrogenase [Brucella ceti B1/94]
 gi|260568819|ref|ZP_05839287.1| alcohol dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|261219323|ref|ZP_05933604.1| NADPH quinone oxidoreductase [Brucella ceti M13/05/1]
 gi|261222858|ref|ZP_05937139.1| NADPH quinone oxidoreductase [Brucella ceti B1/94]
 gi|261315898|ref|ZP_05955095.1| NADPH quinone oxidoreductase [Brucella pinnipedialis M163/99/10]
 gi|261316240|ref|ZP_05955437.1| NADPH quinone oxidoreductase [Brucella pinnipedialis B2/94]
 gi|261322384|ref|ZP_05961581.1| NADPH quinone oxidoreductase [Brucella ceti M644/93/1]
 gi|261325775|ref|ZP_05964972.1| NADPH quinone oxidoreductase [Brucella neotomae 5K33]
 gi|261750891|ref|ZP_05994600.1| NADPH quinone oxidoreductase [Brucella suis bv. 5 str. 513]
 gi|261754144|ref|ZP_05997853.1| NADPH quinone oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|265987303|ref|ZP_06099860.1| NADPH quinone oxidoreductase [Brucella pinnipedialis M292/94/1]
 gi|265998817|ref|ZP_06111374.1| NADPH quinone oxidoreductase [Brucella ceti M490/95/1]
 gi|306844727|ref|ZP_07477312.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Brucella sp.
           BO1]
 gi|148370331|gb|ABQ60310.1| alcohol dehydrogenase, zinc-containing [Brucella ovis ATCC 25840]
 gi|161336475|gb|ABX62780.1| NAD(P)H quinone oxidoreductase, PIG3 family [Brucella canis ATCC
           23365]
 gi|163676037|gb|ABY40147.1| Alcohol dehydrogenase, zinc-binding [Brucella suis ATCC 23445]
 gi|260154203|gb|EEW89285.1| alcohol dehydrogenase [Brucella suis bv. 4 str. 40]
 gi|260921442|gb|EEX88095.1| NADPH quinone oxidoreductase [Brucella ceti B1/94]
 gi|260924412|gb|EEX90980.1| NADPH quinone oxidoreductase [Brucella ceti M13/05/1]
 gi|261295074|gb|EEX98570.1| NADPH quinone oxidoreductase [Brucella ceti M644/93/1]
 gi|261295463|gb|EEX98959.1| NADPH quinone oxidoreductase [Brucella pinnipedialis B2/94]
 gi|261301755|gb|EEY05252.1| NADPH quinone oxidoreductase [Brucella neotomae 5K33]
 gi|261304924|gb|EEY08421.1| NADPH quinone oxidoreductase [Brucella pinnipedialis M163/99/10]
 gi|261740644|gb|EEY28570.1| NADPH quinone oxidoreductase [Brucella suis bv. 5 str. 513]
 gi|261743897|gb|EEY31823.1| NADPH quinone oxidoreductase [Brucella suis bv. 3 str. 686]
 gi|262553506|gb|EEZ09275.1| NADPH quinone oxidoreductase [Brucella ceti M490/95/1]
 gi|264659500|gb|EEZ29761.1| NADPH quinone oxidoreductase [Brucella pinnipedialis M292/94/1]
 gi|306274899|gb|EFM56669.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Brucella sp.
           BO1]
          Length = 334

 Score =  329 bits (843), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 221/315 (70%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G + ++  A+  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ I GLE+AG I
Sbjct: 18  GGAYMLRPAQRAVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDIPGLEIAGDI 77

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V LG     +  GD+V AL+ GGGYAEY + H+ + LP+P G+  I+AA++PE+FFTVW 
Sbjct: 78  VALGHGVKRFRKGDQVVALLAGGGYAEYAVVHESNALPLPSGFGYIEAAAIPETFFTVWH 137

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+   L+ G+  L+HGGSSGIGTTAIQLA  FGATV TTA S+EKC AC+KLGA  AI
Sbjct: 138 NVFERGGLKEGEVFLVHGGSSGIGTTAIQLAKAFGATVITTAGSKEKCDACVKLGADRAI 197

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY +EDF+ ++++ T G+G+D+ILDMVG +Y+ ++    +++G+++ I+FL G  AT  N
Sbjct: 198 NYHEEDFVAVVKEMTGGKGVDVILDMVGGDYVERNYKAAAEDGRIVQIAFLNGAKATA-N 256

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
              +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  +  L     A
Sbjct: 257 FAILMTKRLTHTGSTLRPRPVAFKAGIARELEAKVWPLLAQRRVAPVMDMIFSLKDAWRA 316

Query: 316 HDIMEKSEHIGKIIL 330
           H+ ME+  HIGKI+L
Sbjct: 317 HERMEEGRHIGKIVL 331


>gi|260167949|ref|ZP_05754760.1| zinc-binding alcohol dehydrogenase [Brucella sp. F5/99]
 gi|261757388|ref|ZP_06001097.1| alcohol dehydrogenase [Brucella sp. F5/99]
 gi|261737372|gb|EEY25368.1| alcohol dehydrogenase [Brucella sp. F5/99]
          Length = 334

 Score =  329 bits (843), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 225/324 (69%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G + ++  A+  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ I
Sbjct: 9   MTAIEITEPGGAYMLRPAQRAVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDI 68

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG IV LG     +  GD+V AL+ GGGYAEY + H+ + LP+P G+  I+AA++
Sbjct: 69  PGLEIAGDIVALGHGVKRFRKGDQVVALLAGGGYAEYAVVHESNALPLPSGFGYIEAAAI 128

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW N+F+   L+ G+  L+HGGSSGIGTTAIQLA  FGATV TTA S+EKC AC
Sbjct: 129 PETFFTVWHNVFERGGLKEGEVFLVHGGSSGIGTTAIQLAKAFGATVITTAGSKEKCDAC 188

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           +KLGA  AINY +EDF+ ++++ T G+G+D+ILDMVG +Y+ ++    +++G+++ I+FL
Sbjct: 189 VKLGADRAINYHEEDFVAVVKEMTGGKGVDVILDMVGGDYVERNYKAAAEDGRIVQIAFL 248

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  AT  N   +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  +
Sbjct: 249 NGAKATA-NFAILMTKRLTHTGSTLRPRPVAFKAGIARELEAKVWPLLAQRRVAPVMDMI 307

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L     AH+ ME+  HIGKI+L
Sbjct: 308 FSLKDTWRAHERMEEGRHIGKIVL 331


>gi|23502595|ref|NP_698722.1| alcohol dehydrogenase [Brucella suis 1330]
 gi|256370145|ref|YP_003107656.1| alcohol dehydrogenase, zinc-containing [Brucella microti CCM 4915]
 gi|23348598|gb|AAN30637.1| alcohol dehydrogenase, zinc-containing [Brucella suis 1330]
 gi|256000308|gb|ACU48707.1| alcohol dehydrogenase, zinc-containing [Brucella microti CCM 4915]
          Length = 326

 Score =  329 bits (843), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 221/315 (70%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G + ++  A+  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ I GLE+AG I
Sbjct: 10  GGAYMLRPAQRAVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDIPGLEIAGDI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V LG     +  GD+V AL+ GGGYAEY + H+ + LP+P G+  I+AA++PE+FFTVW 
Sbjct: 70  VALGHGVKRFRKGDQVVALLAGGGYAEYAVVHESNALPLPSGFGYIEAAAIPETFFTVWH 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+   L+ G+  L+HGGSSGIGTTAIQLA  FGATV TTA S+EKC AC+KLGA  AI
Sbjct: 130 NVFERGGLKEGEVFLVHGGSSGIGTTAIQLAKAFGATVITTAGSKEKCDACVKLGADRAI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY +EDF+ ++++ T G+G+D+ILDMVG +Y+ ++    +++G+++ I+FL G  AT  N
Sbjct: 190 NYHEEDFVAVVKEMTGGKGVDVILDMVGGDYVERNYKAAAEDGRIVQIAFLNGAKATA-N 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
              +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  +  L     A
Sbjct: 249 FAILMTKRLTHTGSTLRPRPVAFKAGIARELEAKVWPLLAQRRVAPVMDMIFSLKDAWRA 308

Query: 316 HDIMEKSEHIGKIIL 330
           H+ ME+  HIGKI+L
Sbjct: 309 HERMEEGRHIGKIVL 323


>gi|225628305|ref|ZP_03786339.1| quinone oxidoreductase, PIG3 family protein [Brucella ceti str.
           Cudo]
 gi|225616151|gb|EEH13199.1| quinone oxidoreductase, PIG3 family protein [Brucella ceti str.
           Cudo]
          Length = 336

 Score =  329 bits (843), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 225/324 (69%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G + ++  A+  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ I
Sbjct: 11  MTAIEITEPGGAYMLRPAQRAVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDI 70

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG IV LG     +  GD+V AL+ GGGYAEY + H+ + LP+P G+  I+AA++
Sbjct: 71  PGLEIAGDIVALGHGVKRFRKGDQVVALLAGGGYAEYAVVHESNALPLPSGFGYIEAAAI 130

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW N+F+   L+ G+  L+HGGSSGIGTTAIQLA  FGATV TTA S+EKC AC
Sbjct: 131 PETFFTVWHNVFERGGLKEGEVFLVHGGSSGIGTTAIQLAKAFGATVITTAGSKEKCDAC 190

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           +KLGA  AINY +EDF+ ++++ T G+G+D+ILDMVG +Y+ ++    +++G+++ I+FL
Sbjct: 191 VKLGADRAINYHEEDFVAVVKEMTGGKGVDVILDMVGGDYVERNYKAAAEDGRIVQIAFL 250

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  AT  N   +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  +
Sbjct: 251 NGAKATA-NFAILMTKRLTHTGSTLRPRPVAFKAGIARELEAKVWPLLAQRRVAPVMDMI 309

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L     AH+ ME+  HIGKI+L
Sbjct: 310 FSLKDTWRAHERMEEGRHIGKIVL 333


>gi|225853190|ref|YP_002733423.1| quinone oxidoreductase, PIG3 family protein [Brucella melitensis
           ATCC 23457]
 gi|256263318|ref|ZP_05465850.1| alcohol dehydrogenase [Brucella melitensis bv. 2 str. 63/9]
 gi|225641555|gb|ACO01469.1| quinone oxidoreductase, PIG3 family protein [Brucella melitensis
           ATCC 23457]
 gi|263093317|gb|EEZ17386.1| alcohol dehydrogenase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409749|gb|ADZ66814.1| quinone oxidoreductase, PIG3 family protein [Brucella melitensis
           M28]
          Length = 334

 Score =  328 bits (842), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 221/315 (70%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G + ++  A+  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ I GLE+AG I
Sbjct: 18  GGAYMLRPAQRAVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDIPGLEIAGDI 77

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V LG     +  GD+V AL+ GGGYAEY + H+ + LP+P G+  I+AA++PE+FFTVW 
Sbjct: 78  VALGHGVKRFRKGDQVVALLAGGGYAEYAVVHESNALPLPSGFGYIEAAAIPETFFTVWH 137

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+   L+ G+  L+HGGSSGIGTTAIQLA  FGATV TTA S+EKC AC+KLGA  AI
Sbjct: 138 NVFERGGLKEGEVFLVHGGSSGIGTTAIQLAKAFGATVITTAGSKEKCDACVKLGADRAI 197

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY +EDF+ ++++ T G+G+D+ILDMVG +Y+ ++    +++G+++ I+FL G  AT  N
Sbjct: 198 NYHEEDFVAVVKEMTGGKGVDVILDMVGGDYVERNYKAAAEDGRIMQIAFLNGAKAT-TN 256

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
              +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  +  L     A
Sbjct: 257 FAILMTKRLTHTGSTLRPRPVAFKAGIARELEAKVWPLLAQRRVAPVMDMIFSLKDAWRA 316

Query: 316 HDIMEKSEHIGKIIL 330
           H+ ME+  HIGKI+L
Sbjct: 317 HERMEEGRHIGKIVL 331


>gi|17546784|ref|NP_520186.1| NADPH quinone oxidoreductase oxidoreductase [Ralstonia solanacearum
           GMI1000]
 gi|17429084|emb|CAD15772.1| putative nadph quinone oxidoreductase oxidoreductase protein
           [Ralstonia solanacearum GMI1000]
          Length = 334

 Score =  328 bits (842), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 223/333 (66%), Gaps = 11/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + ++ YG  +V+  AE P+P+P+  E+LI+V A GVNRPDV QR G YP P  A+ I
Sbjct: 1   MRAIEITQYGGPDVLKPAERPMPEPKAGEVLIRVRAAGVNRPDVFQRTGNYPVPPGASDI 60

Query: 67  LGLEVAGKIV--DLGENTTHWNI--GDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV  DL      + +  GD VCALV GGGYAE+C +  G  LP+P G + I+
Sbjct: 61  PGLEVAGEIVGGDLAHADNRYGLRAGDRVCALVQGGGYAEFCTAPLGQVLPVPAGLSDIE 120

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE++FTVW+N+F    L  G     +T+L+ GGSSGIGTTAIQ+AS  G  V+ TA
Sbjct: 121 AAALPENYFTVWSNVFDRGQLGQGAHGKGETLLVQGGSSGIGTTAIQMASALGYRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S+EKC AC+ LGA  AI Y  EDF E+++ ET GRG+D++LDMVG  Y+ + +   + +
Sbjct: 181 GSDEKCAACVALGAARAIRYRTEDFAEVVKAET-GRGVDVVLDMVGGSYVAREIACTADD 239

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+ L  I+ +RIT+TGSTLR R    K +I   L   +WPLL S 
Sbjct: 240 GRIVLIALLGGAKA-EVPLGEILRRRITLTGSTLRPRPVAFKAAIAAHLHDTVWPLLASG 298

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PVIH V+P    A AH +ME S HIGKI+L
Sbjct: 299 RIRPVIHEVMPAEHAAQAHALMESSAHIGKIML 331


>gi|254694395|ref|ZP_05156223.1| quinone oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|256045345|ref|ZP_05448239.1| quinone oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256114304|ref|ZP_05455046.1| quinone oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|260565763|ref|ZP_05836246.1| alcohol dehydrogenase [Brucella melitensis bv. 1 str. 16M]
 gi|261214705|ref|ZP_05928986.1| NADPH quinone oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|265991768|ref|ZP_06104325.1| NADPH quinone oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995607|ref|ZP_06108164.1| NADPH quinone oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|260151136|gb|EEW86231.1| alcohol dehydrogenase [Brucella melitensis bv. 1 str. 16M]
 gi|260916312|gb|EEX83173.1| NADPH quinone oxidoreductase [Brucella abortus bv. 3 str. Tulya]
 gi|262766891|gb|EEZ12509.1| NADPH quinone oxidoreductase [Brucella melitensis bv. 3 str. Ether]
 gi|263002724|gb|EEZ15127.1| NADPH quinone oxidoreductase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 334

 Score =  328 bits (842), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 221/315 (70%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G + ++  A+  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ I GLE+AG I
Sbjct: 18  GGAYMLRPAQRAVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDIPGLEIAGDI 77

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V LG     +  GD+V AL+ GGGYAEY + H+ + LP+P G+  I+AA++PE+FFTVW 
Sbjct: 78  VALGHGVKRFRKGDQVVALLAGGGYAEYAVVHESNALPLPSGFGYIEAAAIPETFFTVWH 137

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+   L+ G+  L+HGGSSGIGTTAIQLA  FGATV TTA S+EKC AC+KLGA  AI
Sbjct: 138 NVFERGGLKEGEVFLVHGGSSGIGTTAIQLAKAFGATVITTAGSKEKCDACVKLGADRAI 197

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY +EDF+ ++++ T G+G+D+ILDMVG +Y+ ++    +++G+++ I+FL G  AT  N
Sbjct: 198 NYHEEDFVAVVKEMTGGKGVDVILDMVGGDYVERNYKAAAEDGRIMQIAFLNGAKATA-N 256

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
              +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  +  L     A
Sbjct: 257 FAILMTKRLTHTGSTLRPRPVAFKAGIARELEAKVWPLLAQRRVAPVMDMIFSLKDAWRA 316

Query: 316 HDIMEKSEHIGKIIL 330
           H+ ME+  HIGKI+L
Sbjct: 317 HERMEEGRHIGKIVL 331


>gi|17986585|ref|NP_539219.1| quinone oxidoreductase [Brucella melitensis bv. 1 str. 16M]
 gi|17982195|gb|AAL51483.1| quinone oxidoreductase [Brucella melitensis bv. 1 str. 16M]
          Length = 336

 Score =  328 bits (842), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 221/315 (70%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G + ++  A+  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ I GLE+AG I
Sbjct: 20  GGAYMLRPAQRAVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDIPGLEIAGDI 79

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V LG     +  GD+V AL+ GGGYAEY + H+ + LP+P G+  I+AA++PE+FFTVW 
Sbjct: 80  VALGHGVKRFRKGDQVVALLAGGGYAEYAVVHESNALPLPSGFGYIEAAAIPETFFTVWH 139

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+   L+ G+  L+HGGSSGIGTTAIQLA  FGATV TTA S+EKC AC+KLGA  AI
Sbjct: 140 NVFERGGLKEGEVFLVHGGSSGIGTTAIQLAKAFGATVITTAGSKEKCDACVKLGADRAI 199

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY +EDF+ ++++ T G+G+D+ILDMVG +Y+ ++    +++G+++ I+FL G  AT  N
Sbjct: 200 NYHEEDFVAVVKEMTGGKGVDVILDMVGGDYVERNYKAAAEDGRIMQIAFLNGAKATA-N 258

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
              +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  +  L     A
Sbjct: 259 FAILMTKRLTHTGSTLRPRPVAFKAGIARELEAKVWPLLAQRRVAPVMDMIFSLKDAWRA 318

Query: 316 HDIMEKSEHIGKIIL 330
           H+ ME+  HIGKI+L
Sbjct: 319 HERMEEGRHIGKIVL 333


>gi|299066330|emb|CBJ37514.1| putative NADPH:quinone reductase (Cryz) [Ralstonia solanacearum
           CMR15]
          Length = 334

 Score =  328 bits (841), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 225/333 (67%), Gaps = 11/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + ++ YG  +V+  AE P+P+P+  E+LI+V A GVNRPDV QR G YP P  A+ I
Sbjct: 1   MRAIEITQYGGPDVLKPAERPMPEPKAGEVLIRVRAAGVNRPDVFQRTGNYPVPPGASDI 60

Query: 67  LGLEVAGKIV--DLGENTTHWNI--GDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV  DL      + +  GD VCALV GGGYAE+C +  G  LP+P G + I+
Sbjct: 61  PGLEVAGEIVGGDLAHADNRYGLRAGDRVCALVQGGGYAEFCTAPLGQVLPVPAGLSDIE 120

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE++FTVW+N+F    L  G     +T+L+ GGSSGIGTTAIQ+AS  G  V+ TA
Sbjct: 121 AAALPENYFTVWSNVFDRGQLGQGAHGKGETLLVQGGSSGIGTTAIQMASALGYRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S+EKC AC++LGA  AI+Y  EDF E+++ ET GRG+D++LDMVG  Y+ + +   + +
Sbjct: 181 GSDEKCAACVELGAARAIHYKTEDFAEVVKAET-GRGVDVVLDMVGGSYVAREIACTADD 239

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+ L  I+ +RIT+TGSTLR R    K +I   L   +WPLL S 
Sbjct: 240 GRIVLIALLGGAKA-EVPLGDILRRRITLTGSTLRPRPVAFKAAIAAHLHDTVWPLLASG 298

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PVIH V+P    A AH +ME S HIGKI+L
Sbjct: 299 RIRPVIHEVMPTEHAAQAHALMESSAHIGKIML 331


>gi|332285103|ref|YP_004417014.1| putative NADPH quinone oxidoreductase, zinc binding protein
           [Pusillimonas sp. T7-7]
 gi|330429056|gb|AEC20390.1| putative NADPH quinone oxidoreductase, zinc binding protein
           [Pusillimonas sp. T7-7]
          Length = 325

 Score =  328 bits (841), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 220/324 (67%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +S  G   V+ L + P+P+ +  E+LIKV A G+NRPDV QRKG YPPP  A+ +
Sbjct: 1   MKAVEISKPGGPEVLVLVDRPVPELKPGEVLIKVSAAGINRPDVFQRKGNYPPPAGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV G+IV      T   IGD+VCALV GGGYAEYC +     LPIPKG + ++AA L
Sbjct: 61  PGLEVVGEIVSGETGDTGLAIGDKVCALVAGGGYAEYCAAPAAQCLPIPKGLSDVEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+++TVW N+F    L +G+++L+HGG+SGIGTTA+QLA+  G  VY T  S+E+  A 
Sbjct: 121 PETYYTVWTNVFDRGRLSAGESLLVHGGASGIGTTAVQLATAMGNKVYATVGSDERVRAV 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+  INY  +D++E ++K T G+G+D++LDMV  +Y+N+++  L+ +G+++II+ L
Sbjct: 181 EGLGAEQGINYRTQDYVEEVKKATNGKGVDVVLDMVAGDYINRNINCLADDGRIVIIALL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  AT I+ N ++ +R+T+TGSTLR R    K  I  SL+  +WPLL S  I P++H  
Sbjct: 241 GGAKAT-IDCNQVLRRRLTVTGSTLRPRPVAFKADIAQSLKTHVWPLLESGKIRPIVHAT 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL +   AH +M+  E IGKIIL
Sbjct: 300 FPLERACDAHAMMDAGEQIGKIIL 323


>gi|134093618|ref|YP_001098693.1| putative oxidoreductase [Herminiimonas arsenicoxydans]
 gi|133737521|emb|CAL60564.1| Zinc-binding dehydrogenase superfamily (quinone oxidoreductase,
           NADPH dependent) [Herminiimonas arsenicoxydans]
          Length = 325

 Score =  328 bits (841), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 221/324 (68%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + ++  G  +V+ L E P+P+P+  E+LIKV A G+NRPDV QR G Y  PK A+ I
Sbjct: 1   MRAIEITQPGPPDVLKLCERPMPEPKAGELLIKVHAAGINRPDVWQRLGSYAVPKGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG++V      + + IGD VCAL  GGGYAEYC +     LPIPKG + ++AASL
Sbjct: 61  PGLEIAGEVVGGDLADSGFKIGDMVCALAQGGGYAEYCTAPVEQCLPIPKGLDVVEAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    L   +T+L+ GG+SGIG TAIQ+A+  G  V+ TA S+EKC AC
Sbjct: 121 PETFFTVWSNVFDRVGLTGNETLLVQGGTSGIGVTAIQIATALGHRVFATAGSDEKCRAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+  INY  EDF+E+++  T G+G+D+ILD++G +Y+ + +  L+ +G+L+ I+  
Sbjct: 181 EVLGAERGINYKTEDFVEVVKAATNGKGVDVILDIIGGDYVAREINCLADDGRLVFIALA 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GGN AT ++L  ++ +R+TITGSTLR R    K +I D L+ K+WPL+ +  I PV++  
Sbjct: 241 GGNKAT-LSLGQVMMRRLTITGSTLRARPVAFKAAIADQLRTKVWPLIEAGKIKPVVYQT 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   A AH +ME S HIGKI+L
Sbjct: 300 FALEDAAQAHALMESSTHIGKIVL 323


>gi|332286062|ref|YP_004417973.1| putative NADPH quinone oxidoreductase [Pusillimonas sp. T7-7]
 gi|330430015|gb|AEC21349.1| putative NADPH quinone oxidoreductase [Pusillimonas sp. T7-7]
          Length = 333

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 215/315 (68%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G ++ M ++E  IPQP   ++LI V   GVNRPD++QR GLYPPP  A+P LGLEV+G I
Sbjct: 14  GAASCMQISEREIPQPAGRQVLIAVHYAGVNRPDILQRSGLYPPPPGASPYLGLEVSGII 73

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
              G +     IGD+VCAL  GGGYAEYCL+ + H LP+PKG + + AA +PE++FTVW 
Sbjct: 74  TAAGPDVQDHKIGDKVCALTPGGGYAEYCLADERHCLPVPKGLDMVSAACIPENYFTVWT 133

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+   L  G+  L+HGGSSGIG TAIQLA  FGA V+TT  + EK  AC K GA H I
Sbjct: 134 NVFERGRLLKGEKFLVHGGSSGIGLTAIQLAHAFGAEVWTTVGNAEKAEACRKAGASHTI 193

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
            Y ++DF E++ K+T   G+D+ILDMVG EY+N+++  L+  G+L+ I+FL G+    I+
Sbjct: 194 LYKEQDFQEVILKDTDRYGMDVILDMVGGEYINRNIHTLALNGRLVQIAFLQGS-KDRID 252

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
             P+++KR+T TGSTLR R+D  K  I  +L   + PL+      PVIH+V P+ +V  A
Sbjct: 253 ATPVMTKRLTFTGSTLRPRSDEDKGQIAQALIEHVVPLMEQGRCTPVIHSVFPMHEVEKA 312

Query: 316 HDIMEKSEHIGKIIL 330
           H++ME S+HIGKI L
Sbjct: 313 HELMESSKHIGKIAL 327


>gi|237816113|ref|ZP_04595109.1| NAD(P)H quinone oxidoreductase, PIG3 family [Brucella abortus str.
           2308 A]
 gi|237788776|gb|EEP62988.1| NAD(P)H quinone oxidoreductase, PIG3 family [Brucella abortus str.
           2308 A]
          Length = 336

 Score =  327 bits (838), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 221/315 (70%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G + ++  A+  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ I GLE+AG I
Sbjct: 20  GGAYMLRPAQRAVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDIPGLEIAGDI 79

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V LG     +  GD+V AL+ GGGYAEY + H+ + LP+P G+  I+AA++PE+FFTVW 
Sbjct: 80  VALGHGVKRFRKGDQVVALLAGGGYAEYAVVHESNALPLPSGFGYIEAAAIPETFFTVWH 139

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+   L+ G+  L+HGGSSGIGTTAIQLA  FGATV TTA S+EKC AC+KLGA  AI
Sbjct: 140 NVFERGWLKEGEVFLVHGGSSGIGTTAIQLAKAFGATVITTAGSKEKCDACVKLGADRAI 199

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY +EDF+ ++++ T G+G+D+ILDMVG +Y+ ++    +++G+++ I+FL G  AT  N
Sbjct: 200 NYHEEDFVAVVKEMTGGKGVDVILDMVGGDYVERNYKAAAEDGRIMQIAFLNGAKATA-N 258

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
              +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  +  L     A
Sbjct: 259 FAILMTKRLTHTGSTLRPRPVAFKAGIARELEAKVWPLLAQRRVAPVMDMIFSLKDAWRA 318

Query: 316 HDIMEKSEHIGKIIL 330
           H+ ME+  HIGKI+L
Sbjct: 319 HERMEEGRHIGKIVL 333


>gi|62290610|ref|YP_222403.1| alcohol dehydrogenase [Brucella abortus bv. 1 str. 9-941]
 gi|189024826|ref|YP_001935594.1| alcohol dehydrogenase, zinc-containing [Brucella abortus S19]
 gi|254689903|ref|ZP_05153157.1| alcohol dehydrogenase, zinc-containing [Brucella abortus bv. 6 str.
           870]
 gi|254698053|ref|ZP_05159881.1| alcohol dehydrogenase, zinc-containing [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730937|ref|ZP_05189515.1| alcohol dehydrogenase, zinc-containing [Brucella abortus bv. 4 str.
           292]
 gi|256258157|ref|ZP_05463693.1| alcohol dehydrogenase, zinc-containing [Brucella abortus bv. 9 str.
           C68]
 gi|260547150|ref|ZP_05822888.1| alcohol dehydrogenase [Brucella abortus NCTC 8038]
 gi|260755435|ref|ZP_05867783.1| NADPH quinone oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|260758657|ref|ZP_05871005.1| NADPH quinone oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260762489|ref|ZP_05874826.1| NADPH quinone oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884451|ref|ZP_05896065.1| NADPH quinone oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|297249005|ref|ZP_06932713.1| NADPH2:quinone reductase [Brucella abortus bv. 5 str. B3196]
 gi|62196742|gb|AAX75042.1| alcohol dehydrogenase, zinc-containing [Brucella abortus bv. 1 str.
           9-941]
 gi|189020398|gb|ACD73120.1| alcohol dehydrogenase, zinc-containing [Brucella abortus S19]
 gi|260095515|gb|EEW79393.1| alcohol dehydrogenase [Brucella abortus NCTC 8038]
 gi|260668975|gb|EEX55915.1| NADPH quinone oxidoreductase [Brucella abortus bv. 4 str. 292]
 gi|260672915|gb|EEX59736.1| NADPH quinone oxidoreductase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675543|gb|EEX62364.1| NADPH quinone oxidoreductase [Brucella abortus bv. 6 str. 870]
 gi|260873979|gb|EEX81048.1| NADPH quinone oxidoreductase [Brucella abortus bv. 9 str. C68]
 gi|297174138|gb|EFH33495.1| NADPH2:quinone reductase [Brucella abortus bv. 5 str. B3196]
          Length = 334

 Score =  327 bits (838), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 221/315 (70%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G + ++  A+  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ I GLE+AG I
Sbjct: 18  GGAYMLRPAQRAVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDIPGLEIAGDI 77

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V LG     +  GD+V AL+ GGGYAEY + H+ + LP+P G+  I+AA++PE+FFTVW 
Sbjct: 78  VALGHGVKRFRKGDQVVALLAGGGYAEYAVVHESNALPLPSGFGYIEAAAIPETFFTVWH 137

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+   L+ G+  L+HGGSSGIGTTAIQLA  FGATV TTA S+EKC AC+KLGA  AI
Sbjct: 138 NVFERGWLKEGEVFLVHGGSSGIGTTAIQLAKAFGATVITTAGSKEKCDACVKLGADRAI 197

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY +EDF+ ++++ T G+G+D+ILDMVG +Y+ ++    +++G+++ I+FL G  AT  N
Sbjct: 198 NYHEEDFVAVVKEMTGGKGVDVILDMVGGDYVERNYKAAAEDGRIMQIAFLNGAKATA-N 256

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
              +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  +  L     A
Sbjct: 257 FAILMTKRLTHTGSTLRPRPVAFKAGIARELEAKVWPLLAQRRVAPVMDMIFSLKDAWRA 316

Query: 316 HDIMEKSEHIGKIIL 330
           H+ ME+  HIGKI+L
Sbjct: 317 HERMEEGRHIGKIVL 331


>gi|82700526|ref|YP_415100.1| glucose/ribitol dehydrogenase [Brucella melitensis biovar Abortus
           2308]
 gi|82616627|emb|CAJ11706.1| Zinc-containing alcohol dehydrogenase superfamily:Glucose/ribitol
           dehydrogenase [Brucella melitensis biovar Abortus 2308]
          Length = 326

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 221/315 (70%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G + ++  A+  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ I GLE+AG I
Sbjct: 10  GGAYMLRPAQRAVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDIPGLEIAGDI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V LG     +  GD+V AL+ GGGYAEY + H+ + LP+P G+  I+AA++PE+FFTVW 
Sbjct: 70  VALGHGVKRFRKGDQVVALLAGGGYAEYAVVHESNALPLPSGFGYIEAAAIPETFFTVWH 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+   L+ G+  L+HGGSSGIGTTAIQLA  FGATV TTA S+EKC AC+KLGA  AI
Sbjct: 130 NVFERGWLKEGEVFLVHGGSSGIGTTAIQLAKAFGATVITTAGSKEKCDACVKLGADRAI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY +EDF+ ++++ T G+G+D+ILDMVG +Y+ ++    +++G+++ I+FL G  AT  N
Sbjct: 190 NYHEEDFVAVVKEMTGGKGVDVILDMVGGDYVERNYKAAAEDGRIMQIAFLNGAKATA-N 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
              +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  +  L     A
Sbjct: 249 FAILMTKRLTHTGSTLRPRPVAFKAGIARELEAKVWPLLAQRRVAPVMDMIFSLKDAWRA 308

Query: 316 HDIMEKSEHIGKIIL 330
           H+ ME+  HIGKI+L
Sbjct: 309 HERMEEGRHIGKIVL 323


>gi|56695153|ref|YP_165500.1| alcohol dehydrogenase, zinc-containing [Ruegeria pomeroyi DSS-3]
 gi|56676890|gb|AAV93556.1| alcohol dehydrogenase, zinc-containing [Ruegeria pomeroyi DSS-3]
          Length = 327

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 157/328 (47%), Positives = 226/328 (68%), Gaps = 4/328 (1%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + ++MR V +S  G   V+ L + P P+P   ++LIKV   GVNRPD +QR G Y PP  
Sbjct: 1   MSQQMRAVEISRPGGPEVLQLTQRPRPEPGHGQVLIKVAYAGVNRPDALQRAGAYDPPPG 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE +G++V +G       +GD+VCAL+ GGGYA+Y ++   H LP+P+G    +
Sbjct: 61  ASDLPGLECSGEVVAVGPGAEDVAVGDKVCALLPGGGYADYVVTPAAHCLPVPQGMALRE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA LPE+FFTVW+N+F    L++G+  L+HGGSSGIGTTAIQLA  FGA V+ TA S++K
Sbjct: 121 AACLPETFFTVWSNVFTRGGLKAGERFLVHGGSSGIGTTAIQLAHAFGARVFATAGSDDK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C ACL LGA+ AINY  EDF+++++ E    G D+ILDMVG +Y+ +++  L+++G+L+ 
Sbjct: 181 CRACLDLGAERAINYRDEDFVKVMRSEG---GADLILDMVGGDYIPRNVKALAEDGRLVQ 237

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+FL G +  E+N   ++ KR+T+TGSTLR ++D+AK  I   L+  +WPLL++  IAPV
Sbjct: 238 IAFLQGPV-VELNFALMMVKRLTLTGSTLRPQSDLAKADIARDLREAVWPLLDAGRIAPV 296

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           + +   LG  A AH  ME S HIGKI+L
Sbjct: 297 MDSEFDLGDAAAAHARMESSGHIGKIVL 324


>gi|121604327|ref|YP_981656.1| alcohol dehydrogenase [Polaromonas naphthalenivorans CJ2]
 gi|120593296|gb|ABM36735.1| Alcohol dehydrogenase, zinc-binding domain protein [Polaromonas
           naphthalenivorans CJ2]
          Length = 328

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 226/327 (69%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+P   E+LI+V A GVNRPDV+QR G YP P  A+ I
Sbjct: 1   MQVIEITSFGAPDVLQLGERPDPEPAAGEVLIRVAASGVNRPDVLQRTGNYPVPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTH---WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
            GLEVAG+I+             IGD VCALV GGGYA  C++  G  LP+P+G + +QA
Sbjct: 61  PGLEVAGEIIAGDAQAMAAAGLKIGDRVCALVAGGGYAGLCVAPVGQCLPVPEGLSDVQA 120

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           ASLPE+FFTVW+N+F+ A+L+ G+T+L+ GGSSGIG TAIQ+A   GATV  TA S+EKC
Sbjct: 121 ASLPETFFTVWSNVFERAHLQKGETLLVQGGSSGIGVTAIQIAKAIGATVLVTAGSDEKC 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
            AC+ LGA HAINY   +F+E ++K T G+G+D+ILDMVG  Y+ + +  L+++G+L+II
Sbjct: 181 AACVALGADHAINYKTGEFVEEVKKLTNGQGVDVILDMVGGSYVAREVQCLAEDGRLVII 240

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           +  GG +  E N   ++ KR+TITGSTLR R+   K +I  +L+ KIWPL+ S  I PVI
Sbjct: 241 AVQGG-VKAEFNAGLVLRKRLTITGSTLRPRSLEFKTAIAMALKEKIWPLIASGAIKPVI 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           H+       A AH +ME ++HIGKI+L
Sbjct: 300 HSTFAAADAAKAHTLMESNQHIGKIVL 326


>gi|254719737|ref|ZP_05181548.1| zinc-binding alcohol dehydrogenase [Brucella sp. 83/13]
 gi|265984752|ref|ZP_06097487.1| NADPH quinone oxidoreductase [Brucella sp. 83/13]
 gi|306839930|ref|ZP_07472726.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Brucella sp.
           NF 2653]
 gi|306841455|ref|ZP_07474156.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Brucella sp.
           BO2]
 gi|264663344|gb|EEZ33605.1| NADPH quinone oxidoreductase [Brucella sp. 83/13]
 gi|306288493|gb|EFM59848.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Brucella sp.
           BO2]
 gi|306404997|gb|EFM61280.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Brucella sp.
           NF 2653]
          Length = 334

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 221/315 (70%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G + ++  A+  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ I GLE+AG I
Sbjct: 18  GGAYMLRPAQRAVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDIPGLEIAGDI 77

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V LG     +  GD+V AL+ GGGYAEY + H+ + LP+P G+  I+AA++PE+FFTVW 
Sbjct: 78  VALGHGVKRFRKGDQVVALLAGGGYAEYAVVHESNALPLPSGFGYIEAAAIPETFFTVWH 137

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+   L+ G+  L+HGGSSGIGTTAIQLA  FGATV TTA S+EKC AC+KLGA  AI
Sbjct: 138 NVFERGGLKEGEVFLVHGGSSGIGTTAIQLAKAFGATVITTAGSKEKCDACVKLGADRAI 197

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY +EDF+ ++++ T G+G+++ILDMVG +Y+ ++    +++G+++ I+FL G  AT  N
Sbjct: 198 NYHEEDFVAVVKEMTGGKGVNVILDMVGGDYVERNYKAAAEDGRIVQIAFLNGAKATA-N 256

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
              +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  +  L     A
Sbjct: 257 FAILMTKRLTHTGSTLRPRPVAFKAGIARELEAKVWPLLAQRRVAPVMDMIFSLKDAWRA 316

Query: 316 HDIMEKSEHIGKIIL 330
           H+ ME+  HIGKI+L
Sbjct: 317 HERMEEGRHIGKIVL 331


>gi|307730343|ref|YP_003907567.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp.
           CCGE1003]
 gi|307584878|gb|ADN58276.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp.
           CCGE1003]
          Length = 338

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 162/333 (48%), Positives = 222/333 (66%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G   V+ LAE P PQP+  E+LIKV A G+NRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPEVLKLAERPTPQPKAGEVLIKVTAFGINRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV    D   N     IGD VCAL+ GGGYAE+  +     LP+P G + ++
Sbjct: 61  PGLEVAGEIVGGDIDAKNNPFGLKIGDRVCALLAGGGYAEFAAAPLLQCLPVPNGLSDVE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AASLPE+FFTVW+N+F  A L  G+     T+L+ GGSSGIG TAIQ+A   G  V+ TA
Sbjct: 121 AASLPETFFTVWSNVFDRAQLGKGEGGANETLLVQGGSSGIGVTAIQIAHALGFRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S+EKC AC  LGA+ AINY  EDF+E+++  T  RG+D++LDMV   Y+++ LT L+  
Sbjct: 181 GSDEKCRACEALGAERAINYKTEDFVEVIKSLTNDRGVDVVLDMVAGSYVSRELTALADG 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+NLN ++ +R+T+TGSTLR R    K  I   L+ ++WP L + 
Sbjct: 241 GRIVLIALLGGAKA-ELNLNEVLRRRLTLTGSTLRPRPVEFKAKIAAQLKEQVWPHLEAG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PV+H V P  + A AH +ME S H+GKI+L
Sbjct: 300 RIKPVVHRVFPAAEAADAHTLMESSTHVGKIVL 332


>gi|312115894|ref|YP_004013490.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311221023|gb|ADP72391.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 325

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 223/324 (68%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +   G  +V+ L + P P+P+ +E+LI+V A GVNRPDV+QR+GLYPPP  A+ I
Sbjct: 1   MKTILIREPGGPDVLSLEDVPAPEPKADEVLIEVAAAGVNRPDVLQRQGLYPPPPGASNI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+GKI  +G + T W  GD V AL +GGGYAEY ++ +G  L +PKG +  + A L
Sbjct: 61  PGLEVSGKIAAVGASVTRWKAGDTVAALTSGGGYAEYAVAQEGSCLRVPKGLSMAEGACL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+F TVW N+F+   L++G+  L+HGGSSGIG+TAIQLA++FGA V+ TA S+EKC  C
Sbjct: 121 PETFMTVWHNVFERGALKAGECFLVHGGSSGIGSTAIQLATHFGARVFATAGSDEKCAYC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+ AINY  ++F E ++  T G+G+++ILDMVG  Y+   +   +++G+++ I+FL
Sbjct: 181 ESLGAEAAINYRTKNFAEEIKTLTCGKGVNVILDMVGGSYIQDDIRCAAEDGRIVQIAFL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    E+NL PI+ KR+T+TGSTLR R+   K  +  +L+ K+WPL+ S  +  VI   
Sbjct: 241 KG-AKVEVNLMPIMLKRLTLTGSTLRPRSAAFKAQLARTLEEKVWPLIESGAVRVVIDKS 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH  ME + H+GKI+L
Sbjct: 300 FPLAEAAQAHRHMETNAHMGKIVL 323


>gi|154245566|ref|YP_001416524.1| quinone oxidoreductase putative PIG3 [Xanthobacter autotrophicus
           Py2]
 gi|154159651|gb|ABS66867.1| Quinone oxidoreductase putative PIG3 [Xanthobacter autotrophicus
           Py2]
          Length = 336

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 162/333 (48%), Positives = 224/333 (67%), Gaps = 4/333 (1%)

Query: 1   MPICK---KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLY 57
           MP+ +    MR    +G G   V+ +  +P+P+P   ++L++V A GVNRPD +QR G Y
Sbjct: 1   MPVVEIPSSMRQARFTGAGGPEVIAIETAPVPRPGPGQVLVEVVAAGVNRPDCLQRAGNY 60

Query: 58  PPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKG 117
           PPP  A  I GLE+AG++V LGE      IGDEVCALV  GGYAEYC++     LPIPK 
Sbjct: 61  PPPPGATEIPGLEIAGRVVALGEGVDSLKIGDEVCALVISGGYAEYCVAEAPLCLPIPKP 120

Query: 118 YNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
            + ++AA LPE+++TV+ N+F    L++G+T+LIHGGSSGIG+TAIQLA + GA V  TA
Sbjct: 121 LSLLEAAGLPENYYTVYDNVFTRGRLKAGETILIHGGSSGIGSTAIQLAHHAGARVIATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S EKC  CLKLGA  AI+Y  +DF+  ++  T GRG+D ILDMVG  Y+ ++L  L+ E
Sbjct: 181 GSPEKCDFCLKLGADAAIDYRAKDFVAEVKALTDGRGVDEILDMVGGPYVARNLQALAVE 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G+L+ I+FL  +  T I+L P++ KR+T TGSTLR R+   K +I ++L+  +WPLL + 
Sbjct: 241 GRLVQIAFLQPSEVT-IDLMPVMLKRLTFTGSTLRARSVALKSAIAEALKRDVWPLLEAG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I P +H   PL +   AH +ME S H+GKI+L
Sbjct: 300 KIKPFVHATFPLEQAREAHALMESSAHLGKIML 332


>gi|149916409|ref|ZP_01904928.1| alcohol dehydrogenase, zinc-containing [Roseobacter sp. AzwK-3b]
 gi|149809679|gb|EDM69533.1| alcohol dehydrogenase, zinc-containing [Roseobacter sp. AzwK-3b]
          Length = 327

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 161/324 (49%), Positives = 227/324 (70%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  V ++  G  +V+ L   P+P P   +++IKV   GVNRPD +QR GLY PP  A+ +
Sbjct: 5   MNAVEITEPGGPDVLRLTSRPVPAPTAGDVVIKVTYAGVNRPDALQRAGLYAPPPTASDL 64

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG+IV +G++ + W++GD+VCAL+ GGGYAEY  +   H LPIP+G    +AA L
Sbjct: 65  PGLEAAGEIVAIGDSVSDWSVGDKVCALLPGGGYAEYVATPAAHCLPIPEGMGLREAACL 124

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    L++G+  L+HGGSSGIGTTAIQLA+ FGA V+TTA S+EKC  C
Sbjct: 125 PETFFTVWSNVFGRGGLKAGERFLVHGGSSGIGTTAIQLANAFGARVFTTAGSDEKCAKC 184

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           + LGA+ AINY  EDF+++++ E    G D+ILDMVG +YL +++  L+ +G+L+ I+FL
Sbjct: 185 VDLGAERAINYRNEDFVDVMRAEG---GADLILDMVGGDYLPRNVKCLADDGRLVQIAFL 241

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    E+N   ++ +R+TITGSTLR ++D AK  I ++L+  +WPLL S  +APV+ + 
Sbjct: 242 QGP-KVELNFAQVMMRRLTITGSTLRPQSDQAKAMIAEALRAHVWPLLASGQVAPVMDSE 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   A+AH  MEKS HIGKI+L
Sbjct: 301 YELANAALAHAHMEKSTHIGKIVL 324


>gi|259417379|ref|ZP_05741298.1| alcohol dehydrogenase, zinc-binding [Silicibacter sp. TrichCH4B]
 gi|259346285|gb|EEW58099.1| alcohol dehydrogenase, zinc-binding [Silicibacter sp. TrichCH4B]
          Length = 334

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 224/326 (68%), Gaps = 4/326 (1%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + MR V +S +G  NV+ + E P+P+    +++I+V   GVNRPD +QR G Y PPK A+
Sbjct: 7   QTMRAVEISEFGAPNVLKMVERPVPEVAHGQVVIRVAYAGVNRPDALQRAGAYAPPKGAS 66

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            + GLE +G+IV +G     W+IGD+VCAL+ GGGYAEY  +   H LP+P+G +  +AA
Sbjct: 67  DLPGLEASGEIVAIGAGVAGWSIGDQVCALLPGGGYAEYVATPAAHCLPLPEGVSLKEAA 126

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
            LPE+ FTVW+N+     L +G+  L+HGGSSGIGTTAIQLAS  GA VY TA S++KC 
Sbjct: 127 CLPETCFTVWSNVVTRGGLAAGERFLVHGGSSGIGTTAIQLASALGARVYATAGSDDKCA 186

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC+ LGA  AINY  EDF+EI++ +    G ++ILDMVG +Y+ +++  L+ EG+L+ I+
Sbjct: 187 ACVGLGADVAINYRDEDFVEIMKADG---GANLILDMVGGDYIPRNIKALADEGRLVHIA 243

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FL G  A E+N   I+++R+T+TGSTLR ++D+AK  I   L   +WPL+ +  + PV+ 
Sbjct: 244 FLQGPKA-ELNFAQIMARRLTVTGSTLRPQSDLAKARIARDLLEAVWPLIAAGKLRPVMD 302

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +  PL + A+AH  ME S HIGKI+L
Sbjct: 303 STFPLAEAAIAHARMEGSTHIGKIVL 328


>gi|207742732|ref|YP_002259124.1| nadph quinone oxidoreductase protein [Ralstonia solanacearum
           IPO1609]
 gi|206594126|emb|CAQ61053.1| nadph quinone oxidoreductase protein [Ralstonia solanacearum
           IPO1609]
          Length = 334

 Score =  326 bits (835), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 166/333 (49%), Positives = 223/333 (66%), Gaps = 11/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ YG  +V+  AE P+P+P   E+LI+V A GVNRPDV QR G YP P  A+ I
Sbjct: 1   MKAIEITQYGGPDVLKPAERPMPEPGAGEVLIRVRAAGVNRPDVFQRTGNYPVPPGASDI 60

Query: 67  LGLEVAGKIV--DLGENTTHWNI--GDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+I+  DL      + +  GD VCALV GGGYAE+C +  G  LP+P G + I+
Sbjct: 61  PGLEVAGEIIGGDLAHADNRYGLKAGDRVCALVQGGGYAEFCTAPLGQVLPVPAGLSDIE 120

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE++FTVW+N+F    L  G     +T+L+ GGSSGIGTTAIQ+AS  G  V++TA
Sbjct: 121 AAALPENYFTVWSNVFDRGQLGQGAHGRDETLLVQGGSSGIGTTAIQMASALGYRVFSTA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S EKC AC++LGA  AI Y  EDF EI++ ET GRG+D++LDMVG  Y+ + +   + +
Sbjct: 181 GSAEKCTACVELGASRAIQYKTEDFAEIVKAET-GRGVDVVLDMVGGAYVAREIACTADD 239

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+ L  I+ +RIT+TGSTLR R    K +I   L   +WPLL S 
Sbjct: 240 GRIVLIALLGGAKA-EVPLGDILRRRITLTGSTLRPRPVAFKAAIAARLHETVWPLLASG 298

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PVIH V+P    A AH +ME S HIGKI+L
Sbjct: 299 RIRPVIHEVMPAEHAAQAHALMESSAHIGKIML 331


>gi|192359405|ref|YP_001981833.1| zinc-containing alcohol dehydrogenase [Cellvibrio japonicus
           Ueda107]
 gi|190685570|gb|ACE83248.1| alcohol dehydrogenase, zinc-containing [Cellvibrio japonicus
           Ueda107]
          Length = 325

 Score =  326 bits (835), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 154/315 (48%), Positives = 222/315 (70%), Gaps = 2/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G    + +AE  +P     E+L+ V A GVNRPD++QR+GLYP P  A+P+LGLEVAG +
Sbjct: 9   GGPEFLRIAEGQVPDVGAGEVLVHVAAAGVNRPDILQRQGLYPAPAAASPVLGLEVAGDV 68

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           + LG+    W +GD VCALVNGGGYA +    +   LP+P+G + +QAA+LPE+ FTVW 
Sbjct: 69  IALGQGVKRWRLGDRVCALVNGGGYATHVAVPEAQCLPVPQGLDWVQAAALPETLFTVWH 128

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NL Q A+L++G+ +L+HGG+SGIGT AIQLA   GA V+ TA S EKC AC +LGA+ AI
Sbjct: 129 NLIQRAHLQAGERLLVHGGASGIGTMAIQLAKALGADVFATAGSVEKCAACAQLGAQ-AI 187

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY  +DF+  ++  T G+G+D+ILDMVG +Y+ ++ +  +K+G+++ I+FL G+  T ++
Sbjct: 188 NYRIQDFVGEVKALTAGQGVDVILDMVGGDYVQRNFSAAAKDGRIVNIAFLQGSRVT-LD 246

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L P + KR+T TGSTLR ++  AK  I   L+ ++WPLL +  I P+I +V PL +VA A
Sbjct: 247 LMPFMLKRLTFTGSTLRAQSAAAKAQIARELEAQVWPLLAAGKIRPMIDSVYPLARVADA 306

Query: 316 HDIMEKSEHIGKIIL 330
           H  ME ++HIGK++L
Sbjct: 307 HRRMEANQHIGKLVL 321


>gi|254251859|ref|ZP_04945177.1| alcohol dehydrogenase [Burkholderia dolosa AUO158]
 gi|124894468|gb|EAY68348.1| alcohol dehydrogenase [Burkholderia dolosa AUO158]
          Length = 339

 Score =  326 bits (835), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 169/334 (50%), Positives = 224/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ LAE P P PQ+ E+LI+V A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLAERPRPDPQRGEVLIRVTASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV     D   N     +GD VCAL+ GGGYAEY ++     LP+P G   I
Sbjct: 61  PGLEVAGEIVGGDLSDAALNPFGLKLGDRVCALLAGGGYAEYAVAPLPQCLPVPDGLTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGAGEGGEHETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A S EKC AC  LGA+ AINY  EDF+E+++  TQ RG+D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGSAEKCRACESLGAERAINYKTEDFVEVVKSLTQDRGVDVILDMVAGSYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A E+NLN I+ +R+T+TGSTLR R    K  I   L  ++WPL+  
Sbjct: 241 GGRLVLIALLGGAKA-EVNLNDILRRRLTVTGSTLRPRPIEFKARIAAQLNARVWPLIAE 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP  + A AH +ME SEHIGKI+L
Sbjct: 300 GRIKPVIYQVLPAAEAAQAHALMESSEHIGKIVL 333


>gi|89071085|ref|ZP_01158291.1| alcohol dehydrogenase, zinc-containing [Oceanicola granulosus
           HTCC2516]
 gi|89043376|gb|EAR49596.1| alcohol dehydrogenase, zinc-containing [Oceanicola granulosus
           HTCC2516]
          Length = 333

 Score =  326 bits (835), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 223/330 (67%), Gaps = 4/330 (1%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + + MR + ++  G    +  +  P+P P   ++LI++   GVNRPD +QR GLY PP
Sbjct: 6   MTMTRTMRAIEITRPGGPEALVASNRPVPAPGYGQVLIRIAHAGVNRPDALQRAGLYKPP 65

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
            NA+ + GLE AG++V++G       +G+ VCAL+ GGGYAEY ++   H LP+P+G + 
Sbjct: 66  PNASDLPGLEAAGEVVEVGPGVETPEVGERVCALLPGGGYAEYAVTPAAHCLPVPEGMSL 125

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            +AA LPE++FTVW+NLF    L+ G+ VLIHGGSSGIGTTAIQLA++FGA V+TTA S 
Sbjct: 126 KEAACLPETYFTVWSNLFMRGRLQGGERVLIHGGSSGIGTTAIQLANHFGARVFTTAGSA 185

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC +LGA  AINY +EDF+ +L+   +  G  +ILDMVG +Y+ ++L  L+ EG+L
Sbjct: 186 EKCAACKRLGAARAINYREEDFVSVLR---EAGGAHVILDMVGGDYIARNLEALADEGRL 242

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+FL G  A E+N   I+ +R+ +TGSTLR ++D+AK  I   L+ ++WPLL +  + 
Sbjct: 243 VQIAFLQGAKA-EVNFAEIMMRRLIVTGSTLRPQSDLAKARIAAELRERVWPLLAARRVG 301

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PV+     L   A AH  ME S+HIGKI+L
Sbjct: 302 PVLDEEFELEAAARAHARMESSQHIGKIVL 331


>gi|110678382|ref|YP_681389.1| alcohol dehydrogenase, zinc-containing, putative [Roseobacter
           denitrificans OCh 114]
 gi|109454498|gb|ABG30703.1| alcohol dehydrogenase, zinc-containing, putative [Roseobacter
           denitrificans OCh 114]
          Length = 328

 Score =  326 bits (835), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 224/328 (68%), Gaps = 4/328 (1%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + + MR + +S  G  +V+   + P+P+P  ++++IKV   GVNRPD +QR GLY PP  
Sbjct: 1   MAQMMRAIEISEAGGPDVLKPCQRPVPEPAHDQVVIKVAWAGVNRPDALQRAGLYAPPPT 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE +G++V +G   T   +GD VCAL+ GGGYAEY  +   H L +P G    +
Sbjct: 61  ASDLPGLEASGEVVAVGTGVTDLAVGDLVCALLPGGGYAEYVATPAAHCLGVPDGMGLRE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA LPE++FTVW+N+F+   L++G+  L+HGGSSGIGTTAIQLA  FGA V+ TA S+EK
Sbjct: 121 AACLPETYFTVWSNVFKRGGLKAGERFLVHGGSSGIGTTAIQLAHAFGARVFATAGSDEK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C AC++LGA+ AINY  +DF+  ++ E    G ++ILDMVG +Y+ ++   L+ +G+L+ 
Sbjct: 181 CAACVELGAERAINYRDDDFVAAMRAEG---GANVILDMVGGDYIPRNFKALADDGRLVQ 237

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+FLGG    E+N  P++++R+T+TGSTLR ++D+AK  I   L+  +WP+L++  I PV
Sbjct: 238 IAFLGGP-KVEVNFAPLMTRRLTMTGSTLRPQSDLAKAEIAQELRDTVWPMLSAGTIGPV 296

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +    PL + A AH  ME S HIGKI+L
Sbjct: 297 MDQEFPLKEAAAAHTRMESSGHIGKIVL 324


>gi|83746294|ref|ZP_00943347.1| Hypothetical Protein RRSL_03887 [Ralstonia solanacearum UW551]
 gi|83727044|gb|EAP74169.1| Hypothetical Protein RRSL_03887 [Ralstonia solanacearum UW551]
          Length = 338

 Score =  326 bits (835), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 166/333 (49%), Positives = 223/333 (66%), Gaps = 11/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ YG  +V+  AE P+P+P   E+LI+V A GVNRPDV QR G YP P  A+ I
Sbjct: 5   MKAIEITQYGGPDVLKPAERPMPEPGAGEVLIRVRAAGVNRPDVFQRTGNYPVPPGASDI 64

Query: 67  LGLEVAGKIV--DLGENTTHWNI--GDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+I+  DL      + +  GD VCALV GGGYAE+C +  G  LP+P G + I+
Sbjct: 65  PGLEVAGEIIGGDLAHADNRYGLKAGDRVCALVQGGGYAEFCTAPLGQVLPVPAGLSDIE 124

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE++FTVW+N+F    L  G     +T+L+ GGSSGIGTTAIQ+AS  G  V++TA
Sbjct: 125 AAALPENYFTVWSNVFDRGQLGQGAHGRDETLLVQGGSSGIGTTAIQMASALGYRVFSTA 184

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S EKC AC++LGA  AI Y  EDF EI++ ET GRG+D++LDMVG  Y+ + +   + +
Sbjct: 185 GSAEKCTACVELGASRAIQYKTEDFAEIVKAET-GRGVDVVLDMVGGAYVAREIACTADD 243

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+ L  I+ +RIT+TGSTLR R    K +I   L   +WPLL S 
Sbjct: 244 GRIVLIALLGGAKA-EVPLGDILRRRITLTGSTLRPRPVAFKAAIAARLHETVWPLLASG 302

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PVIH V+P    A AH +ME S HIGKI+L
Sbjct: 303 RIRPVIHEVMPAEHAAQAHALMESSAHIGKIML 335


>gi|300703639|ref|YP_003745241.1| nadph:quinone reductase (cryz) [Ralstonia solanacearum CFBP2957]
 gi|299071302|emb|CBJ42620.1| putative NADPH:quinone reductase (Cryz) [Ralstonia solanacearum
           CFBP2957]
          Length = 338

 Score =  325 bits (834), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 168/335 (50%), Positives = 225/335 (67%), Gaps = 11/335 (3%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           K M+ + ++ YG  +V+  AE P+P+P   E+LI+V A GVNRPDV QR G YP P  A+
Sbjct: 3   KAMKAIEITQYGGPDVLRPAERPMPEPGVGEVLIRVRAAGVNRPDVFQRTGNYPVPPGAS 62

Query: 65  PILGLEVAGKIV--DLG--ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
            I GLEVAG+I+  DL   +N     +GD VCALV GGGYAE+C +  G  LP+P G + 
Sbjct: 63  DIPGLEVAGEIIGGDLAHADNRYGVKVGDRVCALVQGGGYAEFCAAPLGQVLPVPVGLSD 122

Query: 121 IQAASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYT 175
           I+AA+LPE++FTVW+N+F    L  G     +T+L+ GGSSGIGTTAIQ+AS  G  V+ 
Sbjct: 123 IEAAALPENYFTVWSNVFDRGQLGQGAHGKGETLLVQGGSSGIGTTAIQMASALGYRVFA 182

Query: 176 TAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLS 235
           TA S EKC AC++LGA  AI+Y  EDF EI++ ET GRG+D++LDMVG  Y+ + +   +
Sbjct: 183 TAGSAEKCAACVELGASRAIHYKTEDFAEIVKAET-GRGVDVVLDMVGGAYVAREIACTA 241

Query: 236 KEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLN 295
            +G++++I+ LGG  A E+ L  I+ +RIT+TGSTLR R    K +I   L   +WPLL 
Sbjct: 242 DDGRIVLIALLGGAKA-EVPLGDILRRRITLTGSTLRPRPVAFKAAIAAHLHETVWPLLA 300

Query: 296 SHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           S  I PVIH V+P    A AH +ME S HIGKI+L
Sbjct: 301 SGRIRPVIHEVMPAEHAARAHALMESSAHIGKIML 335


>gi|311108038|ref|YP_003980891.1| NAD(P)H quinone oxidoreductase [Achromobacter xylosoxidans A8]
 gi|310762727|gb|ADP18176.1| NAD(P)H quinone oxidoreductase, PIG3 family protein 3
           [Achromobacter xylosoxidans A8]
          Length = 331

 Score =  325 bits (834), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 157/315 (49%), Positives = 216/315 (68%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  + M LAE  +  P   ++LI+V   GVNRPDV+QR G YPPP  A+P LGLEV+G +
Sbjct: 14  GAPDCMRLAERDMEAPAGRQVLIEVAYAGVNRPDVLQRSGSYPPPPGASPHLGLEVSGTV 73

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +  G   + W +GD+VCAL  GGGYA+YCL+ + H LP+P+G + + AA++PE++FTVW 
Sbjct: 74  IATGPEASLWKVGDQVCALTPGGGYAQYCLADERHCLPVPRGLDLLTAAAIPENYFTVWT 133

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  A L +G+  L+HGGSSGIG TAIQLA  FGA V+TT  ++EK  ACL  GA HA+
Sbjct: 134 NVFDRARLAAGERFLVHGGSSGIGLTAIQLARAFGAEVWTTVGNQEKAEACLAAGAHHAV 193

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
            Y + DF   +++ + G G+D+ILDMVG  Y+N++L LL+  G+L+ I+FL G+ A EI+
Sbjct: 194 LYREADFEAEVRQGSGGPGVDVILDMVGGAYINKNLRLLAVNGRLVQIAFLEGSKA-EID 252

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
             PI+ KR+  TGSTLR R+D  K +I  +L  K+ PL+      P IH V PL + A A
Sbjct: 253 AMPIMIKRLQFTGSTLRPRSDEDKGAIAQALADKVLPLMEQGQCLPRIHQVFPLAEAAQA 312

Query: 316 HDIMEKSEHIGKIIL 330
           H +ME S+HIGKI+L
Sbjct: 313 HALMESSKHIGKIML 327


>gi|319761759|ref|YP_004125696.1| nad(p)h quinone oxidoreductase, pig3 family [Alicycliphilus
           denitrificans BC]
 gi|330826539|ref|YP_004389842.1| NAD(P)H quinone oxidoreductase, PIG3 family [Alicycliphilus
           denitrificans K601]
 gi|317116320|gb|ADU98808.1| NAD(P)H quinone oxidoreductase, PIG3 family [Alicycliphilus
           denitrificans BC]
 gi|329311911|gb|AEB86326.1| NAD(P)H quinone oxidoreductase, PIG3 family [Alicycliphilus
           denitrificans K601]
          Length = 334

 Score =  325 bits (834), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 225/328 (68%), Gaps = 6/328 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +S +G    + LAE P+PQP   E+LI+V A GVNRPDV+QRKG Y PP   + +
Sbjct: 5   MQAVEISAFGPPEGLCLAERPLPQPGAGELLIRVAASGVNRPDVLQRKGHYAPPPGVSDL 64

Query: 67  LGLEVAGKIVDLGENTTHWN----IGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG +V+ G+          +GD VCALV GGGYA YC++     LP+P+G + ++
Sbjct: 65  PGLEVAG-VVESGDAAAMAQAGIRVGDRVCALVAGGGYAAYCVAPVAQCLPVPEGLSDVE 123

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AASLPE+FFTVW+N+F  A L++G+T+L+ GGSSGIG TAIQLA   GATV  TA ++EK
Sbjct: 124 AASLPETFFTVWSNVFDRARLQAGETLLVQGGSSGIGVTAIQLARARGATVIVTAGTDEK 183

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C ACL LGA HAINY  +DF+   Q+ T+GRG+D++LDMV   Y+ + +  L+++G+++I
Sbjct: 184 CAACLALGAHHAINYKSQDFVAEAQRITEGRGVDVVLDMVAGPYVAREVECLAEDGRVVI 243

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+  GG +  E N   ++ KR+TITGSTLR R    K +I  +L+ ++WPLL S  + PV
Sbjct: 244 IAVQGG-VKAEFNAALVLRKRLTITGSTLRPRPVAFKAAIAKALREQVWPLLASGAVKPV 302

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           IH+       A AH +ME ++H+GKI+L
Sbjct: 303 IHSTFAAADAAQAHALMESNQHVGKIVL 330


>gi|254461077|ref|ZP_05074493.1| alcohol dehydrogenase, zinc-containing [Rhodobacterales bacterium
           HTCC2083]
 gi|206677666|gb|EDZ42153.1| alcohol dehydrogenase, zinc-containing [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 325

 Score =  325 bits (834), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 223/324 (68%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++  G   V+ L E P+P+    E++IKV   GVNRPD +QR G Y PP  A+ +
Sbjct: 1   MRAVEITKAGGPEVLQLCERPMPEAGHGEVVIKVAYAGVNRPDALQRAGSYAPPPTASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G+IV +G   + W IGD VCAL+ GGGYAE+  +   H LP+P+G    +AA L
Sbjct: 61  PGLEASGEIVAVGAGVSQWAIGDLVCALLPGGGYAEFVATPAAHCLPVPEGMGLKEAACL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTV++N+FQ   L++G+  L+HGGSSGIGTTAIQL   FGA V+TTA S+EKC AC
Sbjct: 121 PETYFTVFSNVFQRGGLQAGEQFLVHGGSSGIGTTAIQLGKLFGARVFTTAGSDEKCAAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           ++LGA+ AINY  EDF+ ++++     G D+ILDMVG +YL +++  LS +G+L+ I+FL
Sbjct: 181 VELGAERAINYRNEDFVAVMKEIG---GADLILDMVGGDYLPRNVKALSNDGRLVQIAFL 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G+   E+N   ++ KR+TITGSTLR ++D+AK  I D+L+ ++WPLL +  + PV+ + 
Sbjct: 238 QGS-KIELNFALMMMKRLTITGSTLRPQSDLAKARIADALRAQVWPLLEAGRLGPVMDSA 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   + AH  ME S HIGKI+L
Sbjct: 297 FDLANASAAHTRMESSGHIGKIVL 320


>gi|134296436|ref|YP_001120171.1| alcohol dehydrogenase [Burkholderia vietnamiensis G4]
 gi|134139593|gb|ABO55336.1| Alcohol dehydrogenase, zinc-binding domain protein [Burkholderia
           vietnamiensis G4]
          Length = 339

 Score =  325 bits (833), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 168/334 (50%), Positives = 224/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E   P+P + E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLTERVRPEPARGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV--DLGE---NTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV  DL +   N     +GD VCAL+ GGGYAEY ++     LP+P G   I
Sbjct: 61  PGLEVAGEIVGGDLSDPALNPFGLKLGDRVCALLAGGGYAEYAVAPLPQCLPVPGGLTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRALLGAGEGGEQETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A + +KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMVGA YL + L+ L+ 
Sbjct: 181 AGTADKCRACEALGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVGAAYLPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G++++I+ LGG  A EINL  I+ +R+T+TGSTLR R    K  I   L+ ++WPLL  
Sbjct: 241 GGRIVLIALLGGAKA-EINLGEILRRRLTVTGSTLRPRPVEFKARIAAQLKARVWPLLAD 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP G  A AH +ME  EHIGKI+L
Sbjct: 300 GRIKPVIYRVLPAGDAAQAHALMESGEHIGKIVL 333


>gi|207723870|ref|YP_002254268.1| nadph quinone oxidoreductase protein [Ralstonia solanacearum MolK2]
 gi|206589075|emb|CAQ36037.1| nadph quinone oxidoreductase protein [Ralstonia solanacearum MolK2]
          Length = 334

 Score =  325 bits (832), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 223/333 (66%), Gaps = 11/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ YG  +V+  AE P+P+P   E+LI+V A GVNRPDV QR G YP P  A+ I
Sbjct: 1   MKAIEITQYGGPDVLKPAERPMPEPGAGEVLIRVRAAGVNRPDVFQRTGNYPVPPGASDI 60

Query: 67  LGLEVAGKIV--DLG--ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+I+  DL   +N     +GD VCALV GGGYAE+C +  G  LP+P G + I+
Sbjct: 61  PGLEVAGEIIGGDLAHADNRYGLKVGDRVCALVQGGGYAEFCTAPLGQVLPVPVGLSDIE 120

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE++FTVW+N+F    L  G     +T+L+ GGSSGIGTTAIQ+AS  G  V+ TA
Sbjct: 121 AAALPENYFTVWSNVFDRGQLGQGAHGRGETLLVQGGSSGIGTTAIQMASVLGYRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S EKC AC++LGA  AI Y  EDF EI++ ET GRG+D++LDMVG  Y+ + +   + +
Sbjct: 181 GSAEKCAACVELGASRAIQYKTEDFAEIVKAET-GRGVDVVLDMVGGAYVAREIACTADD 239

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+ L  I+ +RIT+TGSTLR R    K +I   L   +WPLL S 
Sbjct: 240 GRIVLIALLGGAKA-EVPLGDILRRRITLTGSTLRPRPVAFKAAIAAHLHETVWPLLASG 298

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PVIH V+P    A AH +ME S HIGKI+L
Sbjct: 299 RIRPVIHEVMPAEHAARAHALMESSAHIGKIML 331


>gi|300175300|emb|CBK20611.2| unnamed protein product [Blastocystis hominis]
          Length = 340

 Score =  324 bits (831), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 156/334 (46%), Positives = 229/334 (68%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++ +G   VM +    +P PQK E+LIKV A  +NRPDV+QR+G+YPPPK A+ I
Sbjct: 1   MRCVDITEFGGPEVMKVVTRDVPTPQKGEMLIKVAAAAINRPDVVQRQGMYPPPKGASNI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G +V LG+  T + +GD+VC ++ GGGYAEY   +    LP+PK  + IQ+A++
Sbjct: 61  PGLECSGTVVALGDGCTGFKVGDKVCGILTGGGYAEYTTMNCMCALPVPKNTSMIQSAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
            ESFFT ++N+F    L+ G++ L+HGG+SGIGT++IQLA  FG  VYTTA+  EKC AC
Sbjct: 121 CESFFTSYSNVFMRGALKPGESFLVHGGTSGIGTSSIQLAKAFGNKVYTTAEGPEKCEAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            KLGA   I+Y KEDF ++++ ET+ +G+++ILD +G +Y  +++ LL++EG+++II F+
Sbjct: 181 RKLGADVVIDYTKEDFFDVIRTETKKKGVNVILDYIGGDYAEKNIKLLAEEGRMVIIGFM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G     I+LNPI+ KR+TITGSTLR R+   K  +   +  K+WPL+ +  +AP+IH  
Sbjct: 241 KGP-RVNISLNPILLKRLTITGSTLRSRSLEFKHQVAMEMYEKVWPLIEAGKLAPLIHAT 299

Query: 307 ----------LPLGKVAMAHDIMEKSEHIGKIIL 330
                     +PL +V  AH +MEK+E IGKI+L
Sbjct: 300 VGHGEEGDGKVPLDEVVRAHTMMEKNEQIGKIVL 333


>gi|260753683|ref|YP_003226576.1| NAD(P)H quinone oxidoreductase, PIG3 family [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258553046|gb|ACV75992.1| NAD(P)H quinone oxidoreductase, PIG3 family [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 351

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 222/324 (68%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +   G ++V+ L ++PIP P+ +EIL+K+ A G+NRPD++QR G YP P +A PI
Sbjct: 22  MKEVIIKEAGSADVLALHDAPIPTPKADEILVKIAAAGINRPDIIQRMGQYPLPPDATPI 81

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE++G ++ LG+N   + IGD +C L NGGGYAEY +      LP+P   +  +AA++
Sbjct: 82  PGLEISGTVIALGQNVEEFKIGDRICGLTNGGGYAEYGVIPAKQALPVPDNLSLTEAAAI 141

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVWANLF     +SG+TVL+HGGSSGIG+TAI LA   G  V+TT  ++EK  A 
Sbjct: 142 PETYFTVWANLFDIGQAKSGETVLVHGGSSGIGSTAIILAKACGLKVFTTVGNQEKAAAV 201

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            KLGA  AINY ++DFL I+Q+E  G+G+D+ILD++G  Y ++++  L+  G+L+I+  +
Sbjct: 202 EKLGA-IAINYNEQDFLTIIQEEMAGKGVDVILDIIGGSYFSRNMKALAFGGRLVIVGAM 260

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG IA + +L P+I KR TI+GST+R RT   K +I  SL+ K+WPLL      P+I + 
Sbjct: 261 GGRIADKFDLLPLIFKRATISGSTMRARTADEKANIARSLREKVWPLLEQGQCHPLIDSS 320

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL KV  AH  ME  +H GKI+L
Sbjct: 321 FPLEKVQDAHKRMESRDHCGKIVL 344


>gi|241762092|ref|ZP_04760175.1| NAD(P)H quinone oxidoreductase, PIG3 family [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373342|gb|EER62942.1| NAD(P)H quinone oxidoreductase, PIG3 family [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 351

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 222/324 (68%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +   G ++V+ L ++PIP P+ +EIL+K+ A G+NRPD++QR G YP P +A PI
Sbjct: 22  MKEVIIKEAGSADVLALHDAPIPTPKADEILVKIAAAGINRPDIIQRMGQYPLPPDATPI 81

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE++G ++ LG+N   + IGD +C L NGGGYAEY +      LP+P   +  +AA++
Sbjct: 82  PGLEISGTVIALGQNVEEFKIGDRICGLTNGGGYAEYGVIPAKQALPVPDNLSLTEAAAI 141

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVWANLF     +SG+TVL+HGGSSGIG+TAI LA   G  V+TT  ++EK  A 
Sbjct: 142 PETYFTVWANLFDIGQAKSGETVLVHGGSSGIGSTAIILAKACGLKVFTTVGNQEKAAAV 201

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            KLGA  AINY ++DFL I+Q+E  G+G+D+ILD++G  Y ++++  L+  G+L+I+  +
Sbjct: 202 EKLGA-IAINYNEQDFLTIIQEEMAGKGVDVILDIIGGSYFSRNMKALAFGGRLVIVGAM 260

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG IA + +L P+I KR TI+GST+R RT   K +I  SL+ K+WPLL      P+I + 
Sbjct: 261 GGRIADKFDLLPLIFKRATISGSTMRARTADEKANIARSLREKVWPLLEQGQCHPLIDSS 320

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL KV  AH  ME  +H GKI+L
Sbjct: 321 FPLEKVQDAHKRMESRDHCGKIVL 344


>gi|83953347|ref|ZP_00962069.1| alcohol dehydrogenase, zinc-containing [Sulfitobacter sp. NAS-14.1]
 gi|83842315|gb|EAP81483.1| alcohol dehydrogenase, zinc-containing [Sulfitobacter sp. NAS-14.1]
          Length = 330

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 154/328 (46%), Positives = 224/328 (68%), Gaps = 4/328 (1%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + + MR + ++  G   V+   + P+PQP   +++IKV   GVNRPD +QR G+Y PP  
Sbjct: 1   MTETMRAIEITKAGGPEVLQPTDRPMPQPAHGQVVIKVAYAGVNRPDALQRAGMYAPPPT 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE +G +  +GE  +   +GD+VCAL+ GGGYAEY  +   H LP+PKG +  Q
Sbjct: 61  ASDLPGLEASGVVSAVGEGVSGLAVGDKVCALLPGGGYAEYVATPAAHCLPVPKGMDMKQ 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA LPE+FFTVW+N+F    L++G+  L+HGGSSGIGTTAIQLA  FGA V+ TA ++ K
Sbjct: 121 AACLPETFFTVWSNVFMRGGLKAGERFLVHGGSSGIGTTAIQLAREFGARVFATAGTDSK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C AC KLGA+ AINY   DF+++L+ E    G D+ILDMVG +Y+ ++L  L+++G+L+ 
Sbjct: 181 CDACAKLGAEAAINYRDSDFVDVLKAEG---GADLILDMVGGDYIPRNLLALAEDGRLVQ 237

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+FL G    E+N   ++++R+T+TGSTLR ++D+AK  I + L+ K+WPLL++  IAPV
Sbjct: 238 IAFLSGP-KVEVNFATLMTRRLTMTGSTLRPQSDLAKAKIAEELREKVWPLLDAGKIAPV 296

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           + +       + AH  ME S HIGKI+L
Sbjct: 297 MDSEYAFEDASEAHARMETSGHIGKIVL 324


>gi|188580950|ref|YP_001924395.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylobacterium
           populi BJ001]
 gi|179344448|gb|ACB79860.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylobacterium
           populi BJ001]
          Length = 336

 Score =  324 bits (830), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 223/326 (68%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + MR +  +G G   V+ +   P+P+P   ++L++V A GVNRPD+MQR+G YPPPK A 
Sbjct: 7   ETMRQIRFTGAGGPEVIAVETVPLPKPAAGQVLVEVVAAGVNRPDIMQRQGSYPPPKGAT 66

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            I GLE+AG+I +LGE  T ++ GDEVCALV  GGYAE+ ++  G  L  P+  + ++AA
Sbjct: 67  EIPGLEIAGRIAELGEGVTGFSEGDEVCALVISGGYAEFAVAEAGQVLKRPEPLSLVEAA 126

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
            LPE+ FTV++ + Q   L+ G+T L+HGGSSGIGTTAIQ+A   GA V TTA S EKC 
Sbjct: 127 GLPETTFTVYSTVIQRGRLKKGETFLVHGGSSGIGTTAIQIAKQHGARVLTTAGSAEKCR 186

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
            C +LGA  AINY + DF E +++ T GRG+D+ILDMVGA YL +++  L+ EG+L+ I+
Sbjct: 187 FCEELGADAAINYRESDFAEEVKRLTDGRGVDVILDMVGAAYLQKNIASLAVEGRLVQIA 246

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           F+ G  A  + L PI+ KR+T+TG+TLR +   AK +I + L+  +WPL+ +  I P++H
Sbjct: 247 FMQGYKAENLTLTPIMLKRLTLTGATLRAQAKEAKAAIAEGLKRDVWPLVEAGQIRPIVH 306

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
              PL +   AH++ME S H GKI+L
Sbjct: 307 ATFPLEEARKAHELMETSSHSGKILL 332


>gi|293395493|ref|ZP_06639777.1| NADPH:quinone reductase [Serratia odorifera DSM 4582]
 gi|291422177|gb|EFE95422.1| NADPH:quinone reductase [Serratia odorifera DSM 4582]
          Length = 356

 Score =  323 bits (829), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 222/330 (67%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + K M+ + ++  G+  V+ + + P+P+  + EIL+KV A GVNRPDV+QR+G Y PP
Sbjct: 26  MTLPKHMKAIEIAQPGEPEVLVVTQRPLPELAQGEILVKVAAAGVNRPDVLQRRGQYAPP 85

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+ I GLE+AG++V +G    H+ IGD VCAL+ GGGYAEYC  H+ + LP+PKG++ 
Sbjct: 86  PGASDIPGLEIAGEVVAVGAGVQHYAIGDRVCALIAGGGYAEYCKVHESNALPVPKGFSL 145

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           ++AA++PE+FFTVW N+FQ  +L++G+TVLIHGG+SGIGT A  LA  F A V TT  SE
Sbjct: 146 VEAAAIPETFFTVWVNVFQRGHLKAGETVLIHGGTSGIGTVATLLAKAFCARVMTTVGSE 205

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EK  A L LGA  AINY  EDF+E   + T G+G ++I+D++  +YL ++    + +G++
Sbjct: 206 EKRQASLALGADVAINYRTEDFVEQTLQATNGKGAEVIVDLIAGDYLAKNYQAAAMDGRI 265

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I    G +  E+NL P++ KR+T TGSTLR R+   K  I   LQ K+WPLL    + 
Sbjct: 266 VQIGTQNG-VVKELNLMPMLIKRLTHTGSTLRARSVEDKAQIAADLQQKVWPLLERGALK 324

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I    PL + A AH +ME S HIGKI+L
Sbjct: 325 PQIFKTFPLEQAAAAHALMESSAHIGKIML 354


>gi|294850985|ref|ZP_06791661.1| NADPH2:quinone reductase [Brucella sp. NVSL 07-0026]
 gi|294821628|gb|EFG38624.1| NADPH2:quinone reductase [Brucella sp. NVSL 07-0026]
          Length = 335

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 220/316 (69%), Gaps = 2/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G + ++  A+  +P+P++ EIL++V A GVNRPDV+QR+G Y PP  A+ I GLE+AG I
Sbjct: 18  GGAYMLRPAQRAVPEPKEGEILVRVRAAGVNRPDVLQRQGQYAPPPGASDIPGLEIAGDI 77

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V LG     +  GD+V AL+ GGGYAEY + H+ + LP+P G+  I+AA++PE+FFTVW 
Sbjct: 78  VALGHGVKRFRKGDQVVALLAGGGYAEYAVVHESNALPLPSGFGYIEAAAIPETFFTVWH 137

Query: 136 NLFQT-ANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHA 194
           N+F+    L+ G+  L+HGGSSGIGTTAIQLA  FGATV TTA S+EKC AC+KLGA  A
Sbjct: 138 NVFERGGGLKEGEVFLVHGGSSGIGTTAIQLAKAFGATVITTAGSKEKCDACVKLGADRA 197

Query: 195 INYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEI 254
           INY +EDF+ ++++ T G+G+D+ILDMVG +Y+ ++    +++G+++ I+FL G  AT  
Sbjct: 198 INYHEEDFVAVVKEMTGGKGVDVILDMVGGDYVERNYKAAAEDGRIVQIAFLNGAKATA- 256

Query: 255 NLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAM 314
           N   +++KR+T TGSTLR R    K  I   L+ K+WPLL    +APV+  +  L     
Sbjct: 257 NFAILMTKRLTHTGSTLRPRPVAFKAGIARELEAKVWPLLAQRRVAPVMDMIFSLKDAWR 316

Query: 315 AHDIMEKSEHIGKIIL 330
           AH  ME+  HIGKI+L
Sbjct: 317 AHKRMEEGRHIGKIVL 332


>gi|163793017|ref|ZP_02186993.1| 3-hydroxybutyryl-CoA dehydrogenase [alpha proteobacterium BAL199]
 gi|159181663|gb|EDP66175.1| 3-hydroxybutyryl-CoA dehydrogenase [alpha proteobacterium BAL199]
          Length = 330

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 213/324 (65%), Gaps = 3/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G   V+     P+P P + E+L+KV   G+NRPD +QR G YPPP  A+ I
Sbjct: 8   MTAIEITKPGAPEVLKAGTRPVPVPAEGEVLVKVAFAGINRPDCLQRAGGYPPPPGASDI 67

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG++V  G   + W +GD+VCALV GGGYAEYC +      P+P GY   +AA+L
Sbjct: 68  PGLEIAGRVVAAGTGVSRWKVGDQVCALVAGGGYAEYCAAPADTCSPVPAGYTLAEAAAL 127

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+++TVW N+F+   L+ G+T+LIHGGSSGIGTTAIQLA  FGA V  TA S +K   C
Sbjct: 128 PENYYTVWTNVFERGRLQKGETILIHGGSSGIGTTAIQLAHAFGARVIATAGSADKVKVC 187

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+  INY  EDF+ ++++     G D+ILDMVG  Y+ +++  L  EG+L+ I+FL
Sbjct: 188 EQLGAERGINYRDEDFVAVMKELG---GADVILDMVGGPYIQRNIDCLKLEGRLVQIAFL 244

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
              +  E N   ++ +R+TITGSTLR RT   K +I   L+ K+WPLL +  + P+IH+ 
Sbjct: 245 QPPVVKEFNFLKVMLQRLTITGSTLRPRTVAQKAAIARQLEEKVWPLLEARTVKPLIHST 304

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL   A AH +ME S+HIGKI+L
Sbjct: 305 FPLDDAAGAHALMESSQHIGKILL 328


>gi|83944306|ref|ZP_00956761.1| alcohol dehydrogenase, zinc-containing [Sulfitobacter sp. EE-36]
 gi|83844850|gb|EAP82732.1| alcohol dehydrogenase, zinc-containing [Sulfitobacter sp. EE-36]
          Length = 330

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 153/328 (46%), Positives = 224/328 (68%), Gaps = 4/328 (1%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + + MR + ++  G   V+   + P+PQP   +++IKV   GVNRPD +QR G+Y PP  
Sbjct: 1   MTETMRAIEITKAGGPEVLQPTDRPMPQPAHGQVVIKVAYAGVNRPDALQRAGMYAPPPT 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE +G +  +GE  +   +GD+VCAL+ GGGYAEY  +   H LP+PKG +  Q
Sbjct: 61  ASDLPGLEASGVVSAVGEGVSGLAVGDKVCALLPGGGYAEYVATPAAHCLPVPKGMDMKQ 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA LPE+FFTVW+N+F    L++G+  L+HGGSSGIGTTAIQLA  FGA V+ TA ++ K
Sbjct: 121 AACLPETFFTVWSNVFMRGGLKAGERFLVHGGSSGIGTTAIQLAREFGARVFATAGTDSK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C AC KLGA+ AINY   DF+++L+ E    G D+ILDMVG +Y+ ++L  L+++G+L+ 
Sbjct: 181 CDACAKLGAEAAINYRDSDFVDVLKAEG---GADLILDMVGGDYIPRNLQALAEDGRLVQ 237

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+FL G    E+N   ++++R+T+TGSTLR ++++AK  I + L+ K+WPLL++  IAPV
Sbjct: 238 IAFLSGP-KVEVNFATLMTRRLTMTGSTLRPQSELAKAKIAEELREKVWPLLDAGKIAPV 296

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           + +       + AH  ME S HIGKI+L
Sbjct: 297 MDSEYAFEDASEAHARMETSGHIGKIVL 324


>gi|221640173|ref|YP_002526435.1| alcohol dehydrogenase, zinc-binding domain-containing protein
           [Rhodobacter sphaeroides KD131]
 gi|221160954|gb|ACM01934.1| Alcohol dehydrogenase, zinc-binding domain protein [Rhodobacter
           sphaeroides KD131]
          Length = 328

 Score =  323 bits (827), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 217/330 (65%), Gaps = 4/330 (1%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + + MR + +S  G   V+  A  P+P P   +ILI+V   GVNRPD +QR G Y PP
Sbjct: 1   MSLPETMRAIEISRPGGPEVLRPATVPVPVPGHGQILIRVSYAGVNRPDALQRAGAYAPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+P+ GLE +G +  +G   T W +G+EVCAL+ GGGYA+Y ++   H LP+P G   
Sbjct: 61  PGASPLPGLEASGTVAAVGPGVTRWRVGEEVCALLPGGGYADYAVTPADHALPVPAGLTL 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            +AA LPE+ FTVW+N+     LR+G+  L+HGGSSGIGTTAIQLA+  GA V+ TA SE
Sbjct: 121 REAACLPETCFTVWSNVAVRGGLRAGERFLVHGGSSGIGTTAIQLAAALGARVFATAGSE 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC  LGA+ AINY +EDF+ +L+ E    G D+ILDMVG  YL +++  L+ EG+L
Sbjct: 181 EKCAACRTLGAERAINYREEDFVAVLKAEG---GADLILDMVGGSYLPRNVKALATEGRL 237

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+FL G    E+N   ++ +R+TITGSTLR ++D+AK      ++ ++WPL+    + 
Sbjct: 238 VQIAFLEGT-KVELNFAEVMMRRLTITGSTLRPQSDLAKARYARDIETQVWPLVARGALR 296

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVI +  P+ + A AH  ME S HIGKI+L
Sbjct: 297 PVIDSEFPIEQAAEAHARMEGSSHIGKIVL 326


>gi|254472940|ref|ZP_05086338.1| NADPH quinone oxidoreductase [Pseudovibrio sp. JE062]
 gi|211957661|gb|EEA92863.1| NADPH quinone oxidoreductase [Pseudovibrio sp. JE062]
          Length = 335

 Score =  323 bits (827), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 162/324 (50%), Positives = 221/324 (68%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V M+G G S V+ +AE  +P+P   E+LIKV A GVNRPDV+QRKG YPPP  A+P+
Sbjct: 10  MKAVVMNGVGGSEVLEIAEVEVPKPGIGEVLIKVHAAGVNRPDVIQRKGAYPPPPGASPL 69

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEV+G+IV+LGE      +G+ VCAL  GGGYAEYC++   H L +P G +  +AA +
Sbjct: 70  LGLEVSGEIVELGEGVASHKVGERVCALTPGGGYAEYCVAPAAHVLHVPAGMSMEEAAGV 129

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    L+SG+  L+HGGSSGIGTTAIQLA  FGA V+TT  SEEK  A 
Sbjct: 130 PETFFTVWSNVFDRLGLQSGEKFLVHGGSSGIGTTAIQLAKAFGAEVFTTVGSEEKAQAV 189

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA + INY   DF++ +   T  +G+++ILDMVG +Y+ ++  + + EG++  I+ L
Sbjct: 190 RELGADYVINYRTTDFVKEIGNITSKQGVEVILDMVGGDYVEKNWIVAAIEGRICQIATL 249

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  +  +N + ++ KR+T TGSTLR RT+  K  I ++L  K+WPLL S  +  V+  V
Sbjct: 250 HGP-SENVNFSRLMMKRLTHTGSTLRPRTNEYKGHIAEALHEKVWPLLESARVKVVMDKV 308

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             +  V  AHD ME S HIGKIIL
Sbjct: 309 FDISDVRAAHDRMEGSNHIGKIIL 332


>gi|157371296|ref|YP_001479285.1| quinone oxidoreductase putative PIG3 [Serratia proteamaculans 568]
 gi|157323060|gb|ABV42157.1| Quinone oxidoreductase putative PIG3 [Serratia proteamaculans 568]
          Length = 335

 Score =  323 bits (827), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 158/324 (48%), Positives = 220/324 (67%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +S  G+  V+  ++ P+P  Q+ EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 11  MKVVEISQPGEPEVLISSQRPLPTLQQGEILVKVAAAGVNRPDVMQRRGQYAPPAGASDI 70

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG +V +G    ++ IGD VCAL+ GGGYAEYC  H+ + LP+P+G++ I+AA++
Sbjct: 71  PGLEIAGTVVAIGIGVQNYAIGDAVCALIAGGGYAEYCKVHESNALPVPEGFSLIEAAAI 130

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW N+FQ  +L++G+TVLIHGG+SGIGT A  LA  F A V TT  SEEK  A 
Sbjct: 131 PETFFTVWVNVFQRGHLKAGETVLIHGGTSGIGTVATLLAKAFCARVITTVGSEEKRQAS 190

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA  AINY  EDF+E  Q+ T G+G D+I+D++  +Y+ ++    + +G+++ I   
Sbjct: 191 LALGADVAINYRNEDFVEQTQRATNGKGADVIVDLIAGDYVAKNYQAAAMDGRIVQIGTQ 250

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G +  E+NL P++ KR+T TGSTLR R+   K  I   L+ K+WPLL    + P I   
Sbjct: 251 NG-VVKELNLMPLLIKRLTHTGSTLRARSVEDKAQIAADLRQKVWPLLERGALKPQIFKT 309

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH +ME S+HIGKI+L
Sbjct: 310 FPLDQAAEAHALMESSQHIGKIML 333


>gi|77464289|ref|YP_353793.1| NADPH/quinone reductase and related Zn-dependent oxidoreductase
           [Rhodobacter sphaeroides 2.4.1]
 gi|332559178|ref|ZP_08413500.1| NADPH/quinone reductase and related Zn-dependent oxidoreductase
           [Rhodobacter sphaeroides WS8N]
 gi|77388707|gb|ABA79892.1| NADPH/quinone reductase and related Zn-dependent oxidoreductases
           [Rhodobacter sphaeroides 2.4.1]
 gi|332276890|gb|EGJ22205.1| NADPH/quinone reductase and related Zn-dependent oxidoreductase
           [Rhodobacter sphaeroides WS8N]
          Length = 328

 Score =  323 bits (827), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 217/330 (65%), Gaps = 4/330 (1%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + + MR + +S  G   V+  A  P+P P   +ILI+V   GVNRPD +QR G Y PP
Sbjct: 1   MSLPETMRAIEISRPGGPEVLRPATVPVPVPGHGQILIRVAYAGVNRPDALQRAGAYAPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+P+ GLE +G +  +G   T W +G+EVCAL+ GGGYA+Y ++   H LP+P G   
Sbjct: 61  PGASPLPGLEASGTVAAVGPGVTRWRVGEEVCALLPGGGYADYAVTPADHALPVPSGLTL 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            +AA LPE+ FTVW+N+     LR+G+  L+HGGSSGIGTTAIQLA+  GA V+ TA SE
Sbjct: 121 REAACLPETCFTVWSNVALRGGLRAGERFLVHGGSSGIGTTAIQLAAALGARVFATAGSE 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC  LGA+ AINY +EDF+ +L+ E    G D+ILDMVG  YL +++  L+ EG+L
Sbjct: 181 EKCAACRALGAERAINYREEDFVAVLKAEG---GADLILDMVGGSYLPRNVKALATEGRL 237

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+FL G    E+N   ++ +R+TITGSTLR ++D+AK      ++ ++WPL+    + 
Sbjct: 238 VQIAFLEGT-KVELNFAEVMMRRLTITGSTLRPQSDLAKARYARDIETQVWPLVARGALR 296

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVI +  P+ + A AH  ME S HIGKI+L
Sbjct: 297 PVIDSEFPIEQAAEAHARMEGSSHIGKIVL 326


>gi|126733757|ref|ZP_01749504.1| alcohol dehydrogenase, zinc-containing, putative [Roseobacter sp.
           CCS2]
 gi|126716623|gb|EBA13487.1| alcohol dehydrogenase, zinc-containing, putative [Roseobacter sp.
           CCS2]
          Length = 323

 Score =  322 bits (826), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 216/324 (66%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +S  G   V+ LA+ P+P+P  ++++IKV   GVNRPD +QR GLY PPK A+ +
Sbjct: 1   MKAIEISQAGGPEVLTLADRPMPEPDYDQVVIKVAYAGVNRPDALQRAGLYNPPKGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG++   G    +   GD+VCAL+ GGGYAEY  +   H LPIP G    QAA L
Sbjct: 61  PGLEAAGEVAACGAGVANLKPGDQVCALLPGGGYAEYVATPAAHCLPIPDGLTLKQAACL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    L++GQ  L+HGGSSGIGTTAIQLA  FGA V+TTA S+EKC AC
Sbjct: 121 PETFFTVWSNVFMRGGLQAGQRFLVHGGSSGIGTTAIQLAKAFGARVFTTAGSDEKCKAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           + LGA+ A +Y   DF+E  Q    G G D+ILDMVG  Y+ ++L  L+ +G L+ I+FL
Sbjct: 181 IALGAEAAFSYRDADFVE--QMRAVG-GADLILDMVGGSYIPRNLKALADDGTLVQIAFL 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    E+N   ++++R+TITGSTLR ++D+AK  I D L+  +WPL+ +  +APV+   
Sbjct: 238 QGP-KVELNFVQLMTRRLTITGSTLRPQSDLAKARIADELRTHVWPLITAGKVAPVMDQE 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   A AH  ME S HIGKI+L
Sbjct: 297 FTLEDAAAAHARMESSAHIGKIVL 320


>gi|238028146|ref|YP_002912377.1| alcohol dehydrogenase, zinc-binding domain-containing protein
           [Burkholderia glumae BGR1]
 gi|237877340|gb|ACR29673.1| Alcohol dehydrogenase, zinc-binding domain protein [Burkholderia
           glumae BGR1]
          Length = 339

 Score =  322 bits (825), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 166/334 (49%), Positives = 226/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P P++ E+LIKV A G+NRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLVERPRPDPKRGEVLIKVAAFGINRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIVD--LGE---NTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IVD  LGE   N     IGD VCAL+ GGGYAEY  +  G  LP+P G + +
Sbjct: 61  PGLEVAGEIVDGELGEGAANPFGLKIGDRVCALLAGGGYAEYATAPLGQCLPVPAGLSDV 120

Query: 122 QAASLPESFFTVWANLFQTANL-----RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L     R  +T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGRGEGRDEETLLVQGGSSGIGVTAIQIAHALGHRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A ++EKC AC  LGA+ AINY  EDF+++++  T  RG D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGTDEKCRACEALGAERAINYKTEDFVDVVKSLTNDRGADVILDMVAGPYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A E++L  I+ +R+TITGSTLR R    K  I  +L+  +WPL+ S
Sbjct: 241 GGRLVVIALLGGAKA-EVSLGEILRRRLTITGSTLRPRPVEFKAKIAANLKETVWPLIES 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + PVI+ VLP  + A AH +ME SEH+GKI+L
Sbjct: 300 GTVRPVIYRVLPAAEAAAAHALMESSEHVGKIVL 333


>gi|116784254|gb|ABK23274.1| unknown [Picea sitchensis]
 gi|116785379|gb|ABK23700.1| unknown [Picea sitchensis]
 gi|224285349|gb|ACN40398.1| unknown [Picea sitchensis]
          Length = 325

 Score =  322 bits (825), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 217/325 (66%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G ++V+ + +   PQ + +E+LIK+ A  +NR D +QR+G YPPPK A P 
Sbjct: 1   MKAVVITTPGDADVLQIQDVDDPQVKDDEVLIKISATALNRADTLQRRGSYPPPKGAPPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I  +G+N   W +GDEVCAL+ GGGYAE      GH LP+PKG +  +AA+L
Sbjct: 61  LGLECSGIIEAVGKNVQTWKVGDEVCALLGGGGYAEKVAVLSGHVLPVPKGISLQEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F T++L  G+  L+HGGSSGIGT AIQ+A Y+GA V+ TA SEEK   C
Sbjct: 121 PEVACTVWSTVFMTSHLSKGENFLVHGGSSGIGTFAIQIAKYYGARVFVTAGSEEKLARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA  AINY  EDF+  +++ET G+G+D+ILD +GA YL ++L  L  +G+L +I F 
Sbjct: 181 KELGADVAINYKTEDFVARVKEETGGKGVDVILDSMGASYLQRNLDALGLDGRLFLIGFQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG + TEINL+ I  KR+TI  + LR R+   K+ I   +   +WP      + P+IHT 
Sbjct: 241 GGTV-TEINLSTIFGKRLTIQAAGLRVRSAENKEQIISDVHKHVWPAFEEGKVKPIIHTS 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           LPL + A AH IME S HIGKI+L+
Sbjct: 300 LPLSQAAEAHKIMESSTHIGKILLI 324


>gi|146278469|ref|YP_001168628.1| alcohol dehydrogenase [Rhodobacter sphaeroides ATCC 17025]
 gi|145556710|gb|ABP71323.1| Alcohol dehydrogenase, zinc-binding domain protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 333

 Score =  322 bits (825), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 215/326 (65%), Gaps = 4/326 (1%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + MR V ++  G  +V+     P+P P   +ILI++   GVNRPD +QR G Y PP  A+
Sbjct: 10  ETMRAVEIARPGAPDVLKPCTVPVPVPGHGQILIRIAYAGVNRPDALQRAGAYAPPPGAS 69

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           P+ GLE AG +  +G     W +GDEVCAL+ GGGYAEY ++  GH LP+P+G    +AA
Sbjct: 70  PLPGLEAAGTVAAVGPGVARWKVGDEVCALLPGGGYAEYAVTPAGHALPVPEGLGLREAA 129

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
            LPE+ FTVW+N+     LR+G+  L+HGGSSGIGTTAIQ+A+  GA V+ TA SEEKC 
Sbjct: 130 CLPETCFTVWSNVVLRGGLRAGERFLVHGGSSGIGTTAIQMATALGARVFATAGSEEKCA 189

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC  LGA+ AINY +EDF+ +L+ E    G D+ILDMVG  YL +++  L+ EG+L+ I+
Sbjct: 190 ACRDLGAERAINYREEDFVAVLKTEG---GADLILDMVGGSYLPRNVKALATEGRLVQIA 246

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FL G    E+N   ++ +R+TITGSTLR ++D+AK      L+  +WP++    + PV+ 
Sbjct: 247 FLEGT-RIELNFAEVMMRRLTITGSTLRPQSDLAKDRYARDLETHVWPMVVRGALRPVMD 305

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +  PL + A AH  ME S H+GKI+L
Sbjct: 306 SEFPLEEAAQAHARMEGSSHVGKIVL 331


>gi|319794671|ref|YP_004156311.1| NAD(P)h quinone oxidoreductase, pig3 family [Variovorax paradoxus
           EPS]
 gi|315597134|gb|ADU38200.1| NAD(P)H quinone oxidoreductase, PIG3 family [Variovorax paradoxus
           EPS]
          Length = 332

 Score =  322 bits (825), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 163/334 (48%), Positives = 226/334 (67%), Gaps = 14/334 (4%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ YG   V+ +A+ P P     E+LI+V A GVNRPDV+QR G YP P  A+ +
Sbjct: 1   MKAIEITSYGAPEVLRVADRPDPVAGAGELLIRVAASGVNRPDVLQRMGHYPVPPGASDL 60

Query: 67  LGLEVAGKIVD-----LGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV      L E    + +GD VCAL+ GGGYAE C++     LP+PKG++ +
Sbjct: 61  PGLEVAGEIVSGDAAALAE--AGFKVGDRVCALIAGGGYAELCVAPVAQCLPVPKGWSDV 118

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
            AASLPE+FFTVW+N+F+   L+ G+T+LI GGSSGIG TAIQ+A   GATV  TA S++
Sbjct: 119 DAASLPETFFTVWSNVFERGRLQKGETLLIQGGSSGIGVTAIQIAKALGATVIVTAGSDD 178

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           KC AC KLGA HAINY   DF+E  ++ T G+G+D+ILDMV  +Y+ + +  L+++G+L+
Sbjct: 179 KCEACKKLGADHAINYRTSDFVEKAKELTGGKGVDVILDMVAGDYVAREIECLAEDGRLV 238

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
           II+  GG +  +IN   ++ +R+TITGSTLR R    K +I  +L+ K+WPLL S  I P
Sbjct: 239 IIAVQGG-VKAQINAGLVLRRRLTITGSTLRPRPVAFKGAIAKALREKVWPLLESGAIKP 297

Query: 302 VIHTVL-----PLGKVAMAHDIMEKSEHIGKIIL 330
           VIH+       P G  A AH +ME ++HIGKI+L
Sbjct: 298 VIHSTFAAAGEPSG-AAQAHTLMESNQHIGKIVL 330


>gi|163850973|ref|YP_001639016.1| PIG3 family NAD(P)H quinone oxidoreductase [Methylobacterium
           extorquens PA1]
 gi|163662578|gb|ABY29945.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylobacterium
           extorquens PA1]
          Length = 336

 Score =  322 bits (824), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 159/326 (48%), Positives = 221/326 (67%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + MR +  +  G   V+ +   P+P+P   ++LI+V A GVNRPD+MQR+G YPPPK A 
Sbjct: 7   ETMRQIRFTAAGGPEVIAVETVPLPEPAAGQVLIEVVAAGVNRPDIMQRQGSYPPPKGAT 66

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            I GLEVAG+I  LGE  T ++ GDEVCALV  GGYAE+ ++  G  L  P   + ++AA
Sbjct: 67  EIPGLEVAGRIAALGEGMTGFSEGDEVCALVISGGYAEFAVAEAGQVLKKPGPLSLVEAA 126

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
            LPE+ FTV++ + Q   L+ G+T L+HGGSSGIGTTAIQ+A   GA V TTA S+EKC 
Sbjct: 127 GLPETTFTVYSTVIQRGRLQKGETFLVHGGSSGIGTTAIQIAKQHGARVLTTAGSDEKCR 186

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
            C +LGA  AINY + DF E +++ T G+G+D+ILDMVGA YL +++  L+ EG+L+ I+
Sbjct: 187 FCEELGADAAINYREADFAEEVKRLTDGKGVDVILDMVGAAYLQKNIASLAVEGRLVQIA 246

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           F+ G  A  + L PI+ KR+TITG+TLR +   AK +I + L+  +WPL+ +  I PV+H
Sbjct: 247 FMKGFKAENLTLTPIMLKRLTITGATLRAQAKEAKAAIAEGLKRDVWPLVEAGKIRPVVH 306

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
              PL +   AH++ME S H GKI+L
Sbjct: 307 ATFPLEEARKAHELMETSSHTGKILL 332


>gi|240138105|ref|YP_002962577.1| putative NADPH quinone oxidoreductase [Methylobacterium extorquens
           AM1]
 gi|240008074|gb|ACS39300.1| putative NADPH quinone oxidoreductase [Methylobacterium extorquens
           AM1]
          Length = 328

 Score =  322 bits (824), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 158/324 (48%), Positives = 220/324 (67%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR +  +  G   V+ +   P+P+P   ++LI+V A GVNRPD+MQR+G YPPPK A  I
Sbjct: 1   MRQIRFTAAGGPEVIAVETVPLPEPAAGQVLIEVVAAGVNRPDIMQRQGSYPPPKGATEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG+I  LGE  T ++ GDEVCALV  GGYAE+ ++  G  L  P   + ++AA L
Sbjct: 61  PGLEIAGRIAALGEGVTGFSEGDEVCALVISGGYAEFAVAEAGQVLKKPGPLSLVEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTV++ + Q   L+ G+T L+HGGSSGIGTTAIQ+A   GA V TTA S+EKC  C
Sbjct: 121 PETVFTVYSTVIQRGRLQKGETFLVHGGSSGIGTTAIQIAKQHGARVLTTAGSDEKCRFC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA  AINY + DF E +++ T G+G+D+ILDMVGA YL +++  L+ EG+L+ I+F+
Sbjct: 181 EELGADAAINYREADFAEEVKRLTDGKGVDVILDMVGAAYLQKNIASLAVEGRLVQIAFM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  A  + L PI+ KR+TITG+TLR +   AK +I + L+  +WPL+ +  I PV+H  
Sbjct: 241 KGFKAENLTLTPIMLKRLTITGATLRAQAKEAKAAIAEGLKQDVWPLVEAGKIRPVVHAT 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL +   AH++ME S H GKI+L
Sbjct: 301 FPLEEARKAHELMETSSHTGKILL 324


>gi|270262470|ref|ZP_06190741.1| quinone oxidoreductase putative PIG3 [Serratia odorifera 4Rx13]
 gi|270043154|gb|EFA16247.1| quinone oxidoreductase putative PIG3 [Serratia odorifera 4Rx13]
          Length = 335

 Score =  322 bits (824), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 220/329 (66%), Gaps = 1/329 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           P+   M+ + +S  G+  V+ +AE P+P  Q+ EIL+KV A GVNRPDVMQR+G Y PP 
Sbjct: 6   PLPNTMKAIEISQPGEPEVLVVAERPLPTLQQGEILVKVAAAGVNRPDVMQRRGQYAPPP 65

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A+ I GLE+AG++V +G    ++ IGD VCAL+ GGGYAEYC  H+ + LP+P+G +  
Sbjct: 66  GASDIPGLEIAGEVVAIGVGVKNYAIGDRVCALIAGGGYAEYCKVHESNALPVPQGMSLT 125

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
           +AA++PE+FFTVW N+FQ  +L++G+TVLIHGG+SGIGT A  LA  F A V TT  SEE
Sbjct: 126 EAAAIPETFFTVWVNVFQRGHLKAGETVLIHGGTSGIGTVATLLAKAFCARVITTVGSEE 185

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           K  A L LGA  AINY  EDF+E  +  T G+G D+I+D++  +Y+ ++    + +G+++
Sbjct: 186 KRQASLALGADVAINYRNEDFVEQTKHATNGKGADVIVDLIAGDYVAKNYQAAAMDGRIV 245

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I    G +  E+NL P++ KR+T TGSTLR R+   K  I   LQ K+WPLL    + P
Sbjct: 246 QIGTQNG-VVKELNLMPLLLKRLTHTGSTLRARSVEDKALIAADLQQKVWPLLERGALKP 304

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I    PL + A AH +ME S HIGKI+L
Sbjct: 305 QIFKTFPLEQAAAAHALMESSMHIGKIML 333


>gi|187479133|ref|YP_787158.1| zinc-binding dehydrogenase [Bordetella avium 197N]
 gi|115423720|emb|CAJ50270.1| Putative zinc-binding dehydrogenase [Bordetella avium 197N]
          Length = 324

 Score =  322 bits (824), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 220/324 (67%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V +   G   V+   E P P+P   E+LIKV A G+NRPDV QRKG Y PP  A+ +
Sbjct: 1   MRAVEIIHPGGPEVLVPTERPTPEPGAGEVLIKVSAAGINRPDVFQRKGNYAPPPGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG+IV        + IGD+VCALV GGGYAEYC++     LPIPKG + I+AA L
Sbjct: 61  PGLEVAGEIVGGDAAAGGFKIGDKVCALVAGGGYAEYCVAPAVQCLPIPKGLSDIEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVW+N+F    L  G+T+L+HGG+SGIGTTAIQ+A   G TVY T  S+E+  A 
Sbjct: 121 PETYFTVWSNVFDRGALAQGETLLVHGGASGIGTTAIQIARALGHTVYATVGSDERVAAV 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGAK  INY  +DF++ ++  T G+G+D++LDMV  +Y+++ L+ L+ +G+++II+ L
Sbjct: 181 ERLGAK-GINYKTQDFVQEIKALTGGKGVDVVLDMVAGDYIDRDLSCLADDGRIVIIAQL 239

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GGN +T IN   ++ +R+TITGSTLR R    K +I  +L+ ++WPLL    I P++H  
Sbjct: 240 GGNKST-INSAEVMRRRLTITGSTLRPRPVAFKGAIARALRERVWPLLEQGAIKPIVHAT 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LPL + A  H +ME  E +GKIIL
Sbjct: 299 LPLEQAADGHAMMEAGEQVGKIIL 322


>gi|186476767|ref|YP_001858237.1| PIG3 family NAD(P)H quinone oxidoreductase [Burkholderia phymatum
           STM815]
 gi|184193226|gb|ACC71191.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia phymatum
           STM815]
          Length = 338

 Score =  322 bits (824), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 163/333 (48%), Positives = 218/333 (65%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++ +G   V+ LAE P+P+P+  E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MNAIEITEFGAPEVLKLAERPMPEPKAGEVLIKVAASGVNRPDVFQRKGGYAPPPGASDL 60

Query: 67  LGLEVAGKIV----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV    D   N     IGD VCAL+ GGGYAEY        LP+PKG++ I+
Sbjct: 61  PGLEVAGEIVGGNIDEKRNPFGLKIGDRVCALMAGGGYAEYATVPLLQCLPVPKGFSDIE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE+FFTVW+N+F  A L  G+     T L+ GGSSGIG TAIQ+A   G  V+ TA
Sbjct: 121 AAALPETFFTVWSNVFDRAMLGKGEGGENETFLVQGGSSGIGVTAIQIAHALGFRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            ++EKC AC  +GA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L  L+  
Sbjct: 181 GTDEKCRACEAIGAERAINYKTEDFVEVIKSLTNDRGVDVILDMVAGSYVPRELKALADG 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G+L++I+ LGG   +E+NLN I+ +R+T+TGSTLR R    K  I   L+  +WP L   
Sbjct: 241 GRLVVIALLGG-AKSEVNLNEILRRRLTVTGSTLRPRPVEFKAKIAAQLKEHVWPHLEDG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PVI+ V P    A AH++ME S H+GKI+L
Sbjct: 300 TIKPVIYKVFPAADAAKAHELMESSTHVGKIVL 332


>gi|126463131|ref|YP_001044245.1| alcohol dehydrogenase [Rhodobacter sphaeroides ATCC 17029]
 gi|126104795|gb|ABN77473.1| Alcohol dehydrogenase, zinc-binding domain protein [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 328

 Score =  321 bits (823), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 216/330 (65%), Gaps = 4/330 (1%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + + MR + +S  G   V+  A  P+P P   +ILI+V   GVNRPD +QR G Y PP
Sbjct: 1   MSLPETMRAIEISRPGGPEVLRPATVPVPVPGHGQILIRVAYAGVNRPDALQRAGAYAPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+P+ GLE +G +  +G   T W +G+EVCAL+ GGGYA+Y ++   H LP+P G   
Sbjct: 61  PGASPLPGLEASGTVAAVGPGVTRWRVGEEVCALLPGGGYADYAVTPADHALPVPAGLTL 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            +AA LPE+ FTVW+N+     LR+G+  L+HGGSSGIGTTAIQLA+  GA V+ TA SE
Sbjct: 121 REAACLPETCFTVWSNVALRGGLRAGERFLVHGGSSGIGTTAIQLAAALGARVFATAGSE 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC  LGA+ AINY +EDF+ +L+ E    G D+ILDMVG  YL +++  L+ EG+L
Sbjct: 181 EKCAACRALGAERAINYREEDFVAVLKAEG---GADLILDMVGGSYLPRNVRALATEGRL 237

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+FL G    E+N   ++ +R+TITGSTLR ++D+AK      ++ ++WPL+    + 
Sbjct: 238 VQIAFLEGT-KVELNFAEVMMRRLTITGSTLRPQSDLAKARYARDIETQVWPLVARGALR 296

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVI    P+ + A AH  ME S HIGKI+L
Sbjct: 297 PVIDGEFPIEQAAEAHARMEGSSHIGKIVL 326


>gi|126739568|ref|ZP_01755260.1| alcohol dehydrogenase, zinc-containing [Roseobacter sp. SK209-2-6]
 gi|126719214|gb|EBA15924.1| alcohol dehydrogenase, zinc-containing [Roseobacter sp. SK209-2-6]
          Length = 329

 Score =  321 bits (823), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 158/324 (48%), Positives = 221/324 (68%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++  G   V+ L E P+P+    +++IKV   GVNRPD +QR G Y PP  A+ +
Sbjct: 5   MRAVEIAEPGGPEVLRLCERPMPEAGHGQVVIKVAYAGVNRPDALQRAGAYNPPPGASDL 64

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG++V+LG   +  +IGD+VCAL+ GGGYAEY  +   H LP+P G +  +AA L
Sbjct: 65  PGLEAAGEVVELGAGVSGLSIGDQVCALLPGGGYAEYVATPAAHCLPVPAGLSLKEAACL 124

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVW+N+F    L++G+  L+HGGSSGIGTTAIQ+AS  GA V+TTA S EKC AC
Sbjct: 125 PETCFTVWSNVFTRGGLKAGERFLVHGGSSGIGTTAIQMASALGARVFTTAGSAEKCQAC 184

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA+ AINY +EDF+ +L++E    G D+ILDMVG +Y+ +++  L+ +G+L+ I+FL
Sbjct: 185 LDLGAERAINYREEDFVAVLREEG---GADLILDMVGGDYIPRNIKTLANDGRLVHIAFL 241

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  A E+N   I+++R+T+TGSTLR ++D AK  I   L   IWPL+ +  + PV+ + 
Sbjct: 242 SGPKA-ELNFAQIMARRLTVTGSTLRPQSDEAKARIAQDLSEVIWPLIETGKLKPVMDST 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L + A AH  ME S HIGKI+L
Sbjct: 301 FSLDEAAAAHARMESSGHIGKIVL 324


>gi|283856547|ref|YP_163507.2| NAD(P)H quinone oxidoreductase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|283775554|gb|AAV90396.2| NAD(P)H quinone oxidoreductase, PIG3 family [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 335

 Score =  321 bits (823), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 221/324 (68%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +   G ++V+ L ++PIP P+ +EIL+K+ A G+NRPD++QR G YP P +A PI
Sbjct: 6   MKEVIIKEAGSADVLALHDAPIPTPKADEILVKIAAAGINRPDIIQRMGQYPLPPDATPI 65

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE++G ++ LG++   + IGD +C L NGGGYAEY +      LP+P   +  +AA++
Sbjct: 66  PGLEISGTVIALGQDVEEFKIGDRICGLTNGGGYAEYGVIPAKQALPVPDNLSLTEAAAI 125

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVWANLF     +SG+TVL+HGGSSGIG+ AI LA   G  V+TT  ++EK  A 
Sbjct: 126 PETYFTVWANLFDIGQAKSGETVLVHGGSSGIGSAAIILAKACGLKVFTTVGNQEKAAAV 185

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            KLGA  AINY ++DFL I+Q+E  G+G+D+ILD++G  Y ++++  L+  G+L+I+  +
Sbjct: 186 EKLGA-IAINYNEQDFLTIIQEEMAGKGVDVILDIIGGSYFSRNMKALAFGGRLVIVGAM 244

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG IA + +L P+I KR TI+GST+R RT   K +I  SL+ K+WPLL      P+I + 
Sbjct: 245 GGRIADKFDLLPLIFKRATISGSTMRARTADEKANIARSLREKVWPLLEQGQCHPLIDSS 304

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL KV  AH  ME  +H GKI+L
Sbjct: 305 FPLEKVQDAHKRMESRDHCGKIVL 328


>gi|254560666|ref|YP_003067761.1| NADPH quinone oxidoreductase [Methylobacterium extorquens DM4]
 gi|254267944|emb|CAX23812.1| putative NADPH quinone oxidoreductase [Methylobacterium extorquens
           DM4]
          Length = 336

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 158/324 (48%), Positives = 220/324 (67%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR +  +  G   V+ +   P+P+P   ++LI+V A GVNRPD+MQR+G YPPPK A  I
Sbjct: 9   MRQIRFTAAGGPEVIAVETVPLPKPAAGQVLIEVVAAGVNRPDIMQRQGSYPPPKGATEI 68

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG+I  LGE  T ++ GDEVCALV  GGYAE+ ++  G  L  P   + ++AA L
Sbjct: 69  PGLEIAGRIAALGEGVTGFSEGDEVCALVISGGYAEFAVAEAGQVLKKPGPLSLVEAAGL 128

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTV++ + Q   L+ G+T L+HGGSSGIGTTAIQ+A   GA V TTA S+EKC  C
Sbjct: 129 PETVFTVYSTVIQRGRLQKGETFLVHGGSSGIGTTAIQIAKQHGARVLTTAGSDEKCRFC 188

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA  AINY + DF E +++ T G+G+D+ILDMVGA YL +++  L+ EG+L+ I+F+
Sbjct: 189 EELGADAAINYREADFAEEVKRLTDGKGVDVILDMVGAAYLQKNIASLAVEGRLVQIAFM 248

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  A  + L PI+ KR+TITG+TLR +   AK +I + L+  +WPL+ +  I PV+H  
Sbjct: 249 KGFKAENLTLTPIMLKRLTITGATLRAQAKEAKAAIAEGLKRDVWPLVEAGKIRPVVHAT 308

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL +   AH++ME S H GKI+L
Sbjct: 309 FPLEEARKAHELMETSTHTGKILL 332


>gi|89900283|ref|YP_522754.1| zinc-binding alcohol dehydrogenase [Rhodoferax ferrireducens T118]
 gi|89345020|gb|ABD69223.1| Alcohol dehydrogenase, zinc-binding [Rhodoferax ferrireducens T118]
          Length = 333

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 157/328 (47%), Positives = 224/328 (68%), Gaps = 6/328 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +S +G  +V+ L E P+P P   E+LI+V A GVNRPDV+QR G YP P  A+ I
Sbjct: 3   MKVIEISAFGAPDVLRLGERPMPVPGVGELLIRVAASGVNRPDVLQRTGNYPVPSGASDI 62

Query: 67  LGLEVAGKIVDLGEN----TTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG +++ G+     +  + +G+ VCALV GGGYA+YC++  G  LP+PKG + ++
Sbjct: 63  PGLEVAG-VIERGDEQELASAGFKLGERVCALVAGGGYAQYCIAPVGQCLPVPKGLSDVE 121

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AASLPE+FFTVW+N+F  A L++G+T+LI GGSSGIG +AIQLA   G+ V  TA S+EK
Sbjct: 122 AASLPETFFTVWSNVFDRAQLQTGETLLIQGGSSGIGVSAIQLAKALGSRVIVTAGSDEK 181

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C ACL LGA HAINY   DF E +++ T G+G+++ILDMV   Y+ + +  LS++G+L+I
Sbjct: 182 CAACLALGADHAINYKTHDFQEEVKRLTGGQGVNVILDMVAGSYVAKEIECLSEDGRLVI 241

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+  GG + +EIN   ++ +R+T+TGSTLR R    K +I  +L   +WPL+    I PV
Sbjct: 242 IAVQGG-VKSEINAGLVLRRRLTVTGSTLRARPVAFKAAIARALLKNVWPLIEQGRIKPV 300

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           IH+         AH +ME + H+GKI+L
Sbjct: 301 IHSTFSAQDAFRAHALMESNLHVGKIVL 328


>gi|260426264|ref|ZP_05780243.1| putative quinone oxidoreductase [Citreicella sp. SE45]
 gi|260420756|gb|EEX14007.1| putative quinone oxidoreductase [Citreicella sp. SE45]
          Length = 327

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 157/328 (47%), Positives = 223/328 (67%), Gaps = 4/328 (1%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           +   MR V +S  G   ++     P+P  +  E++I+V   GVNRPD +QR G Y PPK 
Sbjct: 1   MTDTMRAVEISEPGGPEMLRPTTRPVPVARHGEVVIRVAWAGVNRPDALQRAGSYAPPKG 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE +G++V +G       +GD VCAL+ GGGYAEY  +   H LP+P G +  +
Sbjct: 61  ASDLPGLEASGEVVAVGPGVRWPAVGDAVCALLPGGGYAEYVATPAAHCLPVPAGMDLRE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA LPE+F+TVW N+F+   L++G+  L+HGGSSGIGTTAIQLAS FGA V+ TA S EK
Sbjct: 121 AACLPETFYTVWTNVFERGGLQAGERFLVHGGSSGIGTTAIQLASAFGARVFATAGSPEK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C ACL LGA+ AINY  EDF+ +L++E    G ++ILDMVG +YL +++  L+ EG+L+ 
Sbjct: 181 CNACLALGAERAINYRDEDFVSVLREEG---GANLILDMVGGDYLPRNVKALADEGRLVQ 237

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+FL G    E+N   ++++R+TITGSTLR ++D+AK  I ++L+  +WPLL S  +APV
Sbjct: 238 IAFLQGP-KVELNFAQVMTRRLTITGSTLRPQSDLAKARIAEALRKTVWPLLESGRVAPV 296

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           + +V  L + + AH  ME+S HIGKI+L
Sbjct: 297 MDSVYALDEASKAHAHMERSGHIGKIVL 324


>gi|4378174|gb|AAD19419.1| unknown [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 331

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 221/324 (68%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +   G ++V+ L ++PIP P+ +EIL+K+ A G+NRPD++QR G YP P +A PI
Sbjct: 2   MKEVIIKEAGSADVLALHDAPIPTPKADEILVKIAAAGINRPDIIQRMGQYPLPPDATPI 61

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE++G ++ LG++   + IGD +C L NGGGYAEY +      LP+P   +  +AA++
Sbjct: 62  PGLEISGTVIALGQDVEEFKIGDRICGLTNGGGYAEYGVIPAKQALPVPDNLSLTEAAAI 121

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVWANLF     +SG+TVL+HGGSSGIG+ AI LA   G  V+TT  ++EK  A 
Sbjct: 122 PETYFTVWANLFDIGQAKSGETVLVHGGSSGIGSAAIILAKACGLKVFTTVGNQEKAAAV 181

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            KLGA  AINY ++DFL I+Q+E  G+G+D+ILD++G  Y ++++  L+  G+L+I+  +
Sbjct: 182 EKLGA-IAINYNEQDFLTIIQEEMAGKGVDVILDIIGGSYFSRNMKALAFGGRLVIVGAM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG IA + +L P+I KR TI+GST+R RT   K +I  SL+ K+WPLL      P+I + 
Sbjct: 241 GGRIADKFDLLPLIFKRATISGSTMRARTADEKANIARSLREKVWPLLEQGQCHPLIDSS 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL KV  AH  ME  +H GKI+L
Sbjct: 301 FPLEKVQDAHKRMESRDHCGKIVL 324


>gi|84500399|ref|ZP_00998648.1| alcohol dehydrogenase, zinc-containing [Oceanicola batsensis
           HTCC2597]
 gi|84391352|gb|EAQ03684.1| alcohol dehydrogenase, zinc-containing [Oceanicola batsensis
           HTCC2597]
          Length = 326

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 220/324 (67%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +S  G   V+     P P+PQ  +++I+V   GVNRPD +QR G Y PP +A+ +
Sbjct: 4   MRAIEISEPGGPEVLKPVRRPRPEPQAGQVVIRVAYAGVNRPDALQRAGNYAPPPDASDL 63

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G++V +G   +   +GDEVCAL+ GGGYAEY  +   H LP+P+G    +AA L
Sbjct: 64  PGLEASGEVVAIGAGVSWPAVGDEVCALLPGGGYAEYVATPAAHCLPVPQGMTLKEAACL 123

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ +TVW N+F    L++G+  L+HGGSSGIGTTAIQLA +FGA V+ TA S  KC  C
Sbjct: 124 PETCYTVWTNVFMRGGLKAGEKFLVHGGSSGIGTTAIQLAKHFGARVFATAGSPGKCARC 183

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+ AINY +EDF ++L+ E    G D+ILDMVG +Y+ ++++ L+ EG+L+ I+FL
Sbjct: 184 EELGAERAINYREEDFTKVLKAEG---GADLILDMVGGDYIPRNVSSLATEGRLVFIAFL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E+N   ++++R+T+TGSTLR ++D AK  I + L+  +WPLL +  +APV+ + 
Sbjct: 241 GGPKA-ELNFAQVMARRLTLTGSTLRPQSDAAKAEIAEGLRQNVWPLLEAGSVAPVMDSE 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   A AH  ME SEHIGKI+L
Sbjct: 300 FALEDAAKAHARMESSEHIGKIVL 323


>gi|121609765|ref|YP_997572.1| alcohol dehydrogenase [Verminephrobacter eiseniae EF01-2]
 gi|121554405|gb|ABM58554.1| Alcohol dehydrogenase, zinc-binding domain protein
           [Verminephrobacter eiseniae EF01-2]
          Length = 353

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/333 (46%), Positives = 230/333 (69%), Gaps = 6/333 (1%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           P+ + M+ V +  +G   V+ LAE P+PQP   E+LI+V A GVNRPDV+QR G Y PP 
Sbjct: 20  PMKRTMQAVEIRSFGGPEVLGLAERPVPQPGTAELLIRVRASGVNRPDVLQRLGHYAPPP 79

Query: 62  NANPILGLEVAGKIVDLGENTT----HWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKG 117
            ++ I GLEVAG +V+ G+          +GD VCAL+ GGGYA++C++     LP+P+G
Sbjct: 80  GSSDIPGLEVAG-VVESGDAAALAEAGIRVGDRVCALLAGGGYAQWCVAPVVQCLPVPEG 138

Query: 118 YNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
            + +QAASLPE+FFTVW+N+F    L++G+++L+ GGSSGIG  AIQLA  FGATV  TA
Sbjct: 139 LSDVQAASLPETFFTVWSNVFDRGRLQAGESLLVQGGSSGIGVAAIQLARAFGATVIATA 198

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S+EKC ACL LGA+HAI+Y  +DF+  +++ T GRG+D++LDMV  +Y+ + +  L+++
Sbjct: 199 GSQEKCAACLALGAQHAIDYKTQDFVAEIKRITAGRGVDVVLDMVAGDYVAREVECLAED 258

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G+L+II+  GG + + +N   ++ +R+TITGSTLR R    K +I  +L+ ++WPLL + 
Sbjct: 259 GRLVIIAVQGG-VKSSLNAGLVLRRRLTITGSTLRPRAVPFKGAIARALRERVWPLLAAG 317

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            + PV+H+       + AH +ME + HIGKI+L
Sbjct: 318 TLRPVVHSQFAAADASQAHALMESNRHIGKIVL 350


>gi|312892088|ref|ZP_07751588.1| NAD(P)H quinone oxidoreductase, PIG3 family [Mucilaginibacter
           paludis DSM 18603]
 gi|311295460|gb|EFQ72629.1| NAD(P)H quinone oxidoreductase, PIG3 family [Mucilaginibacter
           paludis DSM 18603]
          Length = 327

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 159/327 (48%), Positives = 222/327 (67%), Gaps = 2/327 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN-P 65
           M+ V ++  G   V+ + + P PQ    E+L+KV A GVNRPDV QRKG +PPP  A+  
Sbjct: 1   MKAVIITHPGPPEVLQIQDRPKPQISTGEVLVKVAAAGVNRPDVAQRKGNHPPPAGASID 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLEVAG IV++G + T W IGD+VC LV G GYAEYC+   G  LPIP     ++AAS
Sbjct: 61  IPGLEVAGTIVEVGADVTRWKIGDQVCGLVIGAGYAEYCVIPAGQCLPIPGNLTLVEAAS 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+FFTVW+N+F   NL+ G+++L+HGGSSGIG TAIQ+A   G+ V+ TA +EEK   
Sbjct: 121 LPETFFTVWSNVFDRGNLQPGESLLVHGGSSGIGVTAIQMARALGSKVFVTAGNEEKVSF 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C  LGA+ AINY  E F EI+++ TQG+G+++ILDM+G +Y   ++  L+ EG+L++I+ 
Sbjct: 181 CESLGAERAINYKTESFKEIIEEATQGKGVNVILDMIGGDYTPDNIKCLAVEGRLVMINS 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           + G  A +++L  ++ KR+ ITGS LR R    K +I   L+  +WPL+ +  I PVI+ 
Sbjct: 241 MKGREA-KVDLAEVMRKRLIITGSMLRGRDVAFKTAIAHQLEQHVWPLIAAGQIKPVIYR 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIILLP 332
           V P  + A AH +ME S+HIGKI+L P
Sbjct: 300 VFPAEQGAEAHALMESSDHIGKIVLSP 326


>gi|222110083|ref|YP_002552347.1| NAD(P)h quinone oxidoreductase, pig3 family [Acidovorax ebreus
           TPSY]
 gi|221729527|gb|ACM32347.1| NAD(P)H quinone oxidoreductase, PIG3 family [Acidovorax ebreus
           TPSY]
          Length = 334

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 156/328 (47%), Positives = 224/328 (68%), Gaps = 6/328 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++ +G    + LAE P+PQP   E+LI+V A GVNRPDV+QRKG Y PP   + +
Sbjct: 5   MQAVEIAAFGPPEGLRLAERPVPQPGDGELLIRVAASGVNRPDVLQRKGNYAPPAGVSDL 64

Query: 67  LGLEVAGKIVDLGENTTH----WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG +V+ G+          +GD VCALV GGGYA++C++     LP+P+G + ++
Sbjct: 65  PGLEVAG-VVESGDAAAMAQAGLRVGDRVCALVAGGGYAQWCVAPVAQCLPVPQGLSDVE 123

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AASLPE+FFTVW+N+F    L++G+ +L+ GGSSGIG TAIQLA   GATV  TA S+EK
Sbjct: 124 AASLPETFFTVWSNVFDRGRLQAGEVLLVQGGSSGIGVTAIQLARARGATVIVTAGSDEK 183

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C ACL LGA HAINY  +DF+   ++ T GRG+D++LDMV   Y+ + +  L+++G+++I
Sbjct: 184 CAACLALGAHHAINYKTQDFVAEARRLTDGRGVDVVLDMVAGSYVAREVECLAEDGRVVI 243

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+  GG +  + N   ++ +R+TITGSTLR R    K +I  +L+  +WPLL S  + PV
Sbjct: 244 IAVQGG-LDAQFNAGLVLRRRLTITGSTLRPRPVAFKGAIAQALREHVWPLLASGAVKPV 302

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           IH+  P  + A AH +ME ++H+GKI+L
Sbjct: 303 IHSTFPAAQAAQAHALMESNQHVGKIVL 330


>gi|319945168|ref|ZP_08019430.1| NADPH:quinone reductase [Lautropia mirabilis ATCC 51599]
 gi|319741738|gb|EFV94163.1| NADPH:quinone reductase [Lautropia mirabilis ATCC 51599]
          Length = 330

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 217/324 (66%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+++     G ++V+ LAE  +P+    E+LI+V   GVNRPDV+QR G YPPP+ A+P 
Sbjct: 1   MKYIDHGRGGDADVLQLAERDMPEVGAGEVLIRVAYAGVNRPDVLQRMGSYPPPRGASPW 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEV+G +  +G+    W  GD VCALV+GGGYAEY  +  G  LP+P G++  QAASL
Sbjct: 61  LGLEVSGVVAAVGQGVPEWKKGDRVCALVDGGGYAEYVTAPAGQVLPVPAGFSMAQAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVWAN+ +   L  G+T+L+HGG+SGIG  AIQ+A   GA V+ T  + EK  A 
Sbjct: 121 PETAFTVWANVVERGRLAEGETLLVHGGTSGIGVMAIQVAKALGARVFCTVGTPEKAEAA 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           LKLGA  AI+Y + DF+  + + T+G+G+D+ILDMVG  Y+ ++L  L+ EG+L+ I+FL
Sbjct: 181 LKLGADAAIDYRRRDFMVEVSRLTEGQGVDVILDMVGGPYIERNLKSLAVEGRLVQIAFL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
             +   E++   ++ KR+T TGSTLR R+   K+ +  +LQ  +WPLL +  + P+I   
Sbjct: 241 QAS-KVEVDWMRLMLKRLTFTGSTLRARSPEEKERLSRALQDNLWPLLEAGKVKPIIDRA 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL K A AH  ME SEH+GKI+L
Sbjct: 300 FPLEKAAEAHRRMESSEHVGKILL 323


>gi|218529801|ref|YP_002420617.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylobacterium
           chloromethanicum CM4]
 gi|218522104|gb|ACK82689.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylobacterium
           chloromethanicum CM4]
          Length = 336

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 220/324 (67%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR +  +  G   V+ +   P+P+P   ++LI+V A GVNRPD+MQR+G YPPPK A  I
Sbjct: 9   MRQIRFTAAGGPEVIAVETVPLPKPAAGQVLIEVVAAGVNRPDIMQRQGSYPPPKGATEI 68

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG+I  LGE  T ++ G+EVCALV  GGYAE+ ++  G  L  P   + ++AA L
Sbjct: 69  PGLEIAGRIAALGEGVTGFSEGEEVCALVISGGYAEFAVAEAGQVLKKPGPLSLVEAAGL 128

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTV++ + Q   L+ G+T L+HGGSSGIGTTAIQ+A   GA V TTA S+EKC  C
Sbjct: 129 PETVFTVYSTVIQRGRLQKGETFLVHGGSSGIGTTAIQIAKQHGARVLTTAGSDEKCRFC 188

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA  AINY + DF E +++ T G+G+D+ILDMVGA YL +++  L+ EG+L+ I+F+
Sbjct: 189 EELGADAAINYREADFAEEVKRLTDGKGVDVILDMVGAAYLQKNIASLAVEGRLVQIAFM 248

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  A  + L PI+ KR+TITG+TLR +   AK +I + L+  +WPL+ +  I PV+H  
Sbjct: 249 KGFKAENLTLTPIMLKRLTITGATLRAQAKEAKAAIAEGLKRDVWPLVEAGKIRPVVHAT 308

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL +   AH++ME S H GKI+L
Sbjct: 309 FPLEEARKAHELMETSSHTGKILL 332


>gi|237811579|ref|YP_002896030.1| NADPH:quinone reductase [Burkholderia pseudomallei MSHR346]
 gi|237504933|gb|ACQ97251.1| NADPH:quinone reductase [Burkholderia pseudomallei MSHR346]
          Length = 339

 Score =  319 bits (818), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 162/334 (48%), Positives = 223/334 (66%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLTERPQPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV     D   N     +GD VCAL+ GGGYA+Y ++     LP+PKG   +
Sbjct: 61  PGLEVAGEIVGGDLADSAANPFGLKLGDRVCALLAGGGYAQYVVAPLAQCLPVPKGLTDV 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
            AASLPE+FFTVW+N+F  A L +G+     T L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 DAASLPETFFTVWSNVFDRAQLGAGEGGAQETFLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A +++KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L  L+ 
Sbjct: 181 AGTDDKCRACEALGAERAINYKSEDFVEVVKSLTHDRGVDVILDMVAGAYVPRELAALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A EIN+  I+ +R+TITGSTLR R    K +I   L+ ++WPL+  
Sbjct: 241 GGRLVVIALLGGAKA-EINVAEILRRRLTITGSTLRPRPVEFKAAIAAQLKARVWPLIED 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + PVI+ VLP  + A AH +ME SEH+GKI+L
Sbjct: 300 GRVKPVIYRVLPAAQAADAHALMESSEHVGKIVL 333


>gi|107023191|ref|YP_621518.1| zinc-binding alcohol dehydrogenase [Burkholderia cenocepacia AU
           1054]
 gi|116690273|ref|YP_835896.1| alcohol dehydrogenase [Burkholderia cenocepacia HI2424]
 gi|170733612|ref|YP_001765559.1| PIG3 family NAD(P)H quinone oxidoreductase [Burkholderia
           cenocepacia MC0-3]
 gi|105893380|gb|ABF76545.1| Alcohol dehydrogenase, zinc-binding protein [Burkholderia
           cenocepacia AU 1054]
 gi|116648362|gb|ABK09003.1| Alcohol dehydrogenase, zinc-binding domain protein [Burkholderia
           cenocepacia HI2424]
 gi|169816854|gb|ACA91437.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia
           cenocepacia MC0-3]
          Length = 339

 Score =  319 bits (818), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 223/334 (66%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ LAE P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLAERPRPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV     D   N     +GD VCAL+ GGGYAEY ++     LP+P G   I
Sbjct: 61  PGLEVAGEIVGGDLSDAALNPFGLKLGDRVCALLAGGGYAEYAVAPLPQCLPVPDGLTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGAGEGGEQETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A + +KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGTADKCRACEALGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVAGSYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A E+NL+ I+ +R+T+TGSTLR R    K  I   L+ ++WPLL  
Sbjct: 241 GGRLVLIALLGGAKA-EVNLSEILRRRLTVTGSTLRPRPVEFKARIAAQLKARVWPLLAD 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP    A AH +ME SEH GKI+L
Sbjct: 300 GRIKPVIYRVLPAADAAQAHALMESSEHTGKIVL 333


>gi|161524201|ref|YP_001579213.1| PIG3 family NAD(P)H quinone oxidoreductase [Burkholderia
           multivorans ATCC 17616]
 gi|189351042|ref|YP_001946670.1| NADPH2:quinone reductase [Burkholderia multivorans ATCC 17616]
 gi|160341630|gb|ABX14716.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia
           multivorans ATCC 17616]
 gi|189335064|dbj|BAG44134.1| NADPH2:quinone reductase [Burkholderia multivorans ATCC 17616]
          Length = 339

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 166/334 (49%), Positives = 221/334 (66%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+PQ+ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLTERPRPEPQRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLE+AG+IV     D   N     +GD VCAL+ GGGYAEY        LP+P+G   I
Sbjct: 61  PGLEIAGEIVGGDLSDAALNPFGLKLGDRVCALLAGGGYAEYATVPLLQCLPVPRGLTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGAGEGGEQETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A + EKC AC  LGA+ AI+Y  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGTAEKCRACEALGAERAIDYKTEDFVEVVKSLTNDRGVDVILDMVAGSYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L+II+ LGG  A E+NL  I+ +R+TITGSTLR R    K  I   L+ ++WPL+  
Sbjct: 241 GGRLVIIALLGGAKA-EVNLGEILRRRLTITGSTLRPRPVEFKAQIAAQLKARVWPLIED 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP    A AH +ME SEHIGKI+L
Sbjct: 300 GRIKPVIYRVLPAADAAQAHALMESSEHIGKIVL 333


>gi|300691022|ref|YP_003752017.1| NADPH:quinone reductase (Cryz) [Ralstonia solanacearum PSI07]
 gi|299078082|emb|CBJ50725.1| putative NADPH:quinone reductase (Cryz) [Ralstonia solanacearum
           PSI07]
          Length = 338

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 222/333 (66%), Gaps = 11/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ YG   V+   E P+P+P+  E+LI+V A GVNRPDV QR G YP P  A+ I
Sbjct: 5   MKAIEIAQYGGPEVLKPTERPMPEPKAGEVLIRVRAAGVNRPDVFQRTGNYPVPPGASDI 64

Query: 67  LGLEVAGKIV--DL--GENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV  DL   +N      GD VCALV GGGYAE+C +  G  LP+P G + I+
Sbjct: 65  PGLEVAGEIVGGDLTHADNRYGLKTGDRVCALVQGGGYAEFCTAPLGQVLPVPAGLSDIE 124

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE++FTVW+N+F    L  G     +T+L+ GGSSGIGTTAIQ+AS  G  V+ TA
Sbjct: 125 AAALPENYFTVWSNVFDRGQLGQGAHGRDETLLVQGGSSGIGTTAIQMASALGYRVFATA 184

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            +  KC AC++LGA  AI+Y  EDF+EI++ ET GRG+D++LDMVG  Y+ + +   + +
Sbjct: 185 GTAGKCAACIELGASRAIHYKTEDFVEIVKAET-GRGVDVVLDMVGGSYVAREIACTADD 243

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+ L  I+ +RIT+TGSTLR R    K +I   L   +WPLL S 
Sbjct: 244 GRIVLIALLGGTKA-EVPLGDILRRRITLTGSTLRPRPVAFKAAIAAHLYEAVWPLLASG 302

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PVIH ++P    A AH +ME S HIGKI+L
Sbjct: 303 RIRPVIHEMMPAEHAAQAHALMESSAHIGKIML 335


>gi|167585968|ref|ZP_02378356.1| Alcohol dehydrogenase, zinc-binding domain protein [Burkholderia
           ubonensis Bu]
          Length = 339

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 168/334 (50%), Positives = 225/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ LAE P P+PQ+ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLAERPRPEPQRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV--DLGE---NTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV  DL +   N     +GD VCAL+ GGGYAEY ++     LP+P G   I
Sbjct: 61  PGLEVAGEIVGGDLSDPALNPFGLKLGDRVCALLAGGGYAEYAVAPLPQCLPVPDGLTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE++FTVW+N+F  A L +G+     T+L+ GGSSGIG TAIQLA   G  V+ T
Sbjct: 121 EAASLPETYFTVWSNVFDRALLGAGEGGEQETLLVQGGSSGIGVTAIQLAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A + +KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGNADKCRACEALGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVAGAYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A EINLN I+ +R+T+TGSTLR R    K  I   L+ ++WPL   
Sbjct: 241 GGRLVLIALLGGAKA-EINLNEILRRRLTVTGSTLRPRPVEFKARIAAQLKARVWPLFGE 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP  + A AH +ME  EHIGKI+L
Sbjct: 300 GRIKPVIYRVLPAAEAAQAHALMESGEHIGKIML 333


>gi|300311093|ref|YP_003775185.1| NADPH:quinone oxidoreductase [Herbaspirillum seropedicae SmR1]
 gi|300073878|gb|ADJ63277.1| NADPH:quinone oxidoreductase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 325

 Score =  319 bits (817), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 159/326 (48%), Positives = 222/326 (68%), Gaps = 5/326 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +  +G   V+   E P+P+ +  E+LIKV A GVNRPDV QR G YP P  A+ +
Sbjct: 1   MRAIEIKEFGGPEVLQACERPVPELKAGEVLIKVHAAGVNRPDVFQRTGNYPVPPGASDL 60

Query: 67  LGLEVAGKIV--DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            GLEVAG+IV  DLG+  + + +GD VCALV GGGYAE+C +     LP+PKG +A++AA
Sbjct: 61  PGLEVAGEIVAGDLGD--SGFKLGDLVCALVQGGGYAEFCAAPLAQCLPVPKGLSALEAA 118

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           +LPE++FTVW+N+F    L   +T+L+ GGSSGIG TAIQ+A   G  V+ TA S EKC 
Sbjct: 119 ALPENYFTVWSNVFDRGQLSGEETLLVQGGSSGIGVTAIQIARALGHRVFATAGSAEKCR 178

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC +LGA+ AINY  EDF  ++++ T GRG+D+ILDMVG +YL + +  L+ +G+L+ I+
Sbjct: 179 ACEELGAERAINYKTEDFEAVVKELTGGRGVDVILDMVGGDYLPREIKALADDGRLVFIA 238

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
            LGG    ++++  ++ +R+TITGSTLR R    K +I   L+  +WPL+ +  I PVIH
Sbjct: 239 QLGGA-KGQLDMGQVMRRRLTITGSTLRPRPVAFKAAIAAKLREHVWPLIEAGKIRPVIH 297

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
              PL + A AH +ME S HIGKI+L
Sbjct: 298 HRFPLEQAAQAHAMMEGSTHIGKIML 323


>gi|330817795|ref|YP_004361500.1| Alcohol dehydrogenase, zinc-binding domain protein [Burkholderia
           gladioli BSR3]
 gi|327370188|gb|AEA61544.1| Alcohol dehydrogenase, zinc-binding domain protein [Burkholderia
           gladioli BSR3]
          Length = 339

 Score =  318 bits (816), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 160/334 (47%), Positives = 222/334 (66%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G   V+ L E P P P++ E+LIKV A G+NRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPEVLKLVERPRPDPKRGEVLIKVAAFGINRPDVFQRKGAYAPPAGASDL 60

Query: 67  LGLEVAGKIV--DLGE---NTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV  + G+   N     +GD VCAL+ GGGYAEY  +     LP+P G + +
Sbjct: 61  PGLEVAGEIVGGEFGDGVANPFGLKLGDRVCALLAGGGYAEYATAPLAQCLPVPAGLSEV 120

Query: 122 QAASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F    L  G     +T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRGGLGRGEGGEQETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A ++EKC AC  LGA+ AINY  EDF+++++  T  RG+D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGTDEKCRACEALGAERAINYRNEDFVDVVKSLTNDRGVDVILDMVAGTYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A E++L  I+ +R+TITGSTLR R    K  I   L+  +WPL+ +
Sbjct: 241 GGRLVVIALLGGAKA-EVSLGEILRRRLTITGSTLRPRPVEFKARIAAQLKETVWPLIEA 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + PVIH VLP  + A AH +ME SEH+GKI+L
Sbjct: 300 GTVRPVIHCVLPASEAAQAHALMESSEHVGKIVL 333


>gi|126732360|ref|ZP_01748160.1| alcohol dehydrogenase, zinc-containing [Sagittula stellata E-37]
 gi|126707229|gb|EBA06295.1| alcohol dehydrogenase, zinc-containing [Sagittula stellata E-37]
          Length = 326

 Score =  318 bits (816), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 220/324 (67%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +S  G   V+     P+P+P   ++++KV   GVNRPD +QR G Y PP  A+ +
Sbjct: 4   MRAIEISEAGGPEVLKPCTRPVPEPGAGKVVLKVAYAGVNRPDALQRAGRYAPPPGASDL 63

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G++V +G       +GD VCAL+ GGGYAEY  +   H LP+P+G    +AA L
Sbjct: 64  PGLEASGEVVAVGAGVDWPAVGDRVCALLPGGGYAEYVATPAAHCLPVPEGMGMKEAACL 123

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+F+TVW+N+F    L++G+  LIHGGSSGIGTTAIQLA +FGA V+ TA S EKC AC
Sbjct: 124 PETFYTVWSNVFMRGGLQAGERFLIHGGSSGIGTTAIQLAKHFGARVFATAGSAEKCAAC 183

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+ AINY  EDF++++++E    G ++ILDMVG +Y+ +++  L+++G+L+ I+FL
Sbjct: 184 EALGAERAINYRDEDFVKVMKEEG---GANLILDMVGGDYIPRNVKTLAEDGRLVQIAFL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    E+N   ++ KR+TITGSTLR ++D+AK  I D L+ K+WPLL++  +APV+ + 
Sbjct: 241 QGP-QVELNFAQVMVKRLTITGSTLRPQSDLAKARIADELKAKVWPLLDAGKVAPVMDSE 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   + AH  ME S HIGKI+L
Sbjct: 300 FALDDASGAHARMESSGHIGKIVL 323


>gi|84502492|ref|ZP_01000628.1| quinone oxidoreductase [Oceanicola batsensis HTCC2597]
 gi|84389304|gb|EAQ02101.1| quinone oxidoreductase [Oceanicola batsensis HTCC2597]
          Length = 332

 Score =  318 bits (816), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 156/326 (47%), Positives = 217/326 (66%), Gaps = 1/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + MRH+ + G+G   V+    +P P P   E+LI+V A GVNRPDV+QR+G YPPP    
Sbjct: 3   ETMRHITIDGFGGPEVLKPVTAPRPVPAAGEVLIRVHAAGVNRPDVVQRRGAYPPPPGVT 62

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            I GLEVAG I  LGE  TH + G+ VCALV GGGYAEY     G  LP+P+G++ +QAA
Sbjct: 63  EIPGLEVAGTIEALGEGMTHLSPGEAVCALVAGGGYAEYVAVPAGQVLPLPEGFDMVQAA 122

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           +LPE+FFTVWAN+F+   L+ G+++L+HGGSSGIGTTAIQLA   GA V+ TA+S EK  
Sbjct: 123 ALPETFFTVWANVFELGGLKRGESLLVHGGSSGIGTTAIQLAVALGARVFATARSPEKVE 182

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC  LGA+ AI+Y +E+F + L + T+G GID+ILDM G ++  ++L  L+  G+++ I+
Sbjct: 183 ACRALGAQVAIDYTQENFADRLLEVTEGAGIDVILDMRGGDFFPENLRALAYRGRMVSIA 242

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
            L G   T +++  ++ KR  ITGSTLR R    K +I   L  ++WPL  +  + P I 
Sbjct: 243 SLAGREVT-LDIALMMRKRAMITGSTLRGRPVAEKAAIARELLDQVWPLFATSPMRPQIA 301

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
            V PL + A AH+ +E +  +GKI+L
Sbjct: 302 EVFPLARAAEAHERLETNTVVGKIVL 327


>gi|254501368|ref|ZP_05113519.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Labrenzia
           alexandrii DFL-11]
 gi|222437439|gb|EEE44118.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Labrenzia
           alexandrii DFL-11]
          Length = 334

 Score =  318 bits (816), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 218/324 (67%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ VA+S  G   V+ L +  +P   + +ILI+VEA GVNRPDV+QR G YPPPK A+ +
Sbjct: 8   MKVVAISEPGGPEVLILEQRALPDVGEGDILIRVEAAGVNRPDVLQRMGAYPPPKGASDL 67

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG++V +G      + GD+V AL  GGGYAEYC    GH LP+P G +  +AA+L
Sbjct: 68  PGLEVAGEVVAVGAAVKGHSAGDKVTALCPGGGYAEYCKVPAGHALPVPAGMSVFEAAAL 127

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW N+F    LR G+  L+HGG+SGIGT AIQLA  FGA V+TT  S EK  A 
Sbjct: 128 PETFFTVWTNVFDRCGLRKGERFLVHGGASGIGTCAIQLAKAFGAEVFTTVGSSEKIEAV 187

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA H INY ++ F +++ + T G+G+D+ILDMVG +Y+ ++    + EG++  I+ L
Sbjct: 188 KALGADHVINYREQAFEKVILEVTGGQGVDVILDMVGGDYVERNWKAAAIEGRICQIATL 247

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G ++ ++N + ++ KR+T TG+TLR R D  K +I DSL+ K+WPL+ S  I P+I + 
Sbjct: 248 NG-VSHDVNFSRLMVKRLTHTGTTLRPRDDAFKSAIADSLRFKVWPLIESGQIKPLIDST 306

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH  ME S HIGKI++
Sbjct: 307 FPLSEAAEAHRRMESSGHIGKIVM 330


>gi|99082357|ref|YP_614511.1| zinc-binding alcohol dehydrogenase [Ruegeria sp. TM1040]
 gi|99038637|gb|ABF65249.1| Alcohol dehydrogenase zinc-binding [Ruegeria sp. TM1040]
          Length = 334

 Score =  318 bits (816), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 223/326 (68%), Gaps = 4/326 (1%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + MR + +S +G  NV+ L E P+P     +++I+V   GVNRPD +QR G Y PPK A+
Sbjct: 7   QTMRAIEISEFGAPNVLKLVERPVPSAGYGQVVIRVAYAGVNRPDALQRAGAYAPPKGAS 66

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            + GLE +G+IV LGE  T WN+GD VCAL+ GGGYA+Y  +   H LP+PKG +  +AA
Sbjct: 67  DLPGLEASGEIVALGEGVTGWNLGDRVCALLPGGGYADYVATPAAHCLPVPKGLSLKEAA 126

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
            LPE+ FTVW+N+     LR+G+  L+HGGSSGIGTTAIQLAS  GA VY TA S++KC 
Sbjct: 127 CLPETCFTVWSNVVTRGGLRAGERFLVHGGSSGIGTTAIQLASALGARVYATAGSDDKCA 186

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC+ LGA  AINY  EDF+EIL+ +    G  +ILDMVG +Y+ +++  L+ +G+L+ I+
Sbjct: 187 ACVGLGADVAINYRDEDFVEILRADG---GAHLILDMVGGDYIPRNIKALADDGRLVHIA 243

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FL G  A E+N   I+++R+T+TGSTLR ++D+AK  I   L   +WPL+ +  + PV+ 
Sbjct: 244 FLQGPKA-ELNFAQIMARRLTVTGSTLRPQSDLAKARIARDLLEAVWPLIEAGKLRPVMD 302

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +   L + A+AH  ME S HIGKI+L
Sbjct: 303 STFALAEAAIAHARMEGSTHIGKIVL 328


>gi|53718844|ref|YP_107830.1| putative oxidoreductase [Burkholderia pseudomallei K96243]
 gi|53725828|ref|YP_103437.1| zinc-binding oxidoreductase family protein [Burkholderia mallei
           ATCC 23344]
 gi|67642195|ref|ZP_00440955.1| NADPH:quinone reductase [Burkholderia mallei GB8 horse 4]
 gi|121600658|ref|YP_992466.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei SAVP1]
 gi|124384457|ref|YP_001026731.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei NCTC 10229]
 gi|126439870|ref|YP_001058335.1| zinc-binding dehydrogenase family oxidoreductase [Burkholderia
           pseudomallei 668]
 gi|126451186|ref|YP_001079984.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei NCTC 10247]
 gi|167000371|ref|ZP_02266189.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei PRL-20]
 gi|167718840|ref|ZP_02402076.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia pseudomallei DM98]
 gi|167737849|ref|ZP_02410623.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia pseudomallei 14]
 gi|167815033|ref|ZP_02446713.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia pseudomallei 91]
 gi|167823449|ref|ZP_02454920.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia pseudomallei 9]
 gi|167845001|ref|ZP_02470509.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia pseudomallei B7210]
 gi|167893542|ref|ZP_02480944.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia pseudomallei 7894]
 gi|167910224|ref|ZP_02497315.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia pseudomallei 112]
 gi|167918257|ref|ZP_02505348.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia pseudomallei BCC215]
 gi|226195345|ref|ZP_03790934.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei Pakistan 9]
 gi|254181190|ref|ZP_04887787.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei 1655]
 gi|254195153|ref|ZP_04901582.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei S13]
 gi|254202113|ref|ZP_04908476.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei FMH]
 gi|254207443|ref|ZP_04913793.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei JHU]
 gi|254298530|ref|ZP_04965982.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei 406e]
 gi|52209258|emb|CAH35203.1| putative oxidoreductase [Burkholderia pseudomallei K96243]
 gi|52429251|gb|AAU49844.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei ATCC 23344]
 gi|121229468|gb|ABM51986.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei SAVP1]
 gi|124292477|gb|ABN01746.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           mallei NCTC 10229]
 gi|126219363|gb|ABN82869.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei 668]
 gi|126244056|gb|ABO07149.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei NCTC 10247]
 gi|147746360|gb|EDK53437.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei FMH]
 gi|147751337|gb|EDK58404.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei JHU]
 gi|157808404|gb|EDO85574.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei 406e]
 gi|169651901|gb|EDS84594.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei S13]
 gi|184211728|gb|EDU08771.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei 1655]
 gi|225932547|gb|EEH28545.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei Pakistan 9]
 gi|238523291|gb|EEP86730.1| NADPH:quinone reductase [Burkholderia mallei GB8 horse 4]
 gi|243063705|gb|EES45891.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei PRL-20]
          Length = 339

 Score =  318 bits (816), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 162/334 (48%), Positives = 222/334 (66%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLTERPQPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV     D   N     +GD VCAL+ GGGYA+Y  +     LP+PKG   +
Sbjct: 61  PGLEVAGEIVGGDLADSAANPFGLKLGDRVCALLAGGGYAQYVAAPLAQCLPVPKGLTDV 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
            AASLPE+FFTVW+N+F  A L +G+     T L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 DAASLPETFFTVWSNVFDRAQLGAGEGGAQETFLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A +++KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L  L+ 
Sbjct: 181 AGTDDKCRACEALGAERAINYKSEDFVEVVKSLTHDRGVDVILDMVAGAYVPRELAALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A EIN+  I+ +R+TITGSTLR R    K +I   L+ ++WPL+  
Sbjct: 241 GGRLVVIALLGGAKA-EINVAEILRRRLTITGSTLRPRPVEFKAAIAAQLKARVWPLIED 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + PVI+ VLP  + A AH +ME SEH+GKI+L
Sbjct: 300 GRVKPVIYRVLPAAQAADAHALMESSEHVGKIVL 333


>gi|163744809|ref|ZP_02152169.1| alcohol dehydrogenase, zinc-containing, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161381627|gb|EDQ06036.1| alcohol dehydrogenase, zinc-containing, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 336

 Score =  318 bits (816), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 156/328 (47%), Positives = 220/328 (67%), Gaps = 4/328 (1%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + + MR + ++  G  +V+     P PQP+  +++IKV   GVNRPD +QR G Y PP  
Sbjct: 1   MTQTMRAIEITEPGGPDVLQGTTRPRPQPKHGQVIIKVAFAGVNRPDALQRAGKYAPPAT 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE +G++V++G   T    GD VCAL+ GGGYAEY  +   H LPIP G    +
Sbjct: 61  ASDLPGLEASGEVVEVGPGVTTLAPGDLVCALLPGGGYAEYVATPAAHCLPIPDGMGLKE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA LPE+FFTVW+NLF    L++G+ VLIHGGSSGIGTTAIQLA   GA V+ TA ++ K
Sbjct: 121 AACLPETFFTVWSNLFMRGGLKAGEKVLIHGGSSGIGTTAIQLARILGARVFVTAGTDSK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C AC+KLGA+ AINY   DF+++LQ E    G D+ILDMVG  Y+N++L  L+++G+L+ 
Sbjct: 181 CAACMKLGAEVAINYRDTDFVDVLQAEG---GADVILDMVGGSYINRNLKALAEDGRLVQ 237

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+FL G    E+N   ++++R+T+TGSTLR ++D+AK  I + L   +WPLL +  ++PV
Sbjct: 238 IAFLQG-AKEEVNFVTLMTRRLTMTGSTLRPQSDLAKARIAEELMQNVWPLLEAGRVSPV 296

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           + +   L +   AH  ME S HIGKI+L
Sbjct: 297 MDSTYDLSEANDAHRRMEASGHIGKIVL 324


>gi|163855934|ref|YP_001630232.1| put. NADPH quinone oxidoreductase, zinc binding [Bordetella petrii
           DSM 12804]
 gi|163259662|emb|CAP41963.1| put. NADPH quinone oxidoreductase, zinc binding [Bordetella petrii]
          Length = 325

 Score =  318 bits (815), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 224/324 (69%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V +S  G   V+  A+ P+P+P   E+LIKV A G+NRPDV QRKG Y PP  A+ +
Sbjct: 1   MRAVEISQPGGPEVLVPADRPMPEPGAGEVLIKVAAAGINRPDVFQRKGNYAPPPGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG+IV        +++GD+VCALV GGGYAEYC++     LPIPKG + I+AA L
Sbjct: 61  PGLELAGEIVGGDAAAGGFSVGDKVCALVAGGGYAEYCVAPVAQCLPIPKGLSEIEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVW+N+F    L+ G+++L+HGG+SGIGTTAIQLA   G TVY T  S+E+  A 
Sbjct: 121 PETYFTVWSNVFDRGALQDGESLLVHGGASGIGTTAIQLARAMGNTVYATVGSDERARAV 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY  +DF++ ++  T G+G+++ILDMV  EY+N+++  L+ +G++++I+ L
Sbjct: 181 EALGAARGINYKTQDFVQEVRDATGGKGVNVILDMVAGEYINRNMKCLADDGRIVVIALL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E++ N I+ +R+T+TGSTLR R    K +I  +L+ ++WPLL    I P++H  
Sbjct: 241 GGARA-EVDCNQILRRRLTLTGSTLRPRPVAFKAAIARALRERVWPLLEQGAIKPIVHAT 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH +ME  E+IGKIIL
Sbjct: 300 FPLEQAAAAHAMMEAGENIGKIIL 323


>gi|83311778|ref|YP_422042.1| NADPH:quinone reductase and related Zn-dependent oxidoreductase
           [Magnetospirillum magneticum AMB-1]
 gi|82946619|dbj|BAE51483.1| NADPH:quinone reductase and related Zn-dependent oxidoreductase
           [Magnetospirillum magneticum AMB-1]
          Length = 330

 Score =  318 bits (815), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 163/326 (50%), Positives = 222/326 (68%), Gaps = 1/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + M  V +S  G   V+     P+P P+  E+LIKV A G+NRPDV+QR G YP P  A+
Sbjct: 4   ETMTCVEISTPGAPEVLKPVTRPLPSPKAGEVLIKVAAAGINRPDVLQRAGAYPAPPGAS 63

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            + GLEVAG I  LGE      +G  VCAL  GGGYAEYC     H LPIP GY+ I+AA
Sbjct: 64  DLPGLEVAGTIAALGEGAASPALGSRVCALAPGGGYAEYCTVDARHCLPIPAGYDMIRAA 123

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           +LPE+FFTVW N+ +   L++G+  L+HGG+ GIGTTAIQLA   GATV+ TA  E K  
Sbjct: 124 ALPETFFTVWHNVVERGQLKAGERFLVHGGAGGIGTTAIQLAKALGATVFATANGEAKGK 183

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC  LGA  AI+Y   DF+E+++ ET+G+G+D+ILDMVG +Y+ +++  L+ +G+L+ I+
Sbjct: 184 ACRDLGADFAIDYSTADFVEVIKAETKGKGVDVILDMVGGDYIARNIKSLAADGRLVSIA 243

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FL G+ A EINL P++ KR+T+TGSTLR +++ AK  +   L   +WPLL+   IAP+IH
Sbjct: 244 FLRGSSA-EINLMPVMLKRLTLTGSTLRPQSNDAKARMARGLAETVWPLLDKGAIAPLIH 302

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
            V PL + A AH +ME + H+GKI+L
Sbjct: 303 AVFPLAEAAKAHALMESNAHMGKIVL 328


>gi|170023978|ref|YP_001720483.1| PIG3 family NAD(P)H quinone oxidoreductase [Yersinia
           pseudotuberculosis YPIII]
 gi|169750512|gb|ACA68030.1| NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pseudotuberculosis YPIII]
          Length = 336

 Score =  318 bits (815), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 159/325 (48%), Positives = 219/325 (67%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++ +G   V+  A+ P P P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 11  MVAIEITQFGGPEVLVPAKRPTPMPAAGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDI 70

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG++V +  + T + IGD VC L+ GGGYA+YC+ H+ + LPIP+G +AI+AA+L
Sbjct: 71  PGLEVAGEVVAIAADVTRFKIGDNVCGLIAGGGYAQYCVIHETNALPIPQGLSAIEAAAL 130

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKCLA 185
           PE+FFTVW NLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FG ATV  T  SEEK  A
Sbjct: 131 PETFFTVWTNLFQRGHFTAGETVLIHGGSSGIGTTAILLSKAFGAATVIVTVGSEEKRQA 190

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA  AINY  +DF+   ++ T G+G D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 191 CLNLGADIAINYHTQDFVAETKRATAGKGADVIVDLIAGDYVARNYDAAAMNGRIVQIGT 250

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             G+ A ++NL  ++ KR+T TGSTLR RT   K  I + L+  +WPLL+   + P I +
Sbjct: 251 QNGH-AKDLNLMLMLIKRLTHTGSTLRSRTVAEKALIANELEQHVWPLLSEGKMKPQIFS 309

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL   A AH++ME S HIGKI+L
Sbjct: 310 TFPLEAAAKAHELMESSTHIGKIVL 334


>gi|76809436|ref|YP_332841.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia pseudomallei 1710b]
 gi|134283954|ref|ZP_01770650.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia pseudomallei 305]
 gi|217419862|ref|ZP_03451368.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei 576]
 gi|254175394|ref|ZP_04882054.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei ATCC 10399]
 gi|254190553|ref|ZP_04897060.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254261156|ref|ZP_04952210.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei 1710a]
 gi|254359865|ref|ZP_04976135.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei 2002721280]
 gi|76578889|gb|ABA48364.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia pseudomallei 1710b]
 gi|134244743|gb|EBA44841.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia pseudomallei 305]
 gi|148029105|gb|EDK87010.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei 2002721280]
 gi|157938228|gb|EDO93898.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160696438|gb|EDP86408.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia mallei ATCC 10399]
 gi|217397166|gb|EEC37182.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei 576]
 gi|254219845|gb|EET09229.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei 1710a]
          Length = 360

 Score =  318 bits (815), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 162/334 (48%), Positives = 222/334 (66%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 22  MKAIEITEFGAPDVLKLTERPQPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 81

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV     D   N     +GD VCAL+ GGGYA+Y  +     LP+PKG   +
Sbjct: 82  PGLEVAGEIVGGDLADSAANPFGLKLGDRVCALLAGGGYAQYVAAPLAQCLPVPKGLTDV 141

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
            AASLPE+FFTVW+N+F  A L +G+     T L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 142 DAASLPETFFTVWSNVFDRAQLGAGEGGAQETFLVQGGSSGIGVTAIQIAHALGFRVFAT 201

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A +++KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L  L+ 
Sbjct: 202 AGTDDKCRACEALGAERAINYKSEDFVEVVKSLTHDRGVDVILDMVAGAYVPRELAALAD 261

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A EIN+  I+ +R+TITGSTLR R    K +I   L+ ++WPL+  
Sbjct: 262 GGRLVVIALLGGAKA-EINVAEILRRRLTITGSTLRPRPVEFKAAIAAQLKARVWPLIED 320

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + PVI+ VLP  + A AH +ME SEH+GKI+L
Sbjct: 321 GRVKPVIYRVLPAAQAADAHALMESSEHVGKIVL 354


>gi|153947557|ref|YP_001400605.1| NAD(P)H quinone oxidoreductase PIG3 family protein [Yersinia
           pseudotuberculosis IP 31758]
 gi|152959052|gb|ABS46513.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pseudotuberculosis IP 31758]
          Length = 336

 Score =  318 bits (814), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 159/325 (48%), Positives = 219/325 (67%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++ +G   V+  A+ P P P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 11  MVAIEITQFGGPEVLVPAKRPTPMPAAGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDI 70

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG++V +  + T + IGD VC L+ GGGYA+YC+ H+ + LPIP+G +AI+AA+L
Sbjct: 71  PGLEVAGEVVAIAADVTRFKIGDNVCGLIAGGGYAQYCVIHETNALPIPQGLSAIEAAAL 130

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKCLA 185
           PE+FFTVW NLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FG ATV  T  SEEK  A
Sbjct: 131 PETFFTVWTNLFQRGHFTAGETVLIHGGSSGIGTTAILLSKAFGAATVIVTVGSEEKRQA 190

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA  AINY  +DF+   ++ T G+G D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 191 CLHLGADIAINYHTQDFVAETKRATAGKGADVIVDLIAGDYVARNYDAAAMNGRIVQIGT 250

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             G+ A ++NL  ++ KR+T TGSTLR RT   K  I + L+  +WPLL+   + P I +
Sbjct: 251 QNGH-AKDLNLMLMLIKRLTHTGSTLRSRTVAEKALIANELEQHVWPLLSEGKMKPQIFS 309

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL   A AH++ME S HIGKI+L
Sbjct: 310 TFPLEAAAKAHELMESSTHIGKIVL 334


>gi|295676034|ref|YP_003604558.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp.
           CCGE1002]
 gi|295435877|gb|ADG15047.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp.
           CCGE1002]
          Length = 338

 Score =  318 bits (814), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 219/333 (65%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G   V+ LAE P PQ +  E+LIKV A G+NRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPEVLKLAERPTPQLKAGEVLIKVAASGINRPDVFQRKGGYAPPPGASDL 60

Query: 67  LGLEVAGKIV----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEV+G+IV    D   N     IGD VCAL+ GGGYAEY  +     LP+P G + ++
Sbjct: 61  PGLEVSGEIVGGTIDAKNNPFGLKIGDRVCALLAGGGYAEYAAAPLLQCLPVPAGLSDVE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AASLPE+FFTVW+N+F  A L  G+     T+L+ GGSSGIG TAIQ+A   G  V+ TA
Sbjct: 121 AASLPETFFTVWSNVFNRAQLGQGEGGANETLLVQGGSSGIGVTAIQIAHALGFRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S+EKC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L+  
Sbjct: 181 GSDEKCRACEALGAERAINYKTEDFVEVIKSLTNDRGVDVILDMVAGSYVPRELSALADG 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+NLN ++ +R+T+TGSTLR R    K  I   L+ ++WP L + 
Sbjct: 241 GRIVLIALLGGAKA-ELNLNEVLRRRLTVTGSTLRPRPIEFKAQIAAQLKERVWPHLEAG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PV+H V P  +   AH +ME S H+GKI+L
Sbjct: 300 RIKPVVHRVFPAAQAGDAHTLMESSTHVGKIVL 332


>gi|260431611|ref|ZP_05785582.1| quinone oxidoreductase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415439|gb|EEX08698.1| quinone oxidoreductase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 328

 Score =  318 bits (814), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 156/328 (47%), Positives = 226/328 (68%), Gaps = 4/328 (1%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + K MR V ++  G  +V+ L E PIP+P   ++++KV   GVNRPD +QR G Y PP  
Sbjct: 1   MTKMMRAVEITSPGGPDVLQLTERPIPEPGHGQVVLKVAYAGVNRPDALQRAGAYDPPPG 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE +G++V +G   +   +GD+VCAL+ GGGYAEY  +   H LP+P G    +
Sbjct: 61  ASDLPGLEASGEVVAIGAGVSGLALGDKVCALLPGGGYAEYVATPAAHCLPVPNGMGLKE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA LPE+FFTVW+N+F    L++G+  L+HGGSSGIGTTAIQLA+ FGA V+ TA S+EK
Sbjct: 121 AACLPETFFTVWSNVFTRGGLKAGERFLVHGGSSGIGTTAIQLANAFGARVFATAGSDEK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C AC+ LGA+ AINY  +DF+ +++ E    G D+ILDMVG +Y+ +++  L+++G+L+ 
Sbjct: 181 CAACVALGAEKAINYKTDDFVAVMRAEG---GADLILDMVGGDYIPRNVKSLAEDGRLVQ 237

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+FL G +A E+N   ++ KR+T+TGSTLR ++D+AK  I   L+  +WPLL +  +APV
Sbjct: 238 IAFLQGPVA-ELNFALMMVKRLTLTGSTLRPQSDLAKARIAQDLREAVWPLLEAGKVAPV 296

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           + +   L + A AH  ME S HIGKI+L
Sbjct: 297 MDSEFDLAEAAAAHARMESSGHIGKIVL 324


>gi|239816486|ref|YP_002945396.1| NAD(P)H quinone oxidoreductase, PIG3 family [Variovorax paradoxus
           S110]
 gi|239803063|gb|ACS20130.1| NAD(P)H quinone oxidoreductase, PIG3 family [Variovorax paradoxus
           S110]
          Length = 332

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 160/334 (47%), Positives = 224/334 (67%), Gaps = 14/334 (4%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ YG   V+   E P P     E+LI+V A GVNRPDV+QRKG YP P  A+ +
Sbjct: 1   MKAIEITSYGAPEVLRAVERPDPVAGVGELLIRVAASGVNRPDVLQRKGHYPVPPGASDL 60

Query: 67  LGLEVAGKIVD-----LGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV      L E    + +GD VCAL+ GGGYA+ C++     LP+PKG++ I
Sbjct: 61  PGLEVAGEIVSGDAAALAE--AGFKVGDRVCALIAGGGYAQLCVAPVAQCLPVPKGWSDI 118

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
           +AASLPE+FFTVW+N+F+   L+ G+T+LI GG+SGIG TAIQ+A   GATV  TA S++
Sbjct: 119 EAASLPETFFTVWSNVFERGRLQKGETLLIQGGTSGIGVTAIQIAKALGATVIATAGSDD 178

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           KC AC KLGA HAINY   DF E  +K T G+G+D++LDMV  +Y+ + +  ++++G+L+
Sbjct: 179 KCEACKKLGADHAINYRTSDFAEEAKKLTGGKGVDVVLDMVAGDYVAREIECMAEDGRLV 238

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
           II+  GG + ++ N   ++ KR+ ITGSTLR R    K +I  +L+ K+WPLL S  + P
Sbjct: 239 IIAVQGG-VKSDFNAGLVLRKRLVITGSTLRPRPVAFKGAIAKALREKVWPLLESGAVKP 297

Query: 302 VIHTVL-----PLGKVAMAHDIMEKSEHIGKIIL 330
           VIH+       P G  A AH +ME ++HIGKI+L
Sbjct: 298 VIHSTFAADGEPSG-AAQAHALMESNQHIGKIVL 330


>gi|187923337|ref|YP_001894979.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia
           phytofirmans PsJN]
 gi|187714531|gb|ACD15755.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia
           phytofirmans PsJN]
          Length = 338

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 162/333 (48%), Positives = 223/333 (66%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ LAE P+PQP+  E+LIKV A G+NRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLAERPMPQPKAGEVLIKVAASGINRPDVFQRKGGYAPPPGASDL 60

Query: 67  LGLEVAGKIV----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV    D   N     +GD VCAL+ GGGYAEY ++     LP+P G + ++
Sbjct: 61  PGLEVAGEIVEGSIDEKNNPFGLKVGDRVCALLAGGGYAEYAVAPLLQCLPVPAGLSDVE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AASLPE+FFTVW+N+F  A L  G+     T+L+ GGSSGIG TAIQ+A   G  V+ TA
Sbjct: 121 AASLPETFFTVWSNVFDRAQLGKGEGAPNETLLVQGGSSGIGVTAIQIAHALGFRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S+EKC AC  LGA+ AINY  EDF+E+++  T  RG+D++LDMV   Y+++ LT L+  
Sbjct: 181 GSDEKCRACEALGAERAINYKTEDFVEVIKSLTNDRGVDVVLDMVAGSYVSRELTALADG 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+NLN ++ +R+T+TGSTLR R    K  I   L+  +WP L   
Sbjct: 241 GRIVLIALLGGAKA-ELNLNEVLRRRLTVTGSTLRPRPIEFKAKIAAQLKEYVWPHLEDG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PV+H V P  + A AH +ME S H+GKI+L
Sbjct: 300 RIKPVVHRVFPAAQAADAHALMESSTHVGKIVL 332


>gi|221199653|ref|ZP_03572697.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           multivorans CGD2M]
 gi|221205447|ref|ZP_03578462.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           multivorans CGD2]
 gi|221174285|gb|EEE06717.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           multivorans CGD2]
 gi|221180938|gb|EEE13341.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           multivorans CGD2M]
          Length = 339

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 221/334 (66%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+PQ+ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLTERPRPEPQRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLE+AG+IV     D   N     +GD VCAL+ GGGYAEY        LP+P+G   I
Sbjct: 61  PGLEIAGEIVGGDLSDAALNPFGLKLGDRVCALLAGGGYAEYATVPLLQCLPVPRGLTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGAGEGGEQETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A + +KC AC  LGA+ AI+Y  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGTADKCRACEALGAERAIDYKTEDFVEVVKSLTNDRGVDVILDMVAGSYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L+II+ LGG  A E+NL  I+ +R+TITGSTLR R    K  I   L+ ++WPL+  
Sbjct: 241 GGRLVIIALLGGAKA-EVNLGEILRRRLTITGSTLRPRPVEFKAQIAAQLKARVWPLIED 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP    A AH +ME SEHIGKI+L
Sbjct: 300 GRIKPVIYRVLPAADAAQAHALMESSEHIGKIVL 333


>gi|117922017|ref|YP_871209.1| response regulator receiver protein [Shewanella sp. ANA-3]
 gi|117614349|gb|ABK49803.1| response regulator receiver protein [Shewanella sp. ANA-3]
          Length = 332

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 151/322 (46%), Positives = 217/322 (67%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           H+ +   G+  VM L  SP+P P   ++LI+  A GVN PD+ QR G+YPPP  A+PI+G
Sbjct: 10  HIYLEQPGEPEVMQLTRSPLPVPSAGQVLIRNRAAGVNGPDIKQRMGVYPPPPGASPIIG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG+I  LGE  T W +GD+VCALV GGGY EY L++  H LPIPKG++ +QAA+LPE
Sbjct: 70  LEVAGEICALGEGVTQWQLGDKVCALVPGGGYGEYSLTYAEHCLPIPKGFSEVQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW NLF  A L++G+TVL+HGGS GIG+TAI LA + GATV  T   + K   C  
Sbjct: 130 TFFTVWGNLFMRAGLKAGETVLVHGGSGGIGSTAISLAKHLGATVIATTGQDAKRDYCAG 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA   +NY  ++F+E +   TQG+G++++ D+ G +++N +L  L+ +G+++ +S    
Sbjct: 190 LGAHLVVNYNTQNFVEEVMAFTQGKGVNVVFDIAGGDFINLNLQALALDGRMVSVSTQRS 249

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+++  +++KRI  TGSTLR ++  AK  I   L+ ++WPLL+S  I P I    P
Sbjct: 250 GKA-EVSILQLMAKRIVWTGSTLRPQSVAAKAEIAKQLRERVWPLLDSQQIVPHICATFP 308

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           L + A AH +M+  EH GK++L
Sbjct: 309 LAEAAKAHALMQSGEHRGKVVL 330


>gi|86140181|ref|ZP_01058743.1| alcohol dehydrogenase, zinc-containing [Roseobacter sp. MED193]
 gi|85823118|gb|EAQ43331.1| alcohol dehydrogenase, zinc-containing [Roseobacter sp. MED193]
          Length = 331

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 158/324 (48%), Positives = 217/324 (66%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +S  G   V+ L + P+P P   ++++KV   GVNRPD +QR G Y PP  A+ +
Sbjct: 5   MRAIEISTPGGPEVLTLTQRPMPVPGHGQVVLKVAYAGVNRPDALQRAGAYNPPPGASDL 64

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG++V LG   T   IGD VCAL+ GGGYAEY  +   H LPIP G +  QAA L
Sbjct: 65  PGLEAAGEVVALGAGVTGLEIGDRVCALLPGGGYAEYVATPAAHCLPIPDGLSLKQAACL 124

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVW+N+F    L +G+  L+HGGSSGIGTTAIQLAS  G  V+TT  S+EKC AC
Sbjct: 125 PETCFTVWSNVFTRGGLEAGERFLVHGGSSGIGTTAIQLASALGTRVFTTVGSDEKCQAC 184

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA+ AINY  EDF+E+L+ E    G ++ILDMVG +Y+ +++  L+ +G+++ I+FL
Sbjct: 185 LDLGAERAINYKNEDFVEVLRAEG---GANLILDMVGGDYIPRNIKTLADDGRMVHIAFL 241

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  A E+N   I+++R+T+TGSTLR ++D+AK  I   L   +WPL+ +  +APV+ + 
Sbjct: 242 SGPKA-ELNFAQIMARRLTVTGSTLRPQSDLAKARIAQDLFEVVWPLIEAGKLAPVMDSE 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L + A AH  ME S HIGKI+L
Sbjct: 301 FSLEEAAAAHARMESSGHIGKIVL 324


>gi|158422114|ref|YP_001523406.1| putative zinc-binding dehydrogenase [Azorhizobium caulinodans ORS
           571]
 gi|158329003|dbj|BAF86488.1| putative zinc-binding dehydrogenase [Azorhizobium caulinodans ORS
           571]
          Length = 382

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 216/329 (65%), Gaps = 1/329 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           P+   M  + +   G    +   E P+PQP K E+L+KV+A GVNRPDVMQRKGLYPPP 
Sbjct: 52  PLPATMTAITIPTPGGPEALVPGERPVPQPVKGELLVKVKAAGVNRPDVMQRKGLYPPPA 111

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A+ I GLE+AG +V  G  T  + +GD VCALV GGGYAEYC +     LPIP G +A 
Sbjct: 112 GASDIPGLEIAGTVVATGPETQRFKVGDRVCALVTGGGYAEYCTTSALTALPIPDGLSAT 171

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
           +AA+LPE+FFTVW+N+F    L+ G+ +L+HGG+SGIGTTAIQLA  FG+ V+ T  S E
Sbjct: 172 EAAALPETFFTVWSNVFDRGRLQPGEVLLVHGGTSGIGTTAIQLAKAFGSKVFVTVGSPE 231

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           KC A  KLGA  AI+Y  +DF+  ++  T G+G D+ILDMV  +Y+ ++    + +G+++
Sbjct: 232 KCEAARKLGADLAIDYNTQDFVAEVKSATGGKGADVILDMVAGDYIARNYEAAAVDGRIV 291

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I+F  G+ A +++   ++ KR+T TGSTLR R    K  I  +L+ K+WPL+    + P
Sbjct: 292 QIAFQKGSKA-QVDFMRVMLKRLTHTGSTLRSRPVADKALIAQALEEKVWPLIAKGSVKP 350

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +I    PL + A AH  ME S HIGKI+L
Sbjct: 351 LIDATFPLKEAAAAHAHMEGSTHIGKIVL 379


>gi|221211732|ref|ZP_03584711.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           multivorans CGD1]
 gi|221169093|gb|EEE01561.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           multivorans CGD1]
          Length = 339

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 220/334 (65%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+PQ+ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLTERPRPEPQRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLE+AG+IV     D   N     +GD VCAL+ GGGYAEY        LP+P+G   I
Sbjct: 61  PGLEIAGEIVGGDLSDAALNPFGLKLGDRVCALLAGGGYAEYATVPLLQCLPVPRGLTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A   +G+     T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQFGAGEGGEQETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A + EKC AC  LGA+ AI+Y  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGTAEKCRACEALGAERAIDYKTEDFVEVVKSLTNDRGVDVILDMVAGSYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L+II+ LGG  A E+NL  I+ +R+TITGSTLR R    K  I   L+ ++WPL+  
Sbjct: 241 GGRLVIIALLGGAKA-EVNLGEILRRRLTITGSTLRPRPVEFKAQIAAQLKARVWPLIED 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP    A AH +ME SEHIGKI+L
Sbjct: 300 GRIKPVIYRVLPAADAAQAHALMESSEHIGKIVL 333


>gi|108807864|ref|YP_651780.1| Zinc-binding dehydrogenase [Yersinia pestis Antiqua]
 gi|108812138|ref|YP_647905.1| Zinc-binding dehydrogenase [Yersinia pestis Nepal516]
 gi|145599075|ref|YP_001163151.1| Zinc-binding dehydrogenase [Yersinia pestis Pestoides F]
 gi|149366384|ref|ZP_01888418.1| probable zinc-binding dehydrogenase [Yersinia pestis CA88-4125]
 gi|162421590|ref|YP_001607217.1| NAD(P)H quinone oxidoreductase PIG3 family protein [Yersinia pestis
           Angola]
 gi|165938526|ref|ZP_02227083.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|166008312|ref|ZP_02229210.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166210573|ref|ZP_02236608.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|167401736|ref|ZP_02307227.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167421771|ref|ZP_02313524.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167426355|ref|ZP_02318108.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|167466594|ref|ZP_02331298.1| probable Zinc-binding dehydrogenase [Yersinia pestis FV-1]
 gi|218928788|ref|YP_002346663.1| putative Zinc-binding dehydrogenase [Yersinia pestis CO92]
 gi|229841644|ref|ZP_04461802.1| probable Zinc-binding dehydrogenase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229843761|ref|ZP_04463904.1| probable Zinc-binding dehydrogenase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229894504|ref|ZP_04509686.1| probable Zinc-binding dehydrogenase [Yersinia pestis Pestoides A]
 gi|229902457|ref|ZP_04517576.1| probable Zinc-binding dehydrogenase [Yersinia pestis Nepal516]
 gi|270490362|ref|ZP_06207436.1| NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia pestis KIM
           D27]
 gi|294504152|ref|YP_003568214.1| probable Zinc-binding dehydrogenase [Yersinia pestis Z176003]
 gi|108775786|gb|ABG18305.1| Zinc-binding dehydrogenase [Yersinia pestis Nepal516]
 gi|108779777|gb|ABG13835.1| Zinc-binding dehydrogenase [Yersinia pestis Antiqua]
 gi|115347399|emb|CAL20298.1| probable Zinc-binding dehydrogenase [Yersinia pestis CO92]
 gi|145210771|gb|ABP40178.1| Zinc-binding dehydrogenase [Yersinia pestis Pestoides F]
 gi|149290758|gb|EDM40833.1| probable zinc-binding dehydrogenase [Yersinia pestis CA88-4125]
 gi|162354405|gb|ABX88353.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis Angola]
 gi|165913641|gb|EDR32261.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|165992694|gb|EDR44995.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166207753|gb|EDR52233.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|166960256|gb|EDR56277.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167048841|gb|EDR60249.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167054710|gb|EDR64514.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|229680503|gb|EEO76600.1| probable Zinc-binding dehydrogenase [Yersinia pestis Nepal516]
 gi|229689369|gb|EEO81432.1| probable Zinc-binding dehydrogenase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229694107|gb|EEO84155.1| probable Zinc-binding dehydrogenase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229703523|gb|EEO90540.1| probable Zinc-binding dehydrogenase [Yersinia pestis Pestoides A]
 gi|262362269|gb|ACY58990.1| probable Zinc-binding dehydrogenase [Yersinia pestis D106004]
 gi|262366202|gb|ACY62759.1| probable Zinc-binding dehydrogenase [Yersinia pestis D182038]
 gi|270338866|gb|EFA49643.1| NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia pestis KIM
           D27]
 gi|294354611|gb|ADE64952.1| probable Zinc-binding dehydrogenase [Yersinia pestis Z176003]
 gi|320014801|gb|ADV98372.1| putative Zinc-binding dehydrogenase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 336

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 159/325 (48%), Positives = 218/325 (67%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++ +G   V+  A+ P P P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 11  MVAIEITQFGGPEVLVPAKRPTPMPAAGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDI 70

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG++V    + T + IGD VC L+ GGGYA+YC+ H+ + LPIP+G +AI+AA+L
Sbjct: 71  PGLEVAGEVVATAADVTRFKIGDNVCGLIAGGGYAQYCVIHETNALPIPQGLSAIEAAAL 130

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKCLA 185
           PE+FFTVW NLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FG ATV  T  SEEK  A
Sbjct: 131 PETFFTVWTNLFQRGHFTAGETVLIHGGSSGIGTTAILLSKAFGAATVIVTVGSEEKRQA 190

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA  AINY  +DF+   ++ T G+G D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 191 CLNLGADIAINYHTQDFVAETKRATAGKGADVIVDLIAGDYVARNYDAAAMNGRIVQIGT 250

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             G+ A ++NL  ++ KR+T TGSTLR RT   K  I + L+  +WPLL+   + P I +
Sbjct: 251 QNGH-AKDLNLMLMLIKRLTHTGSTLRSRTVAEKALIANELEQHVWPLLSEGKMKPQIFS 309

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL   A AH++ME S HIGKI+L
Sbjct: 310 TFPLEAAAKAHELMESSTHIGKIVL 334


>gi|121593374|ref|YP_985270.1| alcohol dehydrogenase [Acidovorax sp. JS42]
 gi|120605454|gb|ABM41194.1| Alcohol dehydrogenase, zinc-binding domain protein [Acidovorax sp.
           JS42]
          Length = 334

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 156/328 (47%), Positives = 223/328 (67%), Gaps = 6/328 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++ +G    + LAE P+PQP   E+LI+V A GVNRPDV+QRKG Y PP   + +
Sbjct: 5   MQAVEIAAFGPPEGLRLAERPVPQPGDGELLIRVAASGVNRPDVLQRKGNYAPPAGVSDL 64

Query: 67  LGLEVAGKIVDLGENTTH----WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG +V+ G+          +GD VCALV GGGYA++C++     LP+P+G + ++
Sbjct: 65  PGLEVAG-VVESGDAAAMAQAGLRVGDRVCALVAGGGYAQWCVAPVAQCLPVPQGLSDVE 123

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AASLPE+FFTVW+N+F    L++G+ +L+ GGSSGIG TAIQLA   GATV  TA S+EK
Sbjct: 124 AASLPETFFTVWSNVFDRGRLQAGEVLLVQGGSSGIGVTAIQLARARGATVIVTAGSDEK 183

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C ACL LGA HAINY  +DF+   ++ T GRG+D++LDMV   Y+ + +  L+++G+++I
Sbjct: 184 CAACLALGAHHAINYKTQDFVAEARRLTDGRGVDVVLDMVAGSYVAREVECLAEDGRVVI 243

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+  GG +  + N   ++ +R+TITGSTLR      K +I  +L+  +WPLL S  + PV
Sbjct: 244 IAVQGG-LDAQFNAGLVLRRRLTITGSTLRPLPVAFKGAIAQALREHVWPLLASGAVKPV 302

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           IHT  P  + A AH +ME ++H+GKI+L
Sbjct: 303 IHTTFPAAQAAQAHALMESNQHVGKIVL 330


>gi|91782609|ref|YP_557815.1| putative NADPH quinone oxidoreductase [Burkholderia xenovorans
           LB400]
 gi|91686563|gb|ABE29763.1| Putative NADPH quinone oxidoreductase [Burkholderia xenovorans
           LB400]
          Length = 338

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 162/333 (48%), Positives = 221/333 (66%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G   V+ LAE P PQP   E+LIKV A G+NRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPEVLKLAERPTPQPAAGEVLIKVAASGINRPDVFQRKGGYAPPPGASDL 60

Query: 67  LGLEVAGKIV----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV    D   N     +GD VCAL+ GGGYAEY ++     LP+P G + ++
Sbjct: 61  PGLEVAGEIVGGTIDEKNNPFGLKVGDRVCALLAGGGYAEYAVAPLLQCLPVPAGLSDVE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AASLPE+FFTVW+N+F  A L  G+     T+L+ GGSSGIG TAIQ+A   G  V+ TA
Sbjct: 121 AASLPETFFTVWSNVFDRAQLGKGEGAPNETLLVQGGSSGIGVTAIQIAHALGFRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S+EKC AC  LGA+ AINY  EDF+E+++  T  RG+D++LDMV   Y+++ LT L+  
Sbjct: 181 GSDEKCRACEALGAERAINYKTEDFVEVIKSLTNDRGVDVVLDMVAGSYVSRELTALADG 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+NLN ++ +R+T+TGSTLR R    K  I   L+ ++WP L   
Sbjct: 241 GRIVLIALLGGAKA-ELNLNEVLRRRLTVTGSTLRPRPIEFKAKIAAQLKERVWPHLEDG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PV+H V P  + A AH +ME S H+GKI+L
Sbjct: 300 RIKPVVHRVFPAAQAAEAHALMESSTHVGKIVL 332


>gi|206560706|ref|YP_002231471.1| putative oxidoreductase [Burkholderia cenocepacia J2315]
 gi|198036748|emb|CAR52648.1| putative oxidoreductase [Burkholderia cenocepacia J2315]
          Length = 339

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 222/334 (66%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ LAE P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLAERPRPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV     D   N     +GD VCAL+ GGGYAEY ++     LP+P G   I
Sbjct: 61  PGLEVAGEIVGGDLSDAALNPFGLKLGDRVCALLAGGGYAEYAVAPLPQCLPVPGGLTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGAGEGGEHETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A + +KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGTADKCRACEALGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVAGSYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A ++NL  I+ +R+TITGSTLR R    K  I   L+ ++WPLL  
Sbjct: 241 GGRLVLIALLGGAKA-DVNLGEILRRRLTITGSTLRPRPVEFKARIAAQLKARVWPLLAD 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP    A AH +ME SEH GKI+L
Sbjct: 300 GRIKPVIYRVLPAADAAQAHALMESSEHTGKIVL 333


>gi|154244790|ref|YP_001415748.1| quinone oxidoreductase putative PIG3 [Xanthobacter autotrophicus
           Py2]
 gi|154158875|gb|ABS66091.1| Quinone oxidoreductase putative PIG3 [Xanthobacter autotrophicus
           Py2]
          Length = 341

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 154/329 (46%), Positives = 224/329 (68%), Gaps = 1/329 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           P+ + M  + +S  G   V+     P+P P   E+L+KVEA G+NRPDVMQRKGLYPPP 
Sbjct: 11  PLPETMTAILISAPGGPEVLVPGNRPVPAPAAGELLVKVEAAGINRPDVMQRKGLYPPPP 70

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A+ I GLE+AG +V LGE  + + +GD VCALV GGGYA+YC +H+   LPIP+G +A 
Sbjct: 71  GASDIPGLEIAGTVVALGEGASRFKLGDRVCALVTGGGYAQYCTTHEATALPIPEGLSAA 130

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
           +AA+LPE+ FTVW+N+F+   L++G+T+L+HGGSSGIGTTAIQLA  FGA V  TA S+E
Sbjct: 131 EAAALPETAFTVWSNIFERGQLKAGETLLLHGGSSGIGTTAIQLAKAFGARVVVTAGSDE 190

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           KC AC+ LGA  A+NY  +DF+  ++  T G+G ++ILDM+G  Y+ ++    +++G+++
Sbjct: 191 KCAACVALGADLAVNYRTQDFVAEVKSFTGGKGANVILDMIGGPYIQKNYEAAAQDGRIV 250

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I+F  G  A E++   ++ KR+T TGSTLR R    K ++  ++  +++PL+ +    P
Sbjct: 251 QIAFQQGAKA-EVDFMRLMLKRLTHTGSTLRSRPVAEKAALAAAIVEQVFPLIAAGKYRP 309

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           V+    PL   A AH  M+ S H+GKI+L
Sbjct: 310 VMDETFPLANAAAAHARMDASAHVGKIVL 338


>gi|94309869|ref|YP_583079.1| zinc-binding alcohol dehydrogenase [Cupriavidus metallidurans CH34]
 gi|93353721|gb|ABF07810.1| Zinc-binding dehydrogenase superfamily (quinone oxidoreductase,
           NADPH dependent) [Cupriavidus metallidurans CH34]
          Length = 334

 Score =  317 bits (812), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 217/333 (65%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +  YG   V+   + P P+P+  EILI+V A G+NRPDV QR G YP P  A+ +
Sbjct: 1   MKAIEIREYGAPEVLQETQRPDPEPKAGEILIRVAAAGINRPDVFQRTGNYPVPPGASDL 60

Query: 67  LGLEVAGKIV--DLGENTTHWNI--GDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG +V  DL      + +  GD VCALV GGGYAE C +     LP+P+G   I+
Sbjct: 61  PGLEVAGVVVGGDLSHPANRFGLKAGDRVCALVQGGGYAELCTAPIEQCLPVPEGLTDIE 120

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE+FFTVW+N+F    L  G     +T+LI GGSSGIGTTAIQ+A   G  V+ TA
Sbjct: 121 AAALPETFFTVWSNVFDRGQLGKGPRGAAETLLIQGGSSGIGTTAIQIAKALGFKVFVTA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S++KC AC  LGA  AINY  +DF+  ++  T+G+G+D+ILDMV   YL + L+ ++ +
Sbjct: 181 GSDDKCKACESLGADRAINYKTQDFVAEVKALTEGKGVDVILDMVAGSYLARELSCIADD 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G+++II+ LGG  A EI L  I+ +RITITGSTLR R    K +I  +L   +WPLL S 
Sbjct: 241 GRIVIIALLGGGKA-EIPLGDILRRRITITGSTLRPRPASFKGAIAQALHQNVWPLLASG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PVIH V P  + A AH +ME SEHIGKI+L
Sbjct: 300 KIKPVIHKVFPAAQAADAHRLMESSEHIGKIVL 332


>gi|51596738|ref|YP_070929.1| Zinc-binding dehydrogenase [Yersinia pseudotuberculosis IP 32953]
 gi|186895802|ref|YP_001872914.1| PIG3 family NAD(P)H quinone oxidoreductase [Yersinia
           pseudotuberculosis PB1/+]
 gi|51590020|emb|CAH21654.1| probable Zinc-binding dehydrogenase [Yersinia pseudotuberculosis IP
           32953]
 gi|186698828|gb|ACC89457.1| NAD(P)H quinone oxidoreductase, PIG3 family [Yersinia
           pseudotuberculosis PB1/+]
          Length = 336

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 158/317 (49%), Positives = 215/317 (67%), Gaps = 2/317 (0%)

Query: 15  YGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGK 74
           +G   V+  A+ P P P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I GLEVAG+
Sbjct: 19  FGGPEVLVPAKRPTPMPAAGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDIPGLEVAGE 78

Query: 75  IVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVW 134
           +V +  + T + IGD VC L+ GGGYA+YC+ H+ + LPIP+G +AI+AA+LPE+FFTVW
Sbjct: 79  VVAIAADVTRFKIGDNVCGLIAGGGYAQYCVIHETNALPIPQGLSAIEAAALPETFFTVW 138

Query: 135 ANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKCLACLKLGAKH 193
            NLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FG ATV  T  SEEK  ACL LGA  
Sbjct: 139 TNLFQRGHFTAGETVLIHGGSSGIGTTAILLSKAFGAATVIVTVGSEEKRQACLNLGADI 198

Query: 194 AINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATE 253
           AINY  +DF+   ++ T G+G D+I+D++  +Y+ ++    +  G+++ I    G+ A +
Sbjct: 199 AINYHTQDFVAETKRATAGKGADVIVDLIAGDYVARNYDAAAMNGRIVQIGTQNGH-AKD 257

Query: 254 INLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA 313
           +NL  ++ KR+T TGSTLR RT   K  I + L+  +WPLL+   + P I +  PL   A
Sbjct: 258 LNLMLMLIKRLTHTGSTLRSRTVAEKALIANELEQHVWPLLSEGKMKPQIFSTFPLEAAA 317

Query: 314 MAHDIMEKSEHIGKIIL 330
            AH++ME S HIGKI+L
Sbjct: 318 KAHELMESSTHIGKIVL 334


>gi|22125710|ref|NP_669133.1| oxidoreductase [Yersinia pestis KIM 10]
 gi|45441595|ref|NP_993134.1| Zinc-binding dehydrogenase [Yersinia pestis biovar Microtus str.
           91001]
 gi|21958627|gb|AAM85384.1|AE013784_3 putative oxidoreductase [Yersinia pestis KIM 10]
 gi|45436456|gb|AAS62011.1| probable Zinc-binding dehydrogenase [Yersinia pestis biovar
           Microtus str. 91001]
          Length = 348

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 159/325 (48%), Positives = 218/325 (67%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++ +G   V+  A+ P P P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 23  MVAIEITQFGGPEVLVPAKRPTPMPAAGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDI 82

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG++V    + T + IGD VC L+ GGGYA+YC+ H+ + LPIP+G +AI+AA+L
Sbjct: 83  PGLEVAGEVVATAADVTRFKIGDNVCGLIAGGGYAQYCVIHETNALPIPQGLSAIEAAAL 142

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKCLA 185
           PE+FFTVW NLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FG ATV  T  SEEK  A
Sbjct: 143 PETFFTVWTNLFQRGHFTAGETVLIHGGSSGIGTTAILLSKAFGAATVIVTVGSEEKRQA 202

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA  AINY  +DF+   ++ T G+G D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 203 CLNLGADIAINYHTQDFVAETKRATAGKGADVIVDLIAGDYVARNYDAAAMNGRIVQIGT 262

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             G+ A ++NL  ++ KR+T TGSTLR RT   K  I + L+  +WPLL+   + P I +
Sbjct: 263 QNGH-AKDLNLMLMLIKRLTHTGSTLRSRTVAEKALIANELEQHVWPLLSEGKMKPQIFS 321

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL   A AH++ME S HIGKI+L
Sbjct: 322 TFPLEAAAKAHELMESSTHIGKIVL 346


>gi|165925472|ref|ZP_02221304.1| zinc-containing alcohol dehydrogenase superfamily [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165922581|gb|EDR39732.1| zinc-containing alcohol dehydrogenase superfamily [Yersinia pestis
           biovar Orientalis str. F1991016]
          Length = 339

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 159/325 (48%), Positives = 218/325 (67%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++ +G   V+  A+ P P P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 14  MVAIEITQFGGPEVLVPAKRPTPMPAAGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDI 73

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG++V    + T + IGD VC L+ GGGYA+YC+ H+ + LPIP+G +AI+AA+L
Sbjct: 74  PGLEVAGEVVATAADVTRFKIGDNVCGLIAGGGYAQYCVIHETNALPIPQGLSAIEAAAL 133

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKCLA 185
           PE+FFTVW NLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FG ATV  T  SEEK  A
Sbjct: 134 PETFFTVWTNLFQRGHFTAGETVLIHGGSSGIGTTAILLSKAFGAATVIVTVGSEEKRQA 193

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA  AINY  +DF+   ++ T G+G D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 194 CLNLGADIAINYHTQDFVAETKRATAGKGADVIVDLIAGDYVARNYDAAAMNGRIVQIGT 253

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             G+ A ++NL  ++ KR+T TGSTLR RT   K  I + L+  +WPLL+   + P I +
Sbjct: 254 QNGH-AKDLNLMLMLIKRLTHTGSTLRSRTVAEKALIANELEQHVWPLLSEGKMKPQIFS 312

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL   A AH++ME S HIGKI+L
Sbjct: 313 TFPLEAAAKAHELMESSTHIGKIVL 337


>gi|167580419|ref|ZP_02373293.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia thailandensis TXDOH]
          Length = 339

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 226/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLTERPQPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV--DLGENTTH---WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV  DL +  T+     +G+ VCAL+ GGGYA+Y  +     LP+PKG   +
Sbjct: 61  PGLEVAGEIVGGDLSDPATNPFGLKVGERVCALLAGGGYAQYVAAPLAQCLPVPKGLTDV 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGAGEGGAQETFLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A +++KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + LT L+ 
Sbjct: 181 AGTDDKCRACEALGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVAGAYVARELTALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG   +EIN+  I+ +R+TITGSTLR R    K  I   L+ ++WPL+  
Sbjct: 241 GGRLVVIALLGGA-KSEINVAEILRRRLTITGSTLRPRPVEFKARIAAQLKARVWPLIEG 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + PV++ VLP  + A AH +ME SEH+GKI+L
Sbjct: 300 GHVKPVVYRVLPAAQAADAHALMESSEHVGKIVL 333


>gi|254475231|ref|ZP_05088617.1| alcohol dehydrogenase, zinc-binding [Ruegeria sp. R11]
 gi|214029474|gb|EEB70309.1| alcohol dehydrogenase, zinc-binding [Ruegeria sp. R11]
          Length = 330

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 219/324 (67%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +S  G  +V+   + PIP P   ++++KV   GVNRPD +QR G Y PP  A+ +
Sbjct: 5   MRAIEISEPGGPDVLRECDRPIPAPAHGQVVLKVAYAGVNRPDALQRAGKYAPPPTASDL 64

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G +V +G   +   +GD VCAL+ GGGYAEY  +   H LP+P G +  QAA L
Sbjct: 65  PGLEASGVVVAIGPGVSGLALGDAVCALLPGGGYAEYVATPAAHCLPVPAGLSMKQAACL 124

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    L++G+  L+HGGSSGIGTTAIQLAS  GA V+TTA S+EKC AC
Sbjct: 125 PETFFTVWSNVFTRGGLKAGERFLVHGGSSGIGTTAIQLASTLGARVFTTAGSDEKCAAC 184

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA+ AINY  EDF+E+++ E    G D+ILDMVG EY+ +++  L+ +G+++ I+FL
Sbjct: 185 LSLGAERAINYRTEDFVEVMKGEG---GADLILDMVGGEYITRNIRALADDGRMVHIAFL 241

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  A E+N   I+++R+T+TGSTLR ++D+AK  I   L+  +WPL+ +  +APV+   
Sbjct: 242 SGPKA-ELNFAQIMARRLTVTGSTLRPQSDLAKARIAQDLREVVWPLIEAGTVAPVMDQT 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   A AH  ME S HIGKI+L
Sbjct: 301 FALADAAAAHARMEGSTHIGKIVL 324


>gi|294340864|emb|CAZ89259.1| putative quinone oxidoreductase [Thiomonas sp. 3As]
          Length = 326

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 212/324 (65%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +S  G   V+   E P+PQ    E+L++V A GVNRPD +QR+GLYPPP  A  +
Sbjct: 1   MRAIEISQPGGPEVLRFCERPMPQAGAGEVLLRVRAFGVNRPDALQRRGLYPPPAGAPDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV G+IV      T  + GD VCALV GGGYAEYC++  G  LP+P G +A + A+L
Sbjct: 61  PGLEVCGEIVSGDLAGTDLHQGDLVCALVAGGGYAEYCVAPTGQCLPLPDGLSAEEGAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVW N+F+   L++G+ +L+ GGSSGIGT AIQLA   GA V  TA S+EKC AC
Sbjct: 121 PETAFTVWHNVFERGRLQAGEMLLVQGGSSGIGTMAIQLAVASGARVVATAGSDEKCAAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L+LGA+ AINY  +DF+E +Q  T  RG D+ILDMV   YL +    L++EG+L++I+  
Sbjct: 181 LQLGAELAINYRTQDFVEAVQAHTAERGADVILDMVAGSYLAREQRCLAEEGRLVVIAVQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  EI+   ++ +R T+TGSTLR R+   K ++  +LQ  +WP +    + PVI  V
Sbjct: 241 GG-VKAEIDAGLLMRRRQTLTGSTLRARSVAFKSAVAQALQKTVWPWIEQGRVRPVIDAV 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P   +  AH  ME+ +HIGK++L
Sbjct: 300 FPAEDIVQAHQRMEQGQHIGKLVL 323


>gi|170746783|ref|YP_001753043.1| PIG3 family NAD(P)H quinone oxidoreductase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653305|gb|ACB22360.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 338

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 219/328 (66%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           +   MR V   G G   V+ + E P P+P + ++L++VE+ G+NRPDVMQR+G YPPP  
Sbjct: 1   MSTTMRAVIAVGQGGPEVLRIVERPRPEPGEGQLLVRVESAGINRPDVMQREGRYPPPPG 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ +LGLE+AG +  LG     +  GD V ALV+ G YAE+ +  +   L +P G  AI+
Sbjct: 61  ASDVLGLELAGIVEALGPGAGRFRTGDRVMALVHSGAYAEWAVVDEAVALKVPDGLPAIE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           A ++PE++FTVW+N+F+ A LR+G+++LIHGG+SGIGTTAI LA  +GA V  TA S EK
Sbjct: 121 AGAIPETYFTVWSNVFERARLRAGESLLIHGGASGIGTTAILLAKAWGARVIVTAGSSEK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C ACLKLGA  AI+Y +EDF+   +  T G G D+ILDMVG  Y+ ++L  ++ +G++  
Sbjct: 181 CAACLKLGADAAIDYRREDFVAAARAATDGGGPDVILDMVGGPYIARNLDAVAVDGRIAQ 240

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+F  G+  TEI+L P+++KR+T+TGSTLR R    K  + ++L   + PLL +    P 
Sbjct: 241 IAFQQGSRVTEIDLQPLLTKRVTLTGSTLRARPVALKARLAEALAEHVLPLLAAGRARPP 300

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           I +V P  +VA AH  M+  +H+GKI+L
Sbjct: 301 IDSVFPFDRVAEAHARMDGGQHVGKIVL 328


>gi|325524615|gb|EGD02630.1| PIG3 family NAD(P)H quinone oxidoreductase [Burkholderia sp. TJI49]
          Length = 339

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 220/334 (65%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ LAE P P+P++ E+L+KV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLAERPRPEPKRGEVLVKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLE+AG+IV     D   N     +GD VCAL+ GGGYAEY +      LP+P     I
Sbjct: 61  PGLEIAGEIVGGDLSDAALNPFGLKLGDRVCALLAGGGYAEYAVVPLLQCLPVPGALTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGAGEGGEQETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A + EKC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L+ 
Sbjct: 181 AGTAEKCRACEALGAERAINYKSEDFVEVVKSLTHDRGVDVILDMVAGSYVPRELSALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A E+NLN I+ +R+TITGSTLR R    K  I   L  ++WPLL  
Sbjct: 241 GGRLVLIALLGGAKA-EVNLNEILRRRLTITGSTLRPRPVEFKAKIAAQLHARVWPLLAD 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP    A AH +ME  EHIGKI+L
Sbjct: 300 GRIKPVIYRVLPAADAAQAHALMESGEHIGKIVL 333


>gi|83720037|ref|YP_441611.1| zinc-binding dehydrogenase family oxidoreductase [Burkholderia
           thailandensis E264]
 gi|167618528|ref|ZP_02387159.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia thailandensis Bt4]
 gi|83653862|gb|ABC37925.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia thailandensis E264]
          Length = 339

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 226/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLTERPQPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV--DLGENTTH---WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV  DL +  T+     +G+ VCAL+ GGGYA+Y  +     LP+PKG   +
Sbjct: 61  PGLEVAGEIVGGDLSDPATNPFGLKVGERVCALLAGGGYAQYVAAPLAQCLPVPKGLTDV 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGAGEGGALETFLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A +++KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + LT L+ 
Sbjct: 181 AGTDDKCRACEALGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVAGAYVARELTALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG   +EIN+  I+ +R+TITGSTLR R    K  I   L+ ++WPL+  
Sbjct: 241 GGRLVVIALLGGA-KSEINVAEILRRRLTITGSTLRPRPVEFKARIAAQLKARVWPLIEG 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + PV++ VLP  + A AH +ME SEH+GKI+L
Sbjct: 300 GHVKPVVYRVLPAAQAADAHALMESSEHVGKIVL 333


>gi|160900615|ref|YP_001566197.1| PIG3 family NAD(P)H quinone oxidoreductase [Delftia acidovorans
           SPH-1]
 gi|160366199|gb|ABX37812.1| NAD(P)H quinone oxidoreductase, PIG3 family [Delftia acidovorans
           SPH-1]
          Length = 333

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 218/327 (66%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++ +G   V+ L E P+P    +E+LI+V A GVNRPDV+QRKG Y PP  A+ +
Sbjct: 6   MRAVELTDFGAPEVLRLGERPLPVAGAQELLIQVSASGVNRPDVLQRKGHYAPPPGASDL 65

Query: 67  LGLEVAGKIV---DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
            GLEVAG IV   D         +GD VCAL+ GGGYAEYC++     LPIP G + ++A
Sbjct: 66  PGLEVAGVIVSGDDEAMRLAGLRVGDRVCALLAGGGYAEYCVAPVAQCLPIPAGLSEVEA 125

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           ++LPE+FFTVW+N+F    L++G+T+L+ GGSSGIG TAIQLA   GATV  TA S+ KC
Sbjct: 126 SALPETFFTVWSNVFDRGALQAGETLLVQGGSSGIGVTAIQLAKARGATVIVTAGSDAKC 185

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             CLKLGA HAINY  +DF   +Q+ T+GRG+D+ILDMV   Y+ + +  L+++G+L+II
Sbjct: 186 ADCLKLGADHAINYRTQDFAAEVQRITEGRGVDVILDMVAGGYVAREVQSLAEDGRLVII 245

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           +  GG I  E +   ++ +R+ +TGSTLR R    K +I  +L+ ++WPL+ +  I PVI
Sbjct: 246 AVQGG-IKAEFDAGLVLRRRLLVTGSTLRPRPVAFKAAIAQALRREVWPLIEAGGIRPVI 304

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           H+         AH +ME S+H GKI+L
Sbjct: 305 HSTFAAADADKAHALMESSQHTGKIVL 331


>gi|78067049|ref|YP_369818.1| zinc-containing alcohol dehydrogenase superfamily protein
           [Burkholderia sp. 383]
 gi|77967794|gb|ABB09174.1| Zinc-containing alcohol dehydrogenase superfamily [Burkholderia sp.
           383]
          Length = 339

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 221/334 (66%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ LAE P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLAERPRPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV     D   N     +GD VCAL+ GGGYAEY ++     LP+P G   I
Sbjct: 61  PGLEVAGEIVGGDLSDAALNPFGLKLGDRVCALLAGGGYAEYAVAPLPQCLPVPDGLTDI 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T+L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGAGEGGEQETLLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A + +KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L  
Sbjct: 181 AGTADKCRACEALGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVAGSYVPRELSALVD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A ++NL  I+ +R+TITGSTLR R    K  I   L+ ++WPLL  
Sbjct: 241 GGRLVLIALLGGAKA-DVNLGEILRRRLTITGSTLRPRPVEFKAQIAAQLKSRVWPLLAD 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVI+ VLP    A AH +ME SEH GKI+L
Sbjct: 300 GRIKPVIYRVLPAADAAQAHALMESSEHTGKIVL 333


>gi|114564824|ref|YP_752338.1| alcohol dehydrogenase [Shewanella frigidimarina NCIMB 400]
 gi|114336117|gb|ABI73499.1| Alcohol dehydrogenase, zinc-binding domain protein [Shewanella
           frigidimarina NCIMB 400]
          Length = 337

 Score =  316 bits (810), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 223/328 (67%), Gaps = 1/328 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + ++  HV +   G+ +VM + +S +  P + ++ IKV A GVN PD+ QR G YPPP +
Sbjct: 4   VNRQFTHVVVEQPGEPSVMTMTQSTLAMPTEGQVTIKVYAAGVNGPDIKQRVGAYPPPAD 63

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+PI+GLEVAG+IV + ++ T W +GD+VCALV GGGYAE   ++  H LPIP GY+ +Q
Sbjct: 64  ASPIIGLEVAGEIVAVADDVTQWQVGDKVCALVPGGGYAELVNTYAAHCLPIPTGYSFVQ 123

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA+LPE+FFTVW NLF    L +G+TVLIHGGS GIGTTAIQ+AS  GATV+ T+ S EK
Sbjct: 124 AAALPETFFTVWGNLFIRGGLNAGETVLIHGGSGGIGTTAIQMASRLGATVFATSGSAEK 183

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C  CL  GA  AINY ++ F+E + + T G G+++I+D+ G +++N++L  ++ +G+++ 
Sbjct: 184 CQYCLDQGASVAINYNEQHFVEPILEATNGLGVNVIMDIAGGDFINENLKAIATDGRMVS 243

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           ++   G  A  +++  I++KR+  TGSTLR ++   K  I   L   +WPLLNS  ++  
Sbjct: 244 VAMQRGPQA-NVDIFRIMAKRVIWTGSTLRPQSVANKALIAQGLAEFVWPLLNSGKMSIP 302

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           I +V P  +V  AH++ME   H GKI+L
Sbjct: 303 IDSVFPFSQVVQAHELMESGTHKGKIVL 330


>gi|187929296|ref|YP_001899783.1| NAD(P)H quinone oxidoreductase, PIG3 family [Ralstonia pickettii
           12J]
 gi|187726186|gb|ACD27351.1| NAD(P)H quinone oxidoreductase, PIG3 family [Ralstonia pickettii
           12J]
          Length = 334

 Score =  316 bits (809), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 166/334 (49%), Positives = 226/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ YG   V+ L E P+P+ +  E+LI+V A GVNRPDV QR G YP P  A+ I
Sbjct: 1   MKAIEITQYGGPEVLKLGERPMPEAKAGEVLIRVRAAGVNRPDVFQRTGNYPVPPGASDI 60

Query: 67  LGLEVAGKIV--DLG--ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV  DL   +N     +GD VCALV GGGYAE+C +  G  LP+P G + ++
Sbjct: 61  PGLEVAGEIVSGDLAHADNRYGLKVGDRVCALVQGGGYAEFCTAPLGQVLPVPAGLSDVE 120

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE++FTVW+N+F    L  G     +T+L+ GGSSGIGTTAIQ+AS  G  V+ TA
Sbjct: 121 AAALPENYFTVWSNVFDRGLLGRGAHGADETLLVQGGSSGIGTTAIQIASALGHRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S EKC AC++LGA  AINY  EDF+EI++ ET GRG D++LDMVG  Y+ + +   + +
Sbjct: 181 GSAEKCDACVELGATRAINYKTEDFVEIVKAET-GRGADVVLDMVGGSYVAREIACTADD 239

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+ L  I+ +RIT+TGSTLR R    K +I  +L   +WPLL S 
Sbjct: 240 GRIVLIALLGGAKA-EVPLGDILRRRITLTGSTLRPRPVAFKAAIAANLYETVWPLLASV 298

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
            I PV+H V+P  + A AH +ME S HIGKI+L+
Sbjct: 299 RIKPVVHEVMPAAQAAQAHALMESSAHIGKIMLV 332


>gi|323525433|ref|YP_004227586.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp.
           CCGE1001]
 gi|323382435|gb|ADX54526.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp.
           CCGE1001]
          Length = 338

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 221/333 (66%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G   V+ LAE P PQP+  E+LIKV A G+NRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPEVLKLAERPTPQPKAGEVLIKVAASGINRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV    D   N     +GD VCAL+ GGGYAEY ++     LP P G + ++
Sbjct: 61  PGLEVAGEIVGGDIDEKNNPFGLKVGDRVCALLAGGGYAEYAVAPLLQCLPAPAGLSDVE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AASLPE+FFTVW+N+F  A L  G+     T+L+ GGSSGIG TAIQ+A   G  V+ TA
Sbjct: 121 AASLPETFFTVWSNVFDRAQLGKGEGGANETLLVQGGSSGIGVTAIQIAHALGFRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S++KC AC  LGA+ AINY  EDF+E+++  T  RG+D++LDMV   Y+++ LT L+  
Sbjct: 181 GSDDKCRACEALGAERAINYKTEDFVEVIKSLTNDRGVDVVLDMVAGSYVSRELTALADG 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+NLN ++ +R+T+TGSTLR R    K  I   L+ ++WP L   
Sbjct: 241 GRIVLIALLGGAKA-ELNLNEVLRRRLTVTGSTLRPRPVEFKAKIAAQLKEQVWPHLEGG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PV+H V P  + A AH +ME S H+GKI+L
Sbjct: 300 RIKPVVHRVFPAAQAADAHALMESSTHVGKIVL 332


>gi|171058182|ref|YP_001790531.1| PIG3 family NAD(P)H quinone oxidoreductase [Leptothrix cholodnii
           SP-6]
 gi|170775627|gb|ACB33766.1| NAD(P)H quinone oxidoreductase, PIG3 family [Leptothrix cholodnii
           SP-6]
          Length = 328

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 226/328 (68%), Gaps = 6/328 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +S  G  +V+ L +  +P     E+LI+V A GVNRPDV+QRKG YPPP  A+ +
Sbjct: 1   MNAIEISRPGAPDVLRLTQRAVPVAGAGEVLIRVAASGVNRPDVLQRKGAYPPPAGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWN----IGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLE+AG +++ G+          IG  VCALV GGGYA+YC++  G  LP+P G++ +Q
Sbjct: 61  PGLELAG-VIESGDAQALQAAGLAIGQRVCALVTGGGYAQYCVAPVGQCLPVPAGFDDVQ 119

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA+LPE+FFTVW+N+F+ A L+SG+T+L+ GG+SGIG TAIQLA   GATV  TA S++K
Sbjct: 120 AAALPETFFTVWSNVFERARLQSGETLLVQGGTSGIGVTAIQLAKARGATVIATAGSDDK 179

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C ACL LGA HAINY  +DF     + T GRG+D+ILDMV  +Y+ + ++ L+++G+L+I
Sbjct: 180 CQACLALGADHAINYRSQDFAAEALRLTDGRGVDVILDMVAGDYVAREVSCLAEDGRLVI 239

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+  GG +    +   ++ +R+TITGSTLR R    K +I  +L+ ++WPLL S  + PV
Sbjct: 240 IAVQGG-VKASFDAGLVLRRRLTITGSTLRARPVAFKAAIAAALRAQVWPLLESRQVRPV 298

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           IH VLP  + A AH +ME ++HIGKI+L
Sbjct: 299 IHAVLPAAQAADAHALMESNQHIGKIVL 326


>gi|307944514|ref|ZP_07659854.1| putative quinone oxidoreductase [Roseibium sp. TrichSKD4]
 gi|307772263|gb|EFO31484.1| putative quinone oxidoreductase [Roseibium sp. TrichSKD4]
          Length = 333

 Score =  315 bits (808), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 219/324 (67%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  +A+S  G  +V+     P+PQ    EILIKVEA GVNRPDV+QRKG YPPPK A+ +
Sbjct: 8   MTAIAISEPGGPDVLKEEMRPVPQAGSGEILIKVEAAGVNRPDVLQRKGAYPPPKGASDL 67

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G +V LGE  +   +G +V AL  GGGYAEYC   + H LP+P G + ++AA+L
Sbjct: 68  PGLEVSGTVVALGEGASQHKLGSQVTALCPGGGYAEYCTVPEQHALPVPAGLSMVEAAAL 127

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    L +G+  L+HGG+SGIGTTAIQLA  FGA ++TT  S++K  A 
Sbjct: 128 PETFFTVWSNVFDRLGLVAGERFLVHGGTSGIGTTAIQLAKAFGAEIFTTVGSDDKAEAA 187

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA H INY   DF+++++ +T G+G+  ILDMVG +Y+ ++    + EG++  I+ L
Sbjct: 188 RALGADHVINYRTADFVDVVRSKTDGQGVHAILDMVGGDYVMKNWKAAAVEGRICQIATL 247

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G +++E N + ++ KR++ TGSTLR R +  K SI ++L+ K+WPL+    I PV+   
Sbjct: 248 NG-VSSETNFSLLMVKRLSHTGSTLRPRDNAFKASIANALREKVWPLIEQGKIKPVMDCT 306

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L + + AH  ME SEHIGKI+L
Sbjct: 307 FLLRQASEAHKRMETSEHIGKIML 330


>gi|329901003|ref|ZP_08272664.1| Quinone oxidoreductase [Oxalobacteraceae bacterium IMCC9480]
 gi|327549291|gb|EGF33866.1| Quinone oxidoreductase [Oxalobacteraceae bacterium IMCC9480]
          Length = 325

 Score =  315 bits (808), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 217/324 (66%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + ++ +G   V+ + E PIP P+  E+LI+V A G+NRPDV QR G YP P  A+ +
Sbjct: 1   MRAIEITQFGGPEVLQICERPIPVPKSGEVLIRVHAAGINRPDVFQRTGNYPVPPGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG+IV        +  GD VCALV GGGYAEYC++  G  LP+P G  A++AASL
Sbjct: 61  PGLEVAGEIVGGDLTGQPFLQGDLVCALVQGGGYAEYCVAPVGQCLPVPLGLTALEAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F  A+L   +T+L+ GG+SGIG TAIQ+A   G  V+ TA S++KC AC
Sbjct: 121 PETFFTVWSNVFDRAHLSGKETLLVQGGTSGIGVTAIQMAVALGHRVFATAGSDDKCRAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+  INY  +DF  I++ +T G+G+D+ILDMVG +YL + +  L+ +G++ +I+ L
Sbjct: 181 EALGAEQGINYRTQDFAAIIKDKTAGKGVDVILDMVGGDYLPREINCLADDGRIALIALL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E++L  ++ +R+TI+G+TLR R+   K ++   L   +WPL     I PVI   
Sbjct: 241 GGAKA-ELDLGQVLRRRLTISGATLRPRSLAFKAAVAHHLLNTVWPLFAQKRIKPVIFRT 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH +ME S HIGKI+L
Sbjct: 300 FPLEQAADAHVLMESSTHIGKIML 323


>gi|296160626|ref|ZP_06843441.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp.
           Ch1-1]
 gi|295889152|gb|EFG68955.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp.
           Ch1-1]
          Length = 338

 Score =  315 bits (808), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 221/333 (66%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G   V+ LAE P PQP   E+LIKV A G+NRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPEVLKLAERPTPQPAAGEVLIKVAASGINRPDVFQRKGGYAPPPGASDL 60

Query: 67  LGLEVAGKIV----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV    D   N     +GD VCAL+ GGGYAEY ++     LP+P G + ++
Sbjct: 61  PGLEVAGEIVGGTIDEKNNPFGLKVGDRVCALLAGGGYAEYAVAPLLQCLPVPAGLSDVE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AASLPE+FFTVW+N+F  A L  G+     T+L+ GGSSGIG TAIQ+A   G  V+ TA
Sbjct: 121 AASLPETFFTVWSNVFDRAQLGKGEGAPDETLLVQGGSSGIGVTAIQIAHALGFRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S+EKC AC  LGA+ AINY  EDF+E+++  T  RG++++LDMV   Y+++ LT L+  
Sbjct: 181 GSDEKCRACEALGAERAINYKTEDFVEVIKSLTNDRGVNVVLDMVAGSYVSRELTALADG 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+NLN ++ +R+T+TGSTLR R    K  I   L+ ++WP L   
Sbjct: 241 GRIVLIALLGGAKA-ELNLNEVLRRRLTVTGSTLRPRPIEFKAKIAAQLKERVWPHLEDG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PV+H V P  + A AH +ME S H+GKI+L
Sbjct: 300 SIKPVVHRVFPAAQAADAHALMESSTHVGKIVL 332


>gi|241663487|ref|YP_002981847.1| NAD(P)H quinone oxidoreductase, PIG3 family [Ralstonia pickettii
           12D]
 gi|240865514|gb|ACS63175.1| NAD(P)H quinone oxidoreductase, PIG3 family [Ralstonia pickettii
           12D]
          Length = 334

 Score =  315 bits (808), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 226/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ YG   V+ L E P+P+ +  E+LI+V A GVNRPDV QR G YP P  A+ I
Sbjct: 1   MKAIEITQYGGPEVLQLGERPMPETKAGEVLIRVRAAGVNRPDVFQRTGNYPVPPGASDI 60

Query: 67  LGLEVAGKIV--DL--GENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV  DL   +N     +GD VCALV GGGYAE+C +  G  LP+P G + ++
Sbjct: 61  PGLEVAGEIVSGDLTHADNRYGLKVGDRVCALVQGGGYAEFCTAPLGQVLPVPAGLSDVE 120

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE++FTVW+N+F    L  G     +T+L+ GGSSGIGTTAIQ+AS  G  V+ TA
Sbjct: 121 AAALPENYFTVWSNVFDRGLLGRGAHGADETLLVQGGSSGIGTTAIQIASALGHRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S +KC AC+KLGA  AINY  EDF+EI++ ET GRG D++LDMVG  Y+ + +   + +
Sbjct: 181 GSADKCAACVKLGAARAINYKTEDFVEIVKAET-GRGADVVLDMVGGSYVAREIDCTADD 239

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+ L  I+ +R+T+TGSTLR R    K +I  +L   +WPLL S 
Sbjct: 240 GRIVLIALLGGAKA-EVPLGDILRRRLTLTGSTLRPRPVAFKAAIAANLYETVWPLLVSG 298

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
            I PV+H V+P  + A AH +ME S HIGKI+L+
Sbjct: 299 RIKPVVHEVMPAAQAAQAHALMESSAHIGKIMLV 332


>gi|238756410|ref|ZP_04617720.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           ruckeri ATCC 29473]
 gi|238705383|gb|EEP97790.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           ruckeri ATCC 29473]
          Length = 336

 Score =  315 bits (807), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 159/326 (48%), Positives = 217/326 (66%), Gaps = 2/326 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           KM  + ++ +G  +V+      +P+P   +IL+KV A GVNRPDVMQR G Y PPK A+ 
Sbjct: 10  KMTAIEITQFGPPSVLKACRRTVPEPIDGQILVKVMAAGVNRPDVMQRLGQYAPPKGASD 69

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLE++G+++ LG N   + IGD+VC L+ GGGYAEYC+ H+ + LPIP G + I+AA+
Sbjct: 70  IPGLEISGEVIALGNNAKRYKIGDKVCGLIAGGGYAEYCVIHETNALPIPHGLSMIEAAA 129

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCL 184
           LPE+FFTVWANLFQ A+L +G+TVLIHGGSSGIGTT+I L+  FGA  V  T  SEEK  
Sbjct: 130 LPETFFTVWANLFQRAHLVAGETVLIHGGSSGIGTTSILLSKAFGAAKVIVTVGSEEKRQ 189

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           ACL LGA  AINY  +DF+    + T G G D+I+D++  +Y+ ++    +  G++  I 
Sbjct: 190 ACLALGADVAINYRTQDFVTETMQATDGHGADVIVDLIAGDYVARNYEAAAINGRITQIG 249

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
              G  A  +NL P++ KR+T TGSTLR RT + K  I + L+ K+WPL     + P I 
Sbjct: 250 IQNGP-AKNLNLMPMLLKRLTHTGSTLRSRTVVEKALITNELKQKVWPLFECGRLKPQIF 308

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
              PL + A AH++ME S HIGKI+L
Sbjct: 309 ATFPLQQAADAHELMEGSTHIGKIVL 334


>gi|332528748|ref|ZP_08404725.1| NAD(P)H quinone oxidoreductase, PIG3 family protein [Hylemonella
           gracilis ATCC 19624]
 gi|332041814|gb|EGI78163.1| NAD(P)H quinone oxidoreductase, PIG3 family protein [Hylemonella
           gracilis ATCC 19624]
          Length = 329

 Score =  315 bits (807), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 222/327 (67%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++ YG+  V+ L E P P P   E+LI+V A G+NRPDV QR+G YP P  A+ I
Sbjct: 1   MKAVEITRYGEPEVLVLGERPDPVPAAGELLIRVAASGINRPDVFQRQGNYPVPPGASDI 60

Query: 67  LGLEVAGKIV--DLGE-NTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
            GLEVAG+IV  D  E       +GD+VCALV GGGYAE C +     LP PKG + ++A
Sbjct: 61  PGLEVAGQIVGGDAKELAAAGLKLGDKVCALVAGGGYAELCTAPIAQCLPYPKGLSDVEA 120

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           ASLPE+FFTVW+N+F    L+ G+T+LI GGSSGIG TAIQLA  +GATV  TA S++KC
Sbjct: 121 ASLPETFFTVWSNVFDRGRLQPGETLLIQGGSSGIGVTAIQLAKAWGATVIVTAGSDDKC 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
            ACL LGA HAINY  +DF E +++ T G+G+D+ILDMVG EY+ + +  L+++G+++II
Sbjct: 181 AACLDLGADHAINYKAQDFKEEVKRLTDGKGVDVILDMVGGEYVAREVESLAEDGRIVII 240

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           +  GG   +  N   ++ KR+TITGSTLR R    K +I  + +   WPL+ +  I PVI
Sbjct: 241 AVQGGT-KSSFNAGLVLRKRLTITGSTLRPRPVAFKAAIAQACRQHAWPLIEAGKIKPVI 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           H+  P  + A AH +ME ++HIGKI+L
Sbjct: 300 HSTFPPAQAAQAHALMESNQHIGKIVL 326


>gi|254486241|ref|ZP_05099446.1| alcohol dehydrogenase, zinc-containing [Roseobacter sp. GAI101]
 gi|214043110|gb|EEB83748.1| alcohol dehydrogenase, zinc-containing [Roseobacter sp. GAI101]
          Length = 342

 Score =  315 bits (807), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 150/328 (45%), Positives = 222/328 (67%), Gaps = 4/328 (1%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           +   MR + ++  G   V+   + P+P P   +++IKV   GVNRPD +QR G+Y PP  
Sbjct: 15  MSDTMRAIEITKAGGPEVLQPTQRPMPTPAHGQVVIKVAYAGVNRPDALQRAGMYAPPPT 74

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE +G+I  +G+  +  ++GD+VCAL+ GGGYAEY  +   H LP+P+G    +
Sbjct: 75  ASDLPGLEASGEIHAIGDGVSGLSVGDKVCALLPGGGYAEYVATPAAHCLPVPEGMGMKE 134

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA LPE+FFTVW+N+F    L++G+  L+HGGSSGIGTTAIQLA   GA V+ TA ++ K
Sbjct: 135 AACLPETFFTVWSNVFMRGGLKAGERFLVHGGSSGIGTTAIQLARELGARVFATAGTDSK 194

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C AC KLGA+ AINY   DF+++L+ E    G D+ILDMVG +Y+ ++L  L+++G+L+ 
Sbjct: 195 CAACAKLGAEAAINYRDTDFVDVLKAEG---GADLILDMVGGDYIPRNLQALAEDGRLVQ 251

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+FL G    E+N   ++++R+T+TGSTLR ++D+AK  I D L+  +WPLL++  IAPV
Sbjct: 252 IAFLTGP-KVEVNFATLMTRRLTMTGSTLRPQSDLAKARIADQLREHVWPLLDAGKIAPV 310

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           + +     + + AH  ME S HIGKI+L
Sbjct: 311 MDSEYEFEQASEAHARMETSGHIGKIVL 338


>gi|328542514|ref|YP_004302623.1| NAD(P)H quinone oxidoreductase, PIG3 family [polymorphum gilvum
           SL003B-26A1]
 gi|326412260|gb|ADZ69323.1| Putative NAD(P)H quinone oxidoreductase, PIG3 family [Polymorphum
           gilvum SL003B-26A1]
          Length = 333

 Score =  315 bits (807), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 158/324 (48%), Positives = 216/324 (66%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  +A++  G  +V+   +  +P P   EILIKV A GVNRPDV+QR G YPPPK+A+ +
Sbjct: 8   MTAIAITAPGGPDVLAPEQRHVPVPLGREILIKVAAAGVNRPDVLQRMGAYPPPKDASDL 67

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +  +G   T + +GD V ALV GGGYAEYC  H+ H LP+P G+   +AA++
Sbjct: 68  PGLEVAGTVAAVGTQVTAFAVGDRVTALVPGGGYAEYCKVHESHALPVPAGFTMEEAAAV 127

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    LR+G+  L+HGG+SGIGTTAIQLA  FGA VYTT  S EK  A 
Sbjct: 128 PETFFTVWSNVFDRVGLRAGERFLVHGGTSGIGTTAIQLAKAFGAKVYTTVGSAEKLDAV 187

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA  AI+Y K+DF+  +  ET G G+ +ILDMVG +Y+ ++  + + EG++  I+ L
Sbjct: 188 RALGADVAIDYNKQDFVAEILAETGGEGVHVILDMVGGDYVEKNWKVAAVEGRICQIATL 247

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G I+  +N + ++ KR+  TGSTLR R    K +I  +L+ K+WPLL +  + PV+ + 
Sbjct: 248 NG-ISENVNFSRLMQKRLIHTGSTLRPRDTAFKAAIAAALKDKVWPLLEAGTVRPVMDST 306

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL K A AH  ME S HIGKI+L
Sbjct: 307 FPLAKAADAHRRMESSGHIGKIVL 330


>gi|91789119|ref|YP_550071.1| zinc-binding alcohol dehydrogenase [Polaromonas sp. JS666]
 gi|91698344|gb|ABE45173.1| Alcohol dehydrogenase, zinc-binding protein [Polaromonas sp. JS666]
          Length = 340

 Score =  315 bits (807), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 162/339 (47%), Positives = 224/339 (66%), Gaps = 16/339 (4%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ YG  +V+ L E P  Q    E+LI+V+A GVNRPDV QR G YP P  A+ I
Sbjct: 1   MKAIEITSYGAPDVLRLGERPDAQAGAGEVLIRVKASGVNRPDVFQRTGNYPVPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTH---WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPK----GYN 119
            GLEVAG+IV           + IGD VCALV GGGYAE C++  G  LP+P       +
Sbjct: 61  PGLEVAGEIVAGDAAAMAAAGFKIGDRVCALVAGGGYAELCVAPVGQCLPVPTCNGVALS 120

Query: 120 AIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKS 179
            ++AA+LPE+FFTVW+N+F  A L++G+T+LI GGSSGIG TAIQ+A   GATV  TA S
Sbjct: 121 DVEAAALPETFFTVWSNVFDRARLQAGETLLIQGGSSGIGVTAIQMAKALGATVLVTAGS 180

Query: 180 EEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGK 239
           +EKC ACL LGA HAINY   DF++ ++K T G+G+++ILDMV   Y+++ +  L+++G+
Sbjct: 181 DEKCAACLALGADHAINYKTADFVQEVKKLTNGQGVNVILDMVAGSYVSREVDSLAEDGR 240

Query: 240 LIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVI 299
           L+II+  GG  A EIN   ++ +R+TITGSTLR R    K +I ++L+ K+WPL+ S  I
Sbjct: 241 LVIIAVQGGARA-EINAGLVLRRRLTITGSTLRPRPLAFKTAIANALKEKVWPLIVSGAI 299

Query: 300 APVIHTVLPL--------GKVAMAHDIMEKSEHIGKIIL 330
            PVIH+               A AH +ME ++H+GKI+L
Sbjct: 300 KPVIHSTFAAVDAGSDTGSGAARAHALMESNQHVGKIVL 338


>gi|254466772|ref|ZP_05080183.1| alcohol dehydrogenase, zinc-containing [Rhodobacterales bacterium
           Y4I]
 gi|206687680|gb|EDZ48162.1| alcohol dehydrogenase, zinc-containing [Rhodobacterales bacterium
           Y4I]
          Length = 327

 Score =  315 bits (806), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 158/324 (48%), Positives = 220/324 (67%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V +S  G   V+ L E P+PQ    E++IKV   G+NRPD +QR G Y PPK A+ +
Sbjct: 5   MRAVEISKPGGPEVLQLCERPVPQAGHGEVVIKVAYAGMNRPDALQRAGAYDPPKGASDL 64

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G++V +G   +    GD+VCAL+ GGGYAEY  +   H LP+P G +  QAA L
Sbjct: 65  PGLEASGEVVAVGAGVSGICEGDQVCALLPGGGYAEYVATPAAHCLPVPAGLDLKQAACL 124

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    L++G+  L+HGGSSGIGTTAIQLA  FGA V+ TA S+EKC AC
Sbjct: 125 PETFFTVWSNVFTRGGLKAGERFLVHGGSSGIGTTAIQLAREFGARVFATAGSDEKCQAC 184

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA+ AINY  EDF++++Q E    G D++LDMVG +Y+ +++  L+++G+L+ I+FL
Sbjct: 185 LDLGAERAINYRDEDFVQVMQGEG---GADLVLDMVGGDYIPRNVKALAEDGRLVQIAFL 241

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    E+N   ++ KR+T+TGSTLR ++D+AK  I   L+  +WPL+ +  +APV+ + 
Sbjct: 242 QGP-KVELNFALMMVKRLTLTGSTLRPQSDLAKARIAQDLREAVWPLIEAGKVAPVMDSE 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   A AH  ME S HIGKI+L
Sbjct: 301 FALADAAAAHARMESSGHIGKIVL 324


>gi|126453705|ref|YP_001065574.1| zinc-binding dehydrogenase family oxidoreductase [Burkholderia
           pseudomallei 1106a]
 gi|242315796|ref|ZP_04814812.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei 1106b]
 gi|126227347|gb|ABN90887.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei 1106a]
 gi|242139035|gb|EES25437.1| oxidoreductase, zinc-binding dehydrogenase family [Burkholderia
           pseudomallei 1106b]
          Length = 360

 Score =  315 bits (806), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 221/334 (66%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 22  MKAIEITEFGAPDVLKLTERPQPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 81

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV     D   N     + D VCAL+ GGGYA+Y  +     LP+PKG   +
Sbjct: 82  PGLEVAGEIVGGDLADSAANPFGLKLCDRVCALLAGGGYAQYVAAPLAQCLPVPKGLTDV 141

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
            AASLPE+FFTVW+N+F  A L +G+     T L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 142 DAASLPETFFTVWSNVFDRAQLGAGEGGAQETFLVQGGSSGIGVTAIQIAHALGFRVFAT 201

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A +++KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L  L+ 
Sbjct: 202 AGTDDKCRACEALGAERAINYKSEDFVEVVKSLTHDRGVDVILDMVAGAYVPRELAALAD 261

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG  A EIN+  I+ +R+TITGSTLR R    K +I   L+ ++WPL+  
Sbjct: 262 GGRLVVIALLGGAKA-EINVAEILRRRLTITGSTLRPRPVEFKAAIAAQLKARVWPLIED 320

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + PVI+ VLP  + A AH +ME SEH+GKI+L
Sbjct: 321 GRVKPVIYRVLPAAQAADAHALMESSEHVGKIVL 354


>gi|163732692|ref|ZP_02140137.1| alcohol dehydrogenase, zinc-containing, putative [Roseobacter
           litoralis Och 149]
 gi|161394052|gb|EDQ18376.1| alcohol dehydrogenase, zinc-containing, putative [Roseobacter
           litoralis Och 149]
          Length = 335

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 149/328 (45%), Positives = 218/328 (66%), Gaps = 4/328 (1%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + + MR + +S  G   V+ L + P+P+P  ++++IKV   GVNRPD +QR GLY PP  
Sbjct: 8   MAQMMRAIEISEAGGPEVLTLCQRPMPEPAHDQVVIKVAWAGVNRPDALQRAGLYAPPPT 67

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE +G++V +G       +GD VCAL+ GGGYAEY  +   H L +P G    +
Sbjct: 68  ASDLPGLEASGEVVAVGAGVNDLAVGDLVCALLPGGGYAEYVATPAAHCLAVPDGMGLRE 127

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA LPE++FTVW+N+F    L++G+  L+HGGSSGIGTTAIQLA   GA V+ TA SE K
Sbjct: 128 AACLPETYFTVWSNVFTRGGLKAGERFLVHGGSSGIGTTAIQLAHALGARVFATAGSEAK 187

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C AC++LGA+ AINY  +DF+  ++ E    G ++ILDMVG +Y+ ++   L+ +G+L+ 
Sbjct: 188 CAACVELGAERAINYRDDDFVAAMRAEG---GANVILDMVGGDYIPRNFKALADDGRLVQ 244

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+FLGG    E+N   ++++R+T+TGSTLR ++D+AK  I   L+  +WP+L++  I PV
Sbjct: 245 IAFLGG-AKVEVNFTMLMTRRLTMTGSTLRPQSDLAKAGIAQELRDTVWPMLSAGTIGPV 303

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +     L + A AH  ME S HIGKI+L
Sbjct: 304 MDQEFLLEEAAAAHTRMESSGHIGKIVL 331


>gi|73540661|ref|YP_295181.1| zinc-containing alcohol dehydrogenase superfamily protein
           [Ralstonia eutropha JMP134]
 gi|72118074|gb|AAZ60337.1| Zinc-containing alcohol dehydrogenase superfamily [Ralstonia
           eutropha JMP134]
          Length = 334

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 215/333 (64%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +  YG   V+   + P P P   EILI+V A GVNRPDV QR G YP P  A+ +
Sbjct: 1   MQAIEIREYGAPEVLQETQRPDPVPGAGEILIRVAAAGVNRPDVFQRTGNYPVPPGASDL 60

Query: 67  LGLEVAGKIV--DL--GENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG +V  DL   +N     +GD VCALV GGGYA+ C +     LP PKG + I+
Sbjct: 61  PGLEVAGVVVGGDLSHADNRFGLKVGDRVCALVQGGGYAQLCTAPVAQCLPAPKGLSDIE 120

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE+FFTVW+N+F    L  G     +T+LI GGSSGIGTTAIQ+A   G  V+ TA
Sbjct: 121 AAALPETFFTVWSNVFDRGYLGQGPRGKDETLLIQGGSSGIGTTAIQIAKALGYKVFVTA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            ++EKC AC  LGA  AINY  +DF+  +   T+G+G+D+ILDMV   YL + L  ++ +
Sbjct: 181 GTDEKCKACEDLGADRAINYKTQDFVAEVASLTEGKGVDVILDMVAGSYLARELKCIADD 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G+++II+ LGG  A EI L  I+ +RIT+TGSTLR R+   K  I  +L  ++WPLL + 
Sbjct: 241 GRIVIIALLGGAKA-EIPLGDILRRRITVTGSTLRPRSASFKGQIAQALHQQVWPLLEAG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PVIH V P  + A AH +ME SEHIGKI+L
Sbjct: 300 KIKPVIHKVFPAAQAAEAHRLMESSEHIGKIVL 332


>gi|257139693|ref|ZP_05587955.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia thailandensis E264]
          Length = 339

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 160/334 (47%), Positives = 225/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+P++ E+LIKV A GVNRPDV QRK  Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLTERPQPEPKRGEVLIKVAASGVNRPDVFQRKDAYAPPPGASDL 60

Query: 67  LGLEVAGKIV--DLGENTTH---WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG+IV  DL +  T+     +G+ VCAL+ GGGYA+Y  +     LP+PKG   +
Sbjct: 61  PGLEVAGEIVGGDLSDPATNPFGLKVGERVCALLAGGGYAQYVAAPLAQCLPVPKGLTDV 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T L+ GGSSGIG TAIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGAGEGGALETFLVQGGSSGIGVTAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A +++KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + LT L+ 
Sbjct: 181 AGTDDKCRACEALGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVAGAYVARELTALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG   +EIN+  I+ +R+TITGSTLR R    K  I   L+ ++WPL+  
Sbjct: 241 GGRLVVIALLGGA-KSEINVAEILRRRLTITGSTLRPRPVEFKARIAAQLKARVWPLIEG 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + PV++ VLP  + A AH +ME SEH+GKI+L
Sbjct: 300 GHVKPVVYRVLPAAQAADAHALMESSEHVGKIVL 333


>gi|255261586|ref|ZP_05340928.1| putative quinone oxidoreductase [Thalassiobium sp. R2A62]
 gi|255103921|gb|EET46595.1| putative quinone oxidoreductase [Thalassiobium sp. R2A62]
          Length = 330

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 158/330 (47%), Positives = 217/330 (65%), Gaps = 4/330 (1%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + K  R V +S  G   ++  A   IPQP+  E+LI+V   GVNRPD +QR GLY PP
Sbjct: 1   MRLPKTARVVEISQAGGPEMLTPAAREIPQPRMGEVLIRVAFAGVNRPDALQRAGLYNPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K A+ + GLE +G++V +GE  T W+IGD+VCAL+ GGGYAEY  +   H LPIP G   
Sbjct: 61  KGASDLPGLEASGEVVAVGEGVTDWSIGDKVCALLPGGGYAEYVTTPAAHCLPIPAGMAM 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA LPE+ FTVW+N+     L++G+  L+HGGSSGIGTTAIQL    GA V+TTA S+
Sbjct: 121 DQAACLPENIFTVWSNVVTRGGLQAGERFLVHGGSSGIGTTAIQLGRQLGARVFTTAGSD 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
            KC ACL LGA+ A+NY   DF+++++      G  +ILDMVG  Y+ ++L  L  +G+L
Sbjct: 181 AKCQACLDLGAEVAVNYRDADFVDVMRNHG---GAHLILDMVGGSYIPRNLKCLVDDGRL 237

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+FL G    E+N   ++++R+TITGSTLR ++D+AK +I   L+  +WPL  +  +A
Sbjct: 238 VQIAFLQGP-KVELNFVQMMTRRLTITGSTLRPQSDLAKAAIARDLRTHVWPLYANGQMA 296

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PV+ +   L   A AH  ME S HIGKI+L
Sbjct: 297 PVMDSTYDLDDAAKAHAYMESSGHIGKIVL 326


>gi|253989812|ref|YP_003041168.1| hypothetical protein PAU_02332 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781262|emb|CAQ84424.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 338

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 154/316 (48%), Positives = 215/316 (68%), Gaps = 2/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G    + L + P+P+P+K  +L+KV A GVNRPD+ QR G YPPP +A+P+LGLE+AG++
Sbjct: 21  GGPEKLHLVQVPLPRPEKGYLLVKVAAAGVNRPDIFQRMGSYPPPPDASPLLGLEIAGEV 80

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V  GE+   WNIGD+VCALV GGGYAEYCL H    LPI  G + +QAA+LPE+FFTVWA
Sbjct: 81  VAKGEDCERWNIGDKVCALVAGGGYAEYCLVHDTIALPI-YGLDFVQAAALPENFFTVWA 139

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+FQT  L  G++VLIHGG+SGIG+  I LA  FGA V TT  S+EK      LGA   I
Sbjct: 140 NVFQTGKLTQGESVLIHGGTSGIGSVTIMLAKAFGARVITTVGSDEKAKVAHSLGADFVI 199

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY KEDF+E + + T  +G+D+++D++G +Y++++  + +K G++I I  + GN    +N
Sbjct: 200 NYRKEDFVERVLQLTDKQGVDMVVDLIGGDYVDKNYKVAAKFGRIIQIGMMKGN-PENLN 258

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L P++ KR+T TGST+R R    K  I   L+  +WPLL S  ++P+I  V  L   A A
Sbjct: 259 LMPLMLKRLTHTGSTMRSRNVEEKAEIARELEKYVWPLLKSGKVSPLICKVFDLKDAADA 318

Query: 316 HDIMEKSEHIGKIILL 331
           H +ME  + IGK++L+
Sbjct: 319 HRMMEAGDVIGKVMLV 334


>gi|194289156|ref|YP_002005063.1| NADPH quinone oxidoreductase [Cupriavidus taiwanensis LMG 19424]
 gi|193222991|emb|CAQ68996.1| putative NADPH QUINONE OXIDOREDUCTASE [Cupriavidus taiwanensis LMG
           19424]
          Length = 334

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 165/333 (49%), Positives = 215/333 (64%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +  YG   V+ L E P P P   E+LI+V A GVNRPDV QR G YP P  A+ +
Sbjct: 1   MQAIEIREYGAPEVLQLTERPDPVPGAGEVLIRVAAAGVNRPDVFQRTGNYPVPPGASDL 60

Query: 67  LGLEVAGKIV--DLG--ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG +V  DLG  +N     +GD VCALV GGGYA+ C +     LP P+G + I+
Sbjct: 61  PGLEVAGVVVGGDLGHADNRFGLKVGDRVCALVQGGGYAQLCTAPLAQVLPAPQGLSDIE 120

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE+FFTVW+N+F    L  G     +T+LI GGSSGIGTTAIQ+A   G  V+ TA
Sbjct: 121 AAALPETFFTVWSNVFDRGYLGQGPRGKEETLLIQGGSSGIGTTAIQVAKALGFKVFVTA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            ++EKC AC  LGA  AINY  +DF+  +   T G+G+D+ILDMV   YL + L  ++ +
Sbjct: 181 GTDEKCKACEDLGADRAINYKTQDFVAEVAALTGGKGVDVILDMVAGPYLARELKCIADD 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G+++II+ LGG  A EI L  I+ +RIT+TGSTLR R    K  I  +L  ++WPLL + 
Sbjct: 241 GRIVIIALLGGAKA-EIPLGDILRRRITVTGSTLRPRPASFKGKIAAALHEQVWPLLAAG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PVIH V P  + A AH +ME SEHIGKI+L
Sbjct: 300 KIKPVIHKVFPAAQAADAHRLMESSEHIGKIVL 332


>gi|114764020|ref|ZP_01443261.1| alcohol dehydrogenase, zinc-containing [Pelagibaca bermudensis
           HTCC2601]
 gi|114543612|gb|EAU46626.1| alcohol dehydrogenase, zinc-containing [Roseovarius sp. HTCC2601]
          Length = 323

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 217/324 (66%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V +S  G   V+     P+PQP   E++I+V   GVNRPD +QR G Y PP+ A+ +
Sbjct: 1   MRAVEISEPGGPEVLRPTTRPVPQPGHSEVVIQVAWAGVNRPDALQRAGRYAPPEGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G +  +G   T   +GD VCAL+ GGGYAEY  +   H LP+P+G    +AA L
Sbjct: 61  PGLEASGIVSAVGPGVTWPAVGDAVCALLPGGGYAEYVATPAAHCLPVPEGMGLREAACL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVW+N+FQ   L++G+  L+HGGSSGIGTTAIQLA   GA V+ TA S EKC AC
Sbjct: 121 PETYFTVWSNVFQRGALKAGERFLVHGGSSGIGTTAIQLAHVMGARVFATAGSAEKCAAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA+ AINY +EDF+E+L+ E    G D+ILDMVG +Y+ +++  L+ +G+L+ I+FL
Sbjct: 181 LSLGAERAINYREEDFVEVLRAEG---GADLILDMVGGDYIPRNVKTLADDGRLVQIAFL 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
                 E+N   ++ +R+TITGSTLR ++  AK  I  SL+  +WPLL++  I PV+ + 
Sbjct: 238 QAP-KVELNFVHLMVRRLTITGSTLRPQSVEAKARIASSLREHVWPLLDAGRIGPVMDSE 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           +PL K + AH  ME S H+GKI+L
Sbjct: 297 VPLEKASEAHARMESSAHVGKIVL 320


>gi|84685525|ref|ZP_01013423.1| NADPH/quinone reductase and related Zn-dependent oxidoreductase
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84666682|gb|EAQ13154.1| NADPH/quinone reductase and related Zn-dependent oxidoreductase
           [Rhodobacterales bacterium HTCC2654]
          Length = 334

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 219/330 (66%), Gaps = 4/330 (1%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + K MR V ++  G   V+     P+P P   EILI++   GVNRPD +QR G+Y PP
Sbjct: 7   MTLPKTMRAVEITKPGAPEVLQPTTRPVPAPGHGEILIELAYAGVNRPDALQRAGMYAPP 66

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+ + GLE +G +  +G   T W +GDEVCAL+ GGGYAEY  +   H LPIPKG   
Sbjct: 67  PTASDLPGLEGSGTVAAIGPGVTEWLVGDEVCALLPGGGYAEYVTTPAAHALPIPKGMGL 126

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            +AA LPE+++TVW+N+F    L++G+  L+HGGSSGIGTTAIQLAS  GA V+TTA S+
Sbjct: 127 KEAACLPETYYTVWSNVFMRGGLKAGERFLVHGGSSGIGTTAIQLASTLGARVFTTAGSD 186

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +KC  C  LGA+ AINY   DF+E++    +  G ++ILDMVG  Y+ +++  L+ EG++
Sbjct: 187 DKCKVCTDLGAEVAINYKDADFVEVM---AEAGGANLILDMVGGSYIARNIKALADEGRM 243

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+FL G  A EIN   I+++R+TITGSTLR ++D AK +I   L+  +WPLL +  + 
Sbjct: 244 VHIAFLTGPKA-EINFAQIMARRLTITGSTLRPQSDAAKAAIAAELREHVWPLLGAGRVK 302

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P++ +  PL + A AH  ME S HIGKI+L
Sbjct: 303 PIMDSTYPLDEAARAHAHMESSTHIGKIVL 332


>gi|332526744|ref|ZP_08402846.1| NAD(P)H quinone oxidoreductase, PIG3 family protein [Rubrivivax
           benzoatilyticus JA2]
 gi|332111147|gb|EGJ11179.1| NAD(P)H quinone oxidoreductase, PIG3 family protein [Rubrivivax
           benzoatilyticus JA2]
          Length = 328

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 212/327 (64%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V +S +G+  V+ + + P P P   E+LI V+A GVNRPDV+QR+G YPPP  A+ +
Sbjct: 1   MRAVEISRFGRPEVLQIVQRPAPVPAAGELLIAVQASGVNRPDVLQRRGHYPPPPGASDL 60

Query: 67  LGLEVAGKIVDLGEN---TTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
            GLEVAG ++D            IGD VCALV GGGYAE C +     LP+P+G   ++A
Sbjct: 61  PGLEVAGTVLDGAPEDLAAAGLAIGDAVCALVAGGGYAEQCAAPAAQCLPVPRGLTMVEA 120

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           ASLPE+FFTVW N+F  + L  G+T+L+ GG+SGIG TAIQLA  FGA V  TA S++KC
Sbjct: 121 ASLPETFFTVWQNVFALSRLARGETLLVQGGTSGIGVTAIQLAKAFGAQVIVTAGSDDKC 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
            A   +GA HAINY  +DF     + T GRG+D++LDMV  +Y+ + +  L+ +G+L II
Sbjct: 181 AAARAIGADHAINYRTQDFAAEANRLTDGRGVDVVLDMVAGDYVAREVECLAVDGRLAII 240

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           +  GG  A+  +   ++ KRITITGSTLR R+   K  +  +L  ++WPLL +  + PV+
Sbjct: 241 AVQGGT-ASAFDAGQVLRKRITITGSTLRARSVGYKAGLARALHEQVWPLLETGAVKPVV 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           H V P  + A AH +ME   H+GKI+L
Sbjct: 300 HRVFPAAEAAAAHALMESGSHVGKIVL 326


>gi|296136709|ref|YP_003643951.1| hypothetical protein Tint_2271 [Thiomonas intermedia K12]
 gi|295796831|gb|ADG31621.1| hypothetical protein Tint_2271 [Thiomonas intermedia K12]
          Length = 326

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 212/324 (65%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +S  G   V+ L E P+PQ    E+L++V A GVNRPD +QR+GLYPPP  A  +
Sbjct: 1   MRAIEISQPGGPEVLRLCERPMPQAGAGEVLLRVRAFGVNRPDALQRRGLYPPPAGAPDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV G+IV      T  + G+ VCALV GGGYAEYC++  G  LP+P G +A + A+L
Sbjct: 61  PGLEVCGEIVSGDLAGTDLHQGELVCALVAGGGYAEYCVAPTGQCLPLPDGLSAEEGAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVW N+F+   L++G+ +L+ GGSSGIGT AIQLA   GA V  TA S+EKC AC
Sbjct: 121 PETAFTVWHNVFERGRLQAGEMLLVQGGSSGIGTMAIQLAVASGARVVATAGSDEKCAAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L+LGA+ AINY  +DF+E +   T  RG D+ILDMV   YL +    L++EG+L++I+  
Sbjct: 181 LQLGAELAINYRTQDFVEAILAHTAERGADVILDMVAGSYLAREQRCLAEEGRLVVIAVQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  EI+   ++ +R T+TGSTLR R+   K ++  +LQ  +WP +    + PVI  V
Sbjct: 241 GG-VKAEIDAGLLMRRRQTLTGSTLRARSVAFKSAVAQALQKTVWPWIEQGRVRPVIDAV 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P   +  AH  ME+ +HIGK++L
Sbjct: 300 FPAEDIVQAHQRMEQGQHIGKLVL 323


>gi|262379282|ref|ZP_06072438.1| NADPH:quinone reductase [Acinetobacter radioresistens SH164]
 gi|262298739|gb|EEY86652.1| NADPH:quinone reductase [Acinetobacter radioresistens SH164]
          Length = 331

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 149/324 (45%), Positives = 212/324 (65%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G    +      IP P+ +E+L+KV A G+NRPD++QR+GLYP P    P+
Sbjct: 7   MQQVIITEPGGPEKLAYESVAIPVPKADEVLVKVHAFGINRPDILQRQGLYPMPAGVTPV 66

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +  +G + T + +GD VC L NGGGYAEYC+  +  TL +P+G + +QAA++
Sbjct: 67  PGLEVAGVVEAVGTDVTQFKVGDPVCGLTNGGGYAEYCVVPETQTLMVPEGVSLVQAAAI 126

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWANLFQ    ++G+TVLIHGG+SGIGTTA+ L    G   + T  S+EK  A 
Sbjct: 127 PETFFTVWANLFQMGKAKAGETVLIHGGTSGIGTTALMLCKALGIKTFATVGSDEKVAAI 186

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             L    AINY  +DF   + ++T   GID+ILD+VGA YL ++L LL K+G+L+ ++FL
Sbjct: 187 AHL--TDAINYKTQDFESYITEKTDKSGIDVILDIVGAPYLERNLNLLRKDGRLVYLAFL 244

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A EINL  I+ KR+TITGST+R R    KQ+I + L+  +WPLL      P+I+  
Sbjct: 245 GGRKAKEINLGHIMMKRLTITGSTMRARNTAEKQTITEGLKQHVWPLLAKGECLPMIYQT 304

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
               ++  AH  M+  EH+GK+++
Sbjct: 305 FKFDQIQDAHAAMDTGEHVGKVVV 328


>gi|170691677|ref|ZP_02882841.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia graminis
           C4D1M]
 gi|170142961|gb|EDT11125.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia graminis
           C4D1M]
          Length = 338

 Score =  313 bits (801), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 221/333 (66%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G   V+ LAE P PQP+  E+LIKV A G+NRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPEVLKLAERPTPQPKAGEVLIKVAASGINRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV    D   N     IGD VCAL+ GGGYAEY ++     LP+P G + ++
Sbjct: 61  PGLEVAGEIVGGDIDGKNNPFGLKIGDRVCALLAGGGYAEYAVAPLLQCLPVPGGLSDVE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AASLPE+FFTVW+N+F  A L  G+     T+L+ GGSSGIG TAIQ+A   G  V+ TA
Sbjct: 121 AASLPETFFTVWSNVFDRAQLGKGEGGPNETLLVQGGSSGIGVTAIQIAHALGFRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S++KC AC  LGA+ AINY  EDF+E+++  T  RG+D++LDMV   Y+++ LT L+  
Sbjct: 181 GSDDKCRACEALGAERAINYKTEDFVEVIKSLTNDRGVDVVLDMVAGSYVSRELTALADG 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+NLN ++ +R+T+TGSTLR R    K  I   L+ ++WP L   
Sbjct: 241 GRIVLIALLGGAKA-ELNLNEVLRRRLTVTGSTLRPRPIEFKAKIAAQLKEQVWPHLEGG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PV+H V    + A AH +ME S H+GKI+L
Sbjct: 300 RIKPVVHRVFRAAQAADAHALMESSTHVGKIVL 332


>gi|311104461|ref|YP_003977314.1| NAD(P)H quinone oxidoreductase [Achromobacter xylosoxidans A8]
 gi|310759150|gb|ADP14599.1| NAD(P)H quinone oxidoreductase, PIG3 family protein 1
           [Achromobacter xylosoxidans A8]
          Length = 325

 Score =  312 bits (800), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 212/324 (65%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  V +S  G   V+   E P P     E+LIKV A GVNRPDV QRKG Y PP+ A+ +
Sbjct: 1   MHAVEISRPGGPEVLVPVERPTPDAGAGEVLIKVSAAGVNRPDVFQRKGNYAPPRGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG+IV      + + +GD+VCALV GGGYAEYC++     LPIPKG + I+AA L
Sbjct: 61  PGLEVAGEIVGGDLAGSGYALGDKVCALVAGGGYAEYCVAPAAQCLPIPKGLSDIEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVW+N+F    L  G+ +L+HGG+SGIGTTAIQLA   G  VY T  S+++  A 
Sbjct: 121 PETYFTVWSNVFDRGRLSEGEALLVHGGASGIGTTAIQLARAMGHKVYATVGSDDRARAV 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+  INY  EDF++ +   T GRG+D+ILDMV  +Y+ + +  L+ +G+++II+ L
Sbjct: 181 EALGAERGINYKTEDFVKEVLDATGGRGVDVILDMVAGDYIGRDMQCLADDGRIVIIAQL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A  ++   ++ +R+TITGSTLR R    K +I  +L+ + WPLL    I P++H  
Sbjct: 241 GGAHAN-VDTAQVMRRRLTITGSTLRPRPVAFKGAIARALREQAWPLLEKGAIKPIVHAT 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + + AH +ME  E+IGKIIL
Sbjct: 300 FPLAEASRAHAMMESGENIGKIIL 323


>gi|309781849|ref|ZP_07676582.1| alcohol dehydrogenase [Ralstonia sp. 5_7_47FAA]
 gi|308919490|gb|EFP65154.1| alcohol dehydrogenase [Ralstonia sp. 5_7_47FAA]
          Length = 334

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 163/334 (48%), Positives = 225/334 (67%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ YG   V+ L E P+P+ +  E+LI+V A GVNRPDV QR G YP P  A+ I
Sbjct: 1   MKAIEITQYGGPEVLKLGERPMPETKAGEVLIRVRAAGVNRPDVFQRTGNYPVPPGASDI 60

Query: 67  LGLEVAGKIV--DLG--ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV  DL   +N     +GD VCALV GGGYAE+C +  G  LP+P G + ++
Sbjct: 61  PGLEVAGEIVSGDLAHADNRYGLKVGDRVCALVQGGGYAEFCTAPLGQVLPVPAGLSDVE 120

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE++FTVW+N+F    L  G     +T+L+ GGSSGIGTTAIQ+AS  G  V+ TA
Sbjct: 121 AAALPENYFTVWSNVFDRGLLGRGAHGADETLLVQGGSSGIGTTAIQIASALGHRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S +KC AC+KLGA  AINY  EDF+EI++ ET G G D++LDMVG  Y+ + +   + +
Sbjct: 181 GSADKCDACVKLGAARAINYKTEDFVEIVKAET-GPGADVVLDMVGGSYVAREIACTADD 239

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+ L  I+ +R+T+TGSTLR R    K +I  +L   +WPLL S 
Sbjct: 240 GRIVLIALLGGAKA-EVPLGDILRRRLTLTGSTLRPRPVAFKAAIAANLYETVWPLLASG 298

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
            + PV+H V+P  + A AH +ME S HIGKI+L+
Sbjct: 299 RVKPVVHEVMPAAQAAQAHALMESSAHIGKIMLV 332


>gi|115522695|ref|YP_779606.1| alcohol dehydrogenase [Rhodopseudomonas palustris BisA53]
 gi|115516642|gb|ABJ04626.1| Alcohol dehydrogenase, zinc-binding domain protein
           [Rhodopseudomonas palustris BisA53]
          Length = 332

 Score =  311 bits (798), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 149/331 (45%), Positives = 218/331 (65%), Gaps = 1/331 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           P+  +M  + +S  G   V+      +PQP   ++L+KV A GVNRPDV QR G YPPP 
Sbjct: 3   PVPSQMTVIGISQPGGPEVLKPETRAVPQPGPGQLLVKVHAAGVNRPDVAQRSGSYPPPP 62

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A+ + GLE+AG++V +G+  +   +GD+V +LV GGGYAEYCL+     + +P GY+ I
Sbjct: 63  GASDLPGLEIAGEVVAIGDGASRHRLGDKVMSLVAGGGYAEYCLAQDAQAMTVPPGYSMI 122

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
           +A + PE+  TVW N+F+   L +G+T+L+HGGSSGIGT AIQLA  FGA V  T  S++
Sbjct: 123 EAGAAPETLMTVWHNVFERGALSAGETLLVHGGSSGIGTMAIQLAKAFGAKVLVTVGSQD 182

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           K  AC+KLGA HAINY  EDF++  +  T G+G+++ILDMVG +Y+ ++    + +G+++
Sbjct: 183 KAEACVKLGADHAINYRNEDFVKAAKHATGGKGVELILDMVGGDYIERNYDAAAMDGRIV 242

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I+FLGG  A   N   ++ KR+  TGSTLR R+D  K ++  +++ ++ PLL    I P
Sbjct: 243 QIAFLGGPKAN-ANFAKLMMKRLHHTGSTLRPRSDADKAAMVAAIEAQVMPLLAQGRIKP 301

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
           +I +  PL + A AH  ME S+HIGKI+L P
Sbjct: 302 LIDSTFPLREAAEAHRRMETSQHIGKIVLAP 332


>gi|209518518|ref|ZP_03267339.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp. H160]
 gi|209501063|gb|EEA01098.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp. H160]
          Length = 338

 Score =  311 bits (798), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 162/333 (48%), Positives = 220/333 (66%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G   V+ LAE P PQ +  E+LIKV A G+NRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPEVLKLAERPTPQLKVGEVLIKVAASGINRPDVFQRKGGYAPPPGASDL 60

Query: 67  LGLEVAGKIV----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG+IV    D   N     IGD VCAL+ GGGYAEY  +     LP+P G + ++
Sbjct: 61  PGLEVAGEIVGGAIDEKNNPFGLKIGDRVCALLAGGGYAEYAAAPLPQCLPVPAGLSDVE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AASLPE+FFTVW+N+F  A L  G+     T+L+ GGSSGIG TAIQ+A   G  V+ TA
Sbjct: 121 AASLPETFFTVWSNVFNRAQLGRGEGGPNETLLVQGGSSGIGVTAIQIAHALGFRVFATA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S+EKC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + L+ L+  
Sbjct: 181 GSDEKCRACEALGAERAINYKTEDFVEVIKSLTNDRGVDVILDMVAGSYVPRELSALADG 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G++++I+ LGG  A E+NLN ++ +R+T+TGSTLR R    K  I   L+ ++WP L + 
Sbjct: 241 GRIVLIALLGGAKA-ELNLNEVLRRRLTVTGSTLRPRPIEFKAQIAAQLKERVWPHLEAG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PV+H V P  + A AH +ME S H+GKI+L
Sbjct: 300 RIKPVVHRVFPAAQAADAHALMESSTHVGKIVL 332


>gi|262375886|ref|ZP_06069117.1| NADPH:quinone reductase [Acinetobacter lwoffii SH145]
 gi|262308980|gb|EEY90112.1| NADPH:quinone reductase [Acinetobacter lwoffii SH145]
          Length = 330

 Score =  311 bits (798), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 216/326 (66%), Gaps = 2/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + M+ V ++  G  + +      +P+P+ +E+L+KV A G+NRPD++QR+GLYP PK   
Sbjct: 4   QTMQQVIITEPGGVDKLAYETVTVPEPKADEVLVKVHAFGINRPDILQRQGLYPMPKGVT 63

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           P+ GLEVAG++V +G + + + +GD+VC L NGGGYAEYC+  +  TL IP+G + +QAA
Sbjct: 64  PVPGLEVAGEVVAIGSDVSQFKVGDQVCGLTNGGGYAEYCVIPESQTLNIPEGVSFVQAA 123

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           ++PE+FFTVWAN+FQ    ++G+TVL+HGG+SGIGTTA+ L    G   + T  S+EK  
Sbjct: 124 AIPETFFTVWANVFQMGKAKAGETVLVHGGTSGIGTTALMLCKSLGIKTFATVGSDEKVA 183

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           A   L    AINY  +DF +++ + T   G+D+ILDMVGA YL ++L LL ++G+L+ I+
Sbjct: 184 AISDL--TTAINYKTQDFEQVINEATDNGGVDVILDMVGAPYLERNLNLLRRDGRLVYIA 241

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FLGG  A E+ L  I+ KR+TITGST+R R+   K  I   L+ +I PL       P+I+
Sbjct: 242 FLGGAKAKEVKLGQIMMKRLTITGSTMRARSTAEKAEIAQGLKEQIAPLWAKGECLPMIY 301

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
                 ++  AH  M+  EH+GK+++
Sbjct: 302 KTFKFDQIQDAHATMDTGEHVGKVVV 327


>gi|197285068|ref|YP_002150940.1| zinc-binding dehydrogenase [Proteus mirabilis HI4320]
 gi|227355472|ref|ZP_03839868.1| possible NADPH:quinone reductase [Proteus mirabilis ATCC 29906]
 gi|194682555|emb|CAR42573.1| probable zinc-binding dehydrogenase [Proteus mirabilis HI4320]
 gi|227164459|gb|EEI49343.1| possible NADPH:quinone reductase [Proteus mirabilis ATCC 29906]
          Length = 341

 Score =  311 bits (797), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 218/324 (67%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  V ++  G  + + L  SP+P      +L+KV A GVNRPD+ QR+G YPPP +A+PI
Sbjct: 11  MTQVVITEPGGVDKLQLENSPLPSLPPHYMLVKVNAAGVNRPDIFQRQGSYPPPADASPI 70

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE+AG++V LGE+ T W IGD VCALV GGGYAEYCL H+   LP  +G + I+AA+L
Sbjct: 71  LGLEIAGEVVKLGEHCTKWAIGDRVCALVAGGGYAEYCLVHEDIALP-SQGLSDIEAAAL 129

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVWANLFQ   L++G++VLIHGG+SGIG+ AI LA   G  +YTT  S+EK    
Sbjct: 130 PENLFTVWANLFQLGQLKAGESVLIHGGTSGIGSMAIMLAHNLGCEIYTTVGSKEKAEVA 189

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            KLGA H INY ++DF   +   TQG+G+D+ILD++G +Y+ ++  + +K G++I +  +
Sbjct: 190 QKLGANHVINYREKDFATEIPVLTQGKGVDVILDIIGGDYVEKNYQVAAKFGRVIQVGMM 249

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G     +N+ P++ KR+  TGST+R RT   K  I   L+ ++WPL+    I P+I+ V
Sbjct: 250 KG-APKNLNMMPLMLKRLIHTGSTMRSRTPEEKTHIAQELKQQVWPLIIKGQIKPIINAV 308

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L +VA AH +ME  + IGK++L
Sbjct: 309 FSLQEVAKAHQLMESGDLIGKVVL 332


>gi|77458179|ref|YP_347684.1| zinc-containing alcohol dehydrogenase superfamily protein
           [Pseudomonas fluorescens Pf0-1]
 gi|77382182|gb|ABA73695.1| putative dehydrogenase [Pseudomonas fluorescens Pf0-1]
          Length = 332

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 211/330 (63%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +  +M  + ++  G   V+     P+P   + E+LI+V A GVNRPD +QR G YP  
Sbjct: 1   MTLPNEMTRIEITEPGGPEVLQSRRVPLPVAAEGEVLIRVHAAGVNRPDALQRAGKYPMK 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
              NPI GLEVAG++V +G   + + +GD VCAL NGGGYAEYC    G TLPIP G + 
Sbjct: 61  PGMNPIPGLEVAGEVVAIGSGVSTFAVGDRVCALTNGGGYAEYCTVPAGQTLPIPDGLDW 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           IQAA++PE+FFTVWANLF       GQ  LIHGG+SGIGTTA+ L   FG   + TA S 
Sbjct: 121 IQAAAIPETFFTVWANLFGLGGASRGQRALIHGGTSGIGTTALMLCREFGIEAFATAGSA 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +KC A   LG   AINY +++F  ++ ++T  +G+++ILD++G  YLN +++ L  +G+L
Sbjct: 181 DKCAAIRNLGGD-AINYREQEFAAVIAEKTASQGVNVILDIMGGSYLNGNISALGMDGRL 239

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +++ FLGG  A +I+L  I+ KR  +TGS LR RT   K +I D L+  +WP+L +    
Sbjct: 240 VMLGFLGGARANDIDLLAILGKRAVVTGSLLRARTSAEKAAIADQLREHVWPVLAAGRCL 299

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P+I  V PL + A AH  ME  +HIGKI+L
Sbjct: 300 PIIDKVYPLAEAAKAHAHMEAGDHIGKIVL 329


>gi|75676934|ref|YP_319355.1| zinc-containing alcohol dehydrogenase superfamily protein
           [Nitrobacter winogradskyi Nb-255]
 gi|74421804|gb|ABA06003.1| Zinc-containing alcohol dehydrogenase superfamily [Nitrobacter
           winogradskyi Nb-255]
          Length = 332

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 151/325 (46%), Positives = 216/325 (66%), Gaps = 1/325 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           +M  + +S  G   V+     P+P P   E+LIKV A GVNRPDV+QR G YPPP  A+ 
Sbjct: 7   QMTAIGISKPGGPEVLVPQLRPVPSPGPREVLIKVAAAGVNRPDVLQRSGSYPPPPGASD 66

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           + GLEVAG++V LGE  + +  GD+V +LV+GGGYA+YC++H+   +P+P  ++ I+A  
Sbjct: 67  LPGLEVAGEVVALGEGASRYRPGDKVMSLVSGGGYAQYCVAHEAIAIPVPTAFSMIEAGG 126

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
            PE+  TVW N+F+   L++G+T+LIHGGSSGIGT AIQLA  FGA    T  S+EK  A
Sbjct: 127 TPETLITVWHNVFERGALKAGETLLIHGGSSGIGTMAIQLAKVFGARTIVTVGSKEKAGA 186

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA HAINY  +DF+  ++  T G G D+ILDMVG +Y+ ++    + EG+++ I+F
Sbjct: 187 CLGLGADHAINYKLQDFVAEVKAATAGAGADLILDMVGGDYIEKNYDAAALEGRIVQIAF 246

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           LGG  AT +NL  ++ KR+  TGSTLR R+   K ++  +++ K+ P++    I P+I +
Sbjct: 247 LGGAKAT-VNLARLMVKRLHHTGSTLRPRSVADKAAMVAAIEAKVLPMMRERRIKPLIDS 305

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL + A AH  ME S H+GKI+L
Sbjct: 306 SFPLEQAADAHRRMETSAHVGKIVL 330


>gi|124266593|ref|YP_001020597.1| putative oxidoreductase [Methylibium petroleiphilum PM1]
 gi|124259368|gb|ABM94362.1| putative oxidoreductase [Methylibium petroleiphilum PM1]
          Length = 328

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 148/327 (45%), Positives = 213/327 (65%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +S  G   V+ L E P P+P   E+LI V A GVNRPDV+QR G YPPP  A+ +
Sbjct: 1   MQAIEISQPGGPEVLRLVERPEPEPGPGELLIDVAAAGVNRPDVLQRAGAYPPPPGASDL 60

Query: 67  LGLEVAGKIVDLGENTTH---WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
            GLEVAG+IV           + +GD VCAL +GGGYA+ C++  G  LP+P G++ I+A
Sbjct: 61  PGLEVAGRIVGGDAGALAAAGFRLGDRVCALTHGGGYAQRCVAPVGQCLPVPAGWSDIEA 120

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           ASLPE+ FTVW N+F+ A L+ G+T+L+ GG+SGIG TAIQLA  FG  V+ T   + + 
Sbjct: 121 ASLPETLFTVWINVFERARLQPGETLLVQGGASGIGVTAIQLAKAFGCRVFVTVGDDARA 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
            AC  +GA  AINY   DF+  +++ T GRG+D+ILDMV   Y+ + L  L+ +G+L II
Sbjct: 181 QACRAIGADEAINYRTRDFVAEVERLTGGRGVDVILDMVAGSYVARELRCLADDGRLSII 240

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           +  GG  A E +   ++ +R+TITGSTLR RT   K ++  +L+ ++WPL+ +    P+I
Sbjct: 241 AVQGGTKA-EFDAGALLRRRLTITGSTLRPRTTEYKAAVGAALRARVWPLIEAGRFKPMI 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           H   P  + A AH++ME  +H+GK++L
Sbjct: 300 HKTFPAAQAAQAHELMESGQHVGKLVL 326


>gi|326800942|ref|YP_004318761.1| NAD(P)H quinone oxidoreductase, PIG3 family [Sphingobacterium sp.
           21]
 gi|326551706|gb|ADZ80091.1| NAD(P)H quinone oxidoreductase, PIG3 family [Sphingobacterium sp.
           21]
          Length = 323

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 216/325 (66%), Gaps = 6/325 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN-ANP 65
           M+ ++++ YG  NV+ L + P P  + +E+LIKV A GVNRPD+ QRKG Y  P+  A+ 
Sbjct: 1   MKAISITEYGAPNVLKLHDKPDPLIKPDEVLIKVAAAGVNRPDIFQRKGKYSAPEGVASD 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLE+AG I  +G     W IGD VCAL+ GGGYAE  +++ GH LPIP G + ++AAS
Sbjct: 61  IPGLEIAGVIEQIGAEVAQWQIGDHVCALIAGGGYAEKAVANAGHCLPIPTGLSFVEAAS 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+ +TVW N+F+   L+  +  L+HGGSSGIG TAIQLA   GA VY TA SEEKC A
Sbjct: 121 LPETIYTVWDNVFRRGALKKNEHFLVHGGSSGIGITAIQLAKSIGAKVYATAGSEEKCKA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA   INY   +F ++  KE     ID+ILDMVG  Y  +++++L+ +G+L+ I+ 
Sbjct: 181 CLDLGADVCINYRIYEFEKVFAKEK----IDVILDMVGGSYFRKNISILNHDGRLVYINA 236

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           + G++  E+++  I+ KRI++TGSTLR R    K  +   +   +WPL++S    P+IH 
Sbjct: 237 MNGSL-VELDIMEIMHKRISVTGSTLRSRDKHFKAMLTADILNNVWPLMHSGFFRPLIHA 295

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
           V PL +   AHD+ME+  HIGKI+L
Sbjct: 296 VFPLAEAWRAHDLMEEGRHIGKIVL 320


>gi|255319150|ref|ZP_05360368.1| putative quinone oxidoreductase [Acinetobacter radioresistens SK82]
 gi|255303796|gb|EET82995.1| putative quinone oxidoreductase [Acinetobacter radioresistens SK82]
          Length = 331

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 148/324 (45%), Positives = 212/324 (65%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G    +      IP P+ +E+L+KV A G+NRPD++QR+GLYP P    P+
Sbjct: 7   MQQVIITEPGGPEKLAYESVAIPVPKADEVLVKVHAFGINRPDILQRQGLYPMPAGVTPV 66

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +  +G++ T + +GD VC L NGGGYAEYC+  +  TL +P+G + +QAA++
Sbjct: 67  PGLEVAGVVEAVGKDVTQFKVGDPVCGLTNGGGYAEYCVVPETQTLIVPEGVSLVQAAAI 126

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWANLFQ    ++G+TVLIHGG+SGIGTTA+ L    G   + T  S+EK  A 
Sbjct: 127 PETFFTVWANLFQMGKAKAGETVLIHGGTSGIGTTALMLCKALGIKTFATVGSDEKVAAI 186

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             L    AINY  +DF   + ++T   GID+ILD+VGA YL ++L LL K+G+L+ ++FL
Sbjct: 187 AHL--TDAINYKTQDFESYITEKTDKSGIDVILDIVGAPYLERNLNLLRKDGRLVYLAFL 244

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A EINL  I+ KR+TITGST+R R    K +I + L+  +WPLL      P+I+  
Sbjct: 245 GGRKAKEINLGHIMMKRLTITGSTMRARNTAEKHTIAEGLKQHVWPLLAKGECLPMIYQT 304

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
               ++  AH  M+  EH+GK+++
Sbjct: 305 FKFDQIQDAHAAMDTGEHVGKVVV 328


>gi|319779190|ref|YP_004130103.1| Quinone oxidoreductase [Taylorella equigenitalis MCE9]
 gi|317109214|gb|ADU91960.1| Quinone oxidoreductase [Taylorella equigenitalis MCE9]
          Length = 335

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 217/324 (66%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +S  G   V+ + E  +PQ +  E+LIKV A GVNRPDV QR G+YPPP  A+ +
Sbjct: 6   MKVVEISEAGGPEVLQVNERALPQLEAGEVLIKVVAAGVNRPDVFQRMGIYPPPDGASDL 65

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G IVD       ++IGD VCAL  GGGYAEYC +   + LP+PKG + I AASL
Sbjct: 66  PGLEVSGVIVDGDFGGNGFHIGDRVCALTPGGGYAEYCKAPASNCLPLPKGVDFIGAASL 125

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVW+N+F  A+L +G ++L+HGG+SGIGT+AIQ+A+  G  VY T  S+E+ +A 
Sbjct: 126 PETYFTVWSNVFDIAHLETGDSLLVHGGASGIGTSAIQIATALGHKVYVTVGSDERVIAI 185

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY  +DF+E + K T G G+D++LDMV  EYLN+ +   + +G++++I+ L
Sbjct: 186 EALGATKGINYKTQDFVEEILKLTDGNGVDVVLDMVSGEYLNRDIKCAAIDGRIVVIAQL 245

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG+ A EIN   ++ KR+T+TGSTLR R+   K  I   L+ ++WPL+   +I PVI  V
Sbjct: 246 GGSRA-EINSGLLMRKRVTLTGSTLRPRSVEYKAKIAKELKERVWPLIEKGMIKPVIDRV 304

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
                 + AH+ ME   HIGKI+L
Sbjct: 305 FDFQDASKAHEYMESGNHIGKIVL 328


>gi|182411995|ref|YP_001817061.1| PIG3 family NAD(P)H quinone oxidoreductase [Opitutus terrae PB90-1]
 gi|177839209|gb|ACB73461.1| NAD(P)H quinone oxidoreductase, PIG3 family [Opitutus terrae
           PB90-1]
          Length = 322

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 211/325 (64%), Gaps = 6/325 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN-ANP 65
           M+ V +S  G   V+ +AE P P    E++LI+V+A GVNR DV+QRKG YP P   A  
Sbjct: 1   MKAVVISQPGAPEVLTVAERPTPTIGDEDVLIRVQAAGVNRADVIQRKGHYPAPAGVAAD 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLEVAG +   G   T W +GD VCAL+ GGGYAE+     GH LP+PKG++   AA+
Sbjct: 61  IPGLEVAGLVEACGAKVTRWQVGDPVCALLAGGGYAEFVAVDAGHCLPVPKGWSFTDAAA 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+ FTVW+N+FQ   L+ G+T L+HGG+SGIG  A+QLA   GA V+ TA ++EKC A
Sbjct: 121 LPEALFTVWSNVFQRGRLQRGETFLVHGGTSGIGMAAVQLAKAQGARVFATAGTDEKCRA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C  +GA+  INY  EDF   L+ E    G+D+ILDM+G +Y+ ++L LL  EG+L+ I+ 
Sbjct: 181 CEVVGAERCINYRTEDFAAALKDE----GVDVILDMIGGDYVAKNLKLLRPEGRLVFINA 236

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             G    E+NL  ++S+R+TITGSTLR R    K ++   ++L++WPLL S      +  
Sbjct: 237 AKGA-KVEVNLLQVMSQRLTITGSTLRSRERTFKAALAAEIELEVWPLLASGQFRANVFK 295

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
           V  L   A AH +ME S+HIGK++L
Sbjct: 296 VFALADAAEAHRLMESSQHIGKLVL 320


>gi|237747628|ref|ZP_04578108.1| NADPH2:quinone reductase [Oxalobacter formigenes OXCC13]
 gi|229378990|gb|EEO29081.1| NADPH2:quinone reductase [Oxalobacter formigenes OXCC13]
          Length = 326

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 218/324 (67%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +   G +  + + +  IP PQK E+L+KV A G+NRPDV+QR G Y  PK A  I
Sbjct: 1   MKAIEIINKGSAGYLQMTDREIPVPQKGEVLVKVHAAGINRPDVLQRIGRYVVPKGAPDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG+I+    + + + IGD VCALV GGGYAEYC++     LPIPKG  A++AASL
Sbjct: 61  PGLEIAGEIIGGDVSGSQFRIGDMVCALVQGGGYAEYCIAPVDLCLPIPKGLTAVEAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVW+N+F    L+  +T+L+  G+SGIG TAIQ+A   G  V+ TA++E+KC AC
Sbjct: 121 PETTFTVWSNVFDMGKLKGDETLLVQAGASGIGVTAIQMAKAMGHRVFATARTEDKCRAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            K+GA+  IN   E+F E ++  T G G+D+ILD++GA  L++ +  L+ EG+L++I++L
Sbjct: 181 EKIGAERCINSTTENFAEYIRAATNGNGVDVILDIIGAAVLDKEIDCLADEGRLVLIAYL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG + T ++L  I+ +++ +TGSTLR R++  K  I  +LQ  IWPL++   I PVI+ V
Sbjct: 241 GGRLGT-VDLAQIVHRQLMVTGSTLRPRSNEFKAEIARNLQKHIWPLIDEGKIKPVIYKV 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL    +A  +M+ + H GKI+L
Sbjct: 300 FPLADAMLAQKLMQSNTHFGKIVL 323


>gi|119385001|ref|YP_916057.1| alcohol dehydrogenase [Paracoccus denitrificans PD1222]
 gi|119374768|gb|ABL70361.1| Alcohol dehydrogenase, zinc-binding domain protein [Paracoccus
           denitrificans PD1222]
          Length = 325

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 214/324 (66%), Gaps = 5/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +S  G + V+     P+P     +ILI++   GVNRPDV+QR G Y PP  A+ +
Sbjct: 1   MQAIEISSPGSAEVLRPVTRPVPVAGHGQILIRIAWAGVNRPDVLQRAGSYAPPPGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG++  +G   T W  G++VCAL+ GGGYAEY      H LPIP+G     AA+L
Sbjct: 61  PGLECAGEVAAVGPGVTRWKPGEQVCALLPGGGYAEYATCPAEHALPIPQGLTLRMAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVW+N+     LR G+  L+HGGSSGIGT AIQ A   GA V+ TA S EKC AC
Sbjct: 121 PETAFTVWSNVVMRGGLRPGERFLVHGGSSGIGTMAIQTARALGARVWATAGSAEKCAAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            KLGA +AINY +EDF+ +L+K     G D+ILDMVG +Y+ +++  L+ +G+L +I+FL
Sbjct: 181 EKLGA-NAINYREEDFVAVLRKAG---GADLILDMVGGDYIARNIRCLADDGRLAMIAFL 236

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  A EIN   I+++R+++TGSTLR ++D+AK  I   LQ ++WPL+ +  + P+I + 
Sbjct: 237 AGPKA-EINFAQIMARRLSVTGSTLRPQSDLAKARIACELQERLWPLVEAGAVRPLIDST 295

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PLG+ A AH  ME S HIGKI+L
Sbjct: 296 FPLGEAAEAHRRMEGSNHIGKILL 319


>gi|221068615|ref|ZP_03544720.1| NAD(P)H quinone oxidoreductase, PIG3 family [Comamonas testosteroni
           KF-1]
 gi|220713638|gb|EED69006.1| NAD(P)H quinone oxidoreductase, PIG3 family [Comamonas testosteroni
           KF-1]
          Length = 341

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 216/327 (66%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++ YG  +V+ +   P+P   + E+LI+V A G+NRPDV+QRKG Y PP  A+ +
Sbjct: 12  MRAVEITSYGAPDVLRMGVRPMPVAAEGEVLIRVAASGINRPDVLQRKGHYAPPPGASDL 71

Query: 67  LGLEVAGKIVDLGENTTH---WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
            GLEVAG IV   E       + +GD VCALV GGGYA +C +     LP+P+G++ +QA
Sbjct: 72  PGLEVAGVIVAGDEAAMRKAGFKLGDRVCALVAGGGYASFCAAPVDQCLPVPEGFSDVQA 131

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A+LPE+FFTVW+N+F    L+ G+T+L+ GGSSGIG TAIQLA  +GATV  TA S+ KC
Sbjct: 132 AALPETFFTVWSNVFDRGALQPGETLLVQGGSSGIGVTAIQLAKAWGATVIVTAGSDAKC 191

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             CLKLGA HAINY   DF   +Q+ T G G+++ILDMV   Y+ + +  L+ +G+L+II
Sbjct: 192 DDCLKLGADHAINYKTRDFAAEVQRITAGEGVNVILDMVAGSYVAREVQCLAPDGRLVII 251

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           +  GG +  E +   ++ KR+T+TGSTLR R+   K +I ++L+  +WPLL S  + P I
Sbjct: 252 AVQGG-VKAEFDAGLVLRKRLTVTGSTLRPRSVAFKAAIAEALKRNVWPLLESGKVRPAI 310

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +        A AH +ME S+H GKI+L
Sbjct: 311 YREFDAADAAQAHALMESSQHTGKIVL 337


>gi|238894264|ref|YP_002918998.1| putative zinc-containing oxydoreductase [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238546580|dbj|BAH62931.1| putative zinc-containing oxydoreductase [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
          Length = 326

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 224/324 (69%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+++A+S  G   V+ + E  IP   + E+LI+V+A GVNRPD++QR+GLYP P+   P+
Sbjct: 1   MKYIAISQPGGPEVLQIREGEIPTIGEHEVLIEVKAAGVNRPDILQRQGLYPMPEGVTPV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +V +G   T +  GD VCAL NGGGYAEYC    G TLPIP G +  +AA++
Sbjct: 61  PGLEVAGVVVKVGAQVTAFMPGDRVCALTNGGGYAEYCAVPAGQTLPIPAGLSFSEAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWAN+FQ   L+ G+++L+HGG+SGIGTTA+QL    G TVY T   +EK +A 
Sbjct: 121 PETFFTVWANVFQLGKLQPGESILVHGGASGIGTTAVQLCHALGMTVYATVGQDEK-IAA 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L+  A  AINY  +DF E + + T   G+D+ILD+VG  Y N++L LL K+G+L+II F+
Sbjct: 180 LRPYAT-AINYKTDDFAEKIGQLTNDEGVDVILDIVGGPYFNRNLGLLKKDGRLVIIGFM 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG IA E+++  ++ KR T+TGST+R RT   KQ I ++L+  +WPLL +    P+I+  
Sbjct: 239 GGRIAHEVDIQTLMLKRATVTGSTMRGRTAAEKQQIAEALRRHVWPLLEAGKCKPLIYAS 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P+ ++A AH  ++  +H+GK+++
Sbjct: 299 YPMAEIAEAHACLDSGQHLGKVVI 322


>gi|254438608|ref|ZP_05052102.1| putative NAD(P)H quinone oxidoreductase, PIG3 family
           [Octadecabacter antarcticus 307]
 gi|198254054|gb|EDY78368.1| putative NAD(P)H quinone oxidoreductase, PIG3 family
           [Octadecabacter antarcticus 307]
          Length = 322

 Score =  309 bits (792), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 220/324 (67%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G   V+   ++P+P+P   ++ IKV   GVNRPD +QR G+Y PPK A+P+
Sbjct: 1   MKAVEIAKVGGPEVLVPIDAPMPEPAFGQVRIKVAYAGVNRPDALQRAGMYNPPKGASPL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG+I  +G   T W +GD VCAL+ GGGYAE  ++   H LP+P G    QAA L
Sbjct: 61  PGLEAAGEISAIGAGVTDWAVGDAVCALLPGGGYAEEVVTPAAHCLPVPDGLTLKQAACL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    L++G+  L+HGGSSGIGTTAIQLA+ FGA V+TTA S+ KC AC
Sbjct: 121 PETFFTVWSNVFMRGGLQAGERFLVHGGSSGIGTTAIQLANAFGARVFTTAGSDAKCRAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA+ A+NY + DF++ ++      G ++ILDM+G +YL +++  L  +G+L+ I+FL
Sbjct: 181 LDLGAEVAMNYREVDFVDDVKALG---GANLILDMIGGDYLPRNVRALCDDGRLVQIAFL 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    E+N   ++ +R+TITGSTLR ++D+AK  I   L+ ++WPLL+S  +APV+   
Sbjct: 238 QGP-KIELNFAHLMMRRLTITGSTLRPQSDLAKAEIARQLKAQVWPLLSSGKVAPVMDQE 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   + AH  ME SEHIGKI+L
Sbjct: 297 FALADASAAHARMESSEHIGKIVL 320


>gi|256424596|ref|YP_003125249.1| NAD(P)H quinone oxidoreductase, PIG3 family [Chitinophaga pinensis
           DSM 2588]
 gi|256039504|gb|ACU63048.1| NAD(P)H quinone oxidoreductase, PIG3 family [Chitinophaga pinensis
           DSM 2588]
          Length = 323

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 155/325 (47%), Positives = 215/325 (66%), Gaps = 6/325 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN-P 65
           M+   ++  G   V+   +   P P +EE+LI+V+A G+NR DV QR+G YPPP      
Sbjct: 1   MKAAVITQAGGPEVLQWKDYADPVPGREEVLIEVKAAGINRADVAQRQGKYPPPPGVTVD 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLEVAG ++  GE  T W  GD VCAL+ GGGYAE     +G  LP+P+GY+  +AA+
Sbjct: 61  IPGLEVAGVVISCGEGVTRWKAGDRVCALLAGGGYAEKVAVLEGQCLPVPEGYSFTEAAA 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+ +TVW+N+FQ   L+ G+T LIHGGSSGIG TAIQLA   G+ V  T  SE K +A
Sbjct: 121 LPEAIYTVWSNVFQRGRLQRGETFLIHGGSSGIGVTAIQLAHALGSRVIVTVGSEAKGVA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C +LGA   INY   DF + L  E     +D+ILDMVG EYL ++L +L +EG+L+ I+ 
Sbjct: 181 CTELGADRFINYKSSDFEQELADEK----VDVILDMVGGEYLPKNLRILREEGRLVYINT 236

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           +GGN  TE++L+ ++ KR++ITGSTLR R    K+++ + +   +WPLLN+    PVI++
Sbjct: 237 MGGN-RTELDLSLVMRKRLSITGSTLRGREYAYKKALTEDILEHVWPLLNTGQFKPVIYS 295

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
           + P  + A AH +ME SEHIGK+IL
Sbjct: 296 LFPFEEAAAAHRVMESSEHIGKLIL 320


>gi|91791776|ref|YP_561427.1| zinc-binding alcohol dehydrogenase [Shewanella denitrificans OS217]
 gi|91713778|gb|ABE53704.1| Alcohol dehydrogenase, zinc-binding [Shewanella denitrificans
           OS217]
          Length = 329

 Score =  309 bits (791), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 150/322 (46%), Positives = 221/322 (68%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           HV+ +  G ++VM  + + + QP   ++ IKV A GVN PD+ QR G YP P+ A+PILG
Sbjct: 6   HVSFTQPGNADVMTFSATNLAQPLAGQVQIKVYAAGVNGPDIKQRMGAYPAPEGASPILG 65

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEV+G+I  LGE  + W +GD+VCALV GGGY+E   +   H LPIP+G +  QAA+LPE
Sbjct: 66  LEVSGEICALGEGVSQWQLGDKVCALVPGGGYSERVNTFAAHCLPIPEGLSFEQAAALPE 125

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           + FTVW NLF  A L++G++VLIHGGS GIGTTAIQL S  GA V  T+ S++KC  CL+
Sbjct: 126 TLFTVWGNLFMRAGLKAGESVLIHGGSGGIGTTAIQLVSALGADVIVTSGSDDKCQYCLE 185

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
            GA+ AINY ++DF+E +   T+G+G++++LDM G +++NQ+L  L+ +G+++ ++   G
Sbjct: 186 QGARVAINYNQQDFVEPVLTATEGKGVNVVLDMAGGDFINQNLKALAMDGRMVSVAMQRG 245

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A ++++  I++KRIT TGSTLR ++  AK  I  +L   +WPL+ +  I+  + +V P
Sbjct: 246 PQA-QVDVFRIMAKRITWTGSTLRPQSVEAKAEIAKALMNTVWPLIAAAKISLPLDSVYP 304

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
             +V  AH  ME  +H GKI+L
Sbjct: 305 FSEVIAAHQRMESGQHKGKIVL 326


>gi|293603848|ref|ZP_06686263.1| NADPH:quinone reductase [Achromobacter piechaudii ATCC 43553]
 gi|292817685|gb|EFF76751.1| NADPH:quinone reductase [Achromobacter piechaudii ATCC 43553]
          Length = 325

 Score =  308 bits (790), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 150/324 (46%), Positives = 214/324 (66%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  V +S  G   V+   E P P+    E+LIKV A G+NRPDV QRKG Y PP+  + +
Sbjct: 1   MHAVEISRPGGPEVLVPVERPTPEAGAGEVLIKVSAAGINRPDVFQRKGNYAPPRGVSDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG+IV      + + +GD+VCALV GGGYAEYC++     LPIPKG + I AA L
Sbjct: 61  PGLEVAGEIVGGDVAGSGFAVGDKVCALVAGGGYAEYCVAPVAQCLPIPKGLSDIAAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVW+N+F    L  G+ +L+HGG+SGIGTTAIQLA   G  V+ T  S+++  A 
Sbjct: 121 PETYFTVWSNVFDRGRLSEGEILLVHGGASGIGTTAIQLARAMGNRVFATVGSDDRARAV 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+  INY   DF++ + + T GRG+D+ILDMV  +Y+ + +  L+ +G+++II+ L
Sbjct: 181 EALGAEKGINYKTHDFVKEVMEATDGRGVDVILDMVAGDYIARDMQCLADDGRIVIIAQL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG+ A +++ + ++ +R+TITGSTLR R    K +I  +L+ + WPLL    I P++H  
Sbjct: 241 GGSRA-DVDTSQVMRRRLTITGSTLRPRPVAFKGAIARALREQAWPLLEKGAIKPIVHAT 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + + AH +ME  E+IGKIIL
Sbjct: 300 FPLAEASKAHAMMEGGENIGKIIL 323


>gi|85714423|ref|ZP_01045411.1| Zinc-containing alcohol dehydrogenase superfamily protein
           [Nitrobacter sp. Nb-311A]
 gi|85698870|gb|EAQ36739.1| Zinc-containing alcohol dehydrogenase superfamily protein
           [Nitrobacter sp. Nb-311A]
          Length = 325

 Score =  308 bits (790), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 152/324 (46%), Positives = 212/324 (65%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +S  G   V+     P+P P   EILIKV   GVNRPD++QR G YPPP  A+ +
Sbjct: 1   MTAIGISKPGGPEVLVPEIRPVPLPGPNEILIKVAVAGVNRPDILQRSGHYPPPPGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG+I  LGE    + IGD+V +LV+GGGYA+YC++H+   +P+P G++ I+A + 
Sbjct: 61  PGLEVAGEIAALGEGADKYQIGDKVMSLVSGGGYAQYCVAHESIAMPVPLGFSMIEAGAT 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+  TVW N+F+   L+SG+T+LIHGGSSGIGT AIQLA  FGA    T  S EK  AC
Sbjct: 121 PETLMTVWHNVFERGALKSGETLLIHGGSSGIGTMAIQLARAFGARTIVTVGSREKADAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L+LGA HAINY  +DF+  +   T G G D+ILDMVG +Y+ ++    + EG+++ I+FL
Sbjct: 181 LRLGADHAINYRLQDFVAEVTAVTAGAGADLILDMVGGDYIEKNYDAAAIEGRIVQIAFL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG   T +N   ++ KR+  TGSTLR R+   K ++  +++ ++ PL+    I P+I + 
Sbjct: 241 GGA-KTTVNFARLMVKRLHHTGSTLRPRSVADKAAMVGAIEARVLPLMREGRIKPLIDSS 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL K A AH  ME S H+GKI+L
Sbjct: 300 FPLDKAAEAHRRMETSAHVGKIVL 323


>gi|148258154|ref|YP_001242739.1| putative NADPH quinone oxidoreductase [Bradyrhizobium sp. BTAi1]
 gi|146410327|gb|ABQ38833.1| putative NADPH quinone oxidoreductase [Bradyrhizobium sp. BTAi1]
          Length = 332

 Score =  308 bits (789), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 150/325 (46%), Positives = 216/325 (66%), Gaps = 1/325 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           +M  VA+S  G   V+     P+P+P   EILIKV+A GVNRPDV QR G YPPP  A+ 
Sbjct: 7   QMTVVAISKPGGPEVLQPETRPVPKPGPGEILIKVKAAGVNRPDVAQRSGSYPPPPGASD 66

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           + GLEVAG++V LG+      +GD V +LV GGGYAEYC++     + +P   + ++A +
Sbjct: 67  LPGLEVAGEVVALGDGAVRHRLGDHVMSLVAGGGYAEYCIAQDAQAMAVPSALSILEAGA 126

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+  TVW N+F+   L +G+T+L+HGGSSGIGT AIQLA  FGA V  T  S +K  A
Sbjct: 127 LPETLMTVWHNVFERGGLTAGETLLVHGGSSGIGTMAIQLAKAFGAKVLVTVGSPDKAAA 186

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C+KLGA  AINY  EDF+ ++++ T G+G ++ILDMVG +Y+ ++    + +G+++ I+F
Sbjct: 187 CVKLGADRAINYKTEDFVAVVKEATGGKGANVILDMVGGDYIERNYDAAATDGRIVQIAF 246

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           LG   AT +N   ++ KR+T TGSTLR R++  K ++  +++ K+ PLL    I P++ +
Sbjct: 247 LGSPKAT-VNFVKLMVKRLTHTGSTLRPRSNADKAAMVAAIEAKVMPLLREGRIKPLMDS 305

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL + A AH  ME S+HIGKI+L
Sbjct: 306 TFPLVEAAKAHARMETSQHIGKIVL 330


>gi|206577278|ref|YP_002239061.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Klebsiella
           pneumoniae 342]
 gi|206566336|gb|ACI08112.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Klebsiella
           pneumoniae 342]
          Length = 326

 Score =  308 bits (789), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 224/324 (69%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+++A+S  G   V+ + E  IP   + E+LI+V+A GVNRPD++QR+GLYP PK   P+
Sbjct: 1   MKYIAISQPGGPEVLQIREGEIPAIGENEVLIEVKAAGVNRPDILQRQGLYPMPKGVTPV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +V++G   T +  GD VCAL NGGGYAEYC    G TLPIP G +  +AA++
Sbjct: 61  PGLEVAGVVVEVGAQVTAFTPGDRVCALTNGGGYAEYCAVPAGQTLPIPAGLSFSEAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWAN+FQ   L+ G++VLIHGG+SGIGTTA+ L    G TVY T   +EK +A 
Sbjct: 121 PETFFTVWANVFQLGKLQPGESVLIHGGASGIGTTAVLLCHALGMTVYATVGQDEK-IAA 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L+  A  AINY  +DF E + + T   G+D+ILD+VG  Y N++L LL K+G+L+II F+
Sbjct: 180 LRPYAT-AINYKADDFAEKIGQLTNDEGVDVILDIVGGPYFNRNLGLLKKDGRLVIIGFM 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG IA E+++  ++ KR T+TGST+R RT   KQ I ++L+  +WPLL +    P+I+  
Sbjct: 239 GGRIAHEVDIQTLMLKRATVTGSTMRGRTAAEKQEIAEALRRHVWPLLEAGKCKPLIYAS 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P+ ++A AH  ++  +H+GK+++
Sbjct: 299 YPMAEIAEAHACLDSGQHLGKVVI 322


>gi|238751733|ref|ZP_04613221.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           rohdei ATCC 43380]
 gi|238710004|gb|EEQ02234.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           rohdei ATCC 43380]
          Length = 336

 Score =  308 bits (789), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 210/316 (66%), Gaps = 2/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+   + PIP P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I GLE+AG +
Sbjct: 20  GGPEVLVPVKRPIPIPADGEILVKVTAAGVNRPDVMQRRGQYAPPPGASDIPGLEIAGVV 79

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V    N + + +GD+VC L+ GGGYA+YC+ H+ + L IP     I+AA+LPE+FFTVWA
Sbjct: 80  VASASNVSRFKVGDKVCGLIAGGGYAQYCVIHETNALLIPASLTDIEAAALPETFFTVWA 139

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHA 194
           NLFQ  +L +G+TVLIHGGSSGIGTTA+ L+  FGA TV  T  SEEK  ACL LGA  A
Sbjct: 140 NLFQRGHLTAGETVLIHGGSSGIGTTAVLLSKAFGAKTVIVTVGSEEKRQACLALGADIA 199

Query: 195 INYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEI 254
           INY  EDF++  ++ T  +G D+I+D++  +Y+ ++    +  G+++ I    G+ A ++
Sbjct: 200 INYHTEDFVDETKRATADKGADVIVDLIAGDYVARNYEAAAMNGRIVQIGTQHGS-AKDL 258

Query: 255 NLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAM 314
           NL  ++ KR+T TGSTLR R+   K  I   L+ ++WPLL  H I P I    PL K A 
Sbjct: 259 NLMLMLLKRLTHTGSTLRSRSVAEKALIAKELEQQVWPLLGEHKIKPQIFQTFPLEKAAK 318

Query: 315 AHDIMEKSEHIGKIIL 330
           AH++ME S HIGKI+L
Sbjct: 319 AHELMESSAHIGKIVL 334


>gi|90416388|ref|ZP_01224320.1| quinone oxidoreductase [marine gamma proteobacterium HTCC2207]
 gi|90332113|gb|EAS47327.1| quinone oxidoreductase [marine gamma proteobacterium HTCC2207]
          Length = 334

 Score =  308 bits (789), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 147/315 (46%), Positives = 212/315 (67%), Gaps = 2/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+  +   +P P   ++LI+V A G+NRPDV QR G YPPP     I GLEV+G +
Sbjct: 20  GGPEVLKPSSRAVPAPADNQLLIQVAAAGINRPDVFQRMGFYPPPPGVTDIPGLEVSGTV 79

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V LG   T W IGD+VCAL++GGGYAEY ++ +   LPIP+G +   AA+LPE+ FTVW 
Sbjct: 80  VALGAGVTDWAIGDQVCALLSGGGYAEYAIAEESLCLPIPEGLDLEDAAALPETCFTVWH 139

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLF+ A L++G+ +L+HGGSSGIGTTAIQ+A+  G  V TTA SEEKC  C +LGA  A+
Sbjct: 140 NLFERAELKAGEWLLVHGGSSGIGTTAIQMATAMGVNVITTAGSEEKCAVCEELGAVKAV 199

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY ++DF+E+ Q E  G G++++LDMVG +Y+ ++    + + +++ I+FL G+  TE++
Sbjct: 200 NYNQQDFVEVCQ-ELTGNGVNVVLDMVGGDYMQRNFNACAPQARIVSIAFLRGS-KTELD 257

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L P++ K+I +TGSTLR +    K  I   ++ ++WPL+      PV+H+   L +    
Sbjct: 258 LLPLMLKQIVLTGSTLRAQPLENKARIAAGVESQVWPLIAEGKFKPVVHSRFALAEANKG 317

Query: 316 HDIMEKSEHIGKIIL 330
           H +ME S+HIGKIIL
Sbjct: 318 HALMESSQHIGKIIL 332


>gi|113867067|ref|YP_725556.1| putative Zn-dependent oxidoreductase [Ralstonia eutropha H16]
 gi|113525843|emb|CAJ92188.1| Putative Zn-dependent oxidoreductase [Ralstonia eutropha H16]
          Length = 334

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 163/333 (48%), Positives = 212/333 (63%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +  YG   V+ L E P P     E+LI+V A GVNRPDV QR G YP P  A+ +
Sbjct: 1   MQAIEIREYGAPEVLQLTERPDPVAGAGEVLIRVAAAGVNRPDVFQRTGNYPVPPGASDL 60

Query: 67  LGLEVAGKIV--DL--GENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG +V  DL   +N     +GD VCALV GGGYA+ C +     LP P+G + I+
Sbjct: 61  PGLEVAGVVVGGDLSHADNRFGLKVGDRVCALVQGGGYAQLCTAPLAQVLPAPQGLSDIE 120

Query: 123 AASLPESFFTVWANLFQTANLRSG-----QTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
           AA+LPE+FFTVW+N+F    L  G     +T+LI GGSSGIGTTAIQ+A   G  V+ TA
Sbjct: 121 AAALPETFFTVWSNVFDRGCLGQGPRGKDETLLIQGGSSGIGTTAIQIAKALGYKVFVTA 180

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            ++EKC AC  LGA  AINY  +DF+  +   T G G+D+ILDMV   YL + L  ++ +
Sbjct: 181 GTDEKCKACEDLGADRAINYKTQDFVAEVSALTGGNGVDVILDMVAGPYLARELKCIADD 240

Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           G+++II+ LGG  A EI L  I+ +RIT+TGSTLR R    K  I  +L  ++WPLL + 
Sbjct: 241 GRIVIIALLGGAKA-EIPLGDILRRRITVTGSTLRPRPASFKGKIAAALHEQVWPLLAAG 299

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            I PVIH V P  + A AH +ME SEHIGKI+L
Sbjct: 300 RIKPVIHEVFPAAQAADAHRLMESSEHIGKIVL 332


>gi|152969763|ref|YP_001334872.1| zinc-containing alcohol dehydrogenase superfamily protein
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|262043074|ref|ZP_06016214.1| NADPH:quinone reductase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330012561|ref|ZP_08307424.1| NAD(P)H quinone oxidoreductase, PIG3 family [Klebsiella sp. MS
           92-3]
 gi|150954612|gb|ABR76642.1| putative zinc-containing alcohol dehydrogenase superfamily
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|259039562|gb|EEW40693.1| NADPH:quinone reductase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328533772|gb|EGF60459.1| NAD(P)H quinone oxidoreductase, PIG3 family [Klebsiella sp. MS
           92-3]
          Length = 326

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 223/324 (68%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+++A+S  G   V+ + E  IP   + E+LI+V+A GVNRPD++QR+GLYP P+   P+
Sbjct: 1   MKYIAISQPGGPEVLQIREGEIPTIGEHEVLIEVKAAGVNRPDILQRQGLYPMPEGVTPV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +V +G   T +  GD VCAL NGGGYAEYC    G TLPIP G +  +AA++
Sbjct: 61  PGLEVAGVVVKVGAQVTAFTPGDRVCALTNGGGYAEYCAVPAGQTLPIPAGLSFSEAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWAN+FQ   L+ G+++L+HGG+SGIGTTA+ L    G TVY T   +EK +A 
Sbjct: 121 PETFFTVWANVFQLGKLQPGESILVHGGASGIGTTAVLLCHALGMTVYATVGQDEK-IAA 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L+  A  AINY  +DF E + + T   G+D+ILD+VG  Y N++L LL K+G+L+II F+
Sbjct: 180 LRPYAT-AINYKTDDFAEKIGQLTNDEGVDVILDIVGGPYFNRNLGLLKKDGRLVIIGFM 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG IA E+++  ++ KR T+TGST+R RT   KQ I ++L+  +WPLL +    P+I+  
Sbjct: 239 GGRIAHEVDIQTLMLKRATVTGSTMRGRTAAEKQQIAEALRRHVWPLLEAGKCKPLIYAS 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P+ ++A AH  ++  +H+GK+++
Sbjct: 299 YPMAEIAEAHACLDSGQHLGKVVI 322


>gi|163740339|ref|ZP_02147733.1| alcohol dehydrogenase, zinc-containing [Phaeobacter gallaeciensis
           2.10]
 gi|161386197|gb|EDQ10572.1| alcohol dehydrogenase, zinc-containing [Phaeobacter gallaeciensis
           2.10]
          Length = 330

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 152/324 (46%), Positives = 218/324 (67%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +   G  +V+   + P+P P   ++++KV   GVNRPD +QR G Y PP  A+ +
Sbjct: 5   MRAIEIQEPGGPSVLQACQRPVPIPGHGQVVLKVAYAGVNRPDALQRAGKYAPPPTASDL 64

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G++V +G   +   +GD VCAL+ GGGYAEY  +   H LP+P G +  QAA L
Sbjct: 65  PGLEASGEVVAIGAGVSELTVGDRVCALLPGGGYAEYVATPAAHCLPVPAGLSMKQAACL 124

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVW+N+F    L++G+  L+HGGSSGIGTTAIQLAS  GA V+TTA S+EKC AC
Sbjct: 125 PETCFTVWSNVFTRGGLQAGERFLVHGGSSGIGTTAIQLASQLGARVFTTAGSDEKCAAC 184

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           LKLGA+ AINY  EDF+E+L+ E    G ++ILDMVG +Y+ +++  L+ +G+++ I+FL
Sbjct: 185 LKLGAERAINYRDEDFVEVLKSEG---GANLILDMVGGDYIPRNVRALADDGRMVHIAFL 241

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    E+N   ++++R+T+TGSTLR ++D+AK  I   L+  +WPL+ +   APV+   
Sbjct: 242 SGP-KVELNFAQVMARRLTLTGSTLRPQSDLAKAQIARDLREVVWPLIEAGKFAPVMDQT 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L + A AH  ME S HIGKI+L
Sbjct: 301 FALEEAAAAHARMESSAHIGKIVL 324


>gi|288935963|ref|YP_003440022.1| NAD(P)H quinone oxidoreductase, PIG3 family [Klebsiella variicola
           At-22]
 gi|288890672|gb|ADC58990.1| NAD(P)H quinone oxidoreductase, PIG3 family [Klebsiella variicola
           At-22]
          Length = 326

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 224/324 (69%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+++A+S  G   V+ + E  IP   + E+LI+V+A GVNRPD++QR+GLYP PK   P+
Sbjct: 1   MKYIAISQPGGPEVLQIREGEIPAIGENEVLIEVKAAGVNRPDILQRQGLYPMPKGVTPV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +V++G   T +  GD VCAL NGGGYAEYC    G TLPIP G +  +AA++
Sbjct: 61  PGLEVAGVVVEVGAQVTAFTPGDRVCALTNGGGYAEYCAVPAGQTLPIPAGLSFSEAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWAN+FQ   L+ G+++LIHGG+SGIGTTA+ L    G TVY T   +EK +A 
Sbjct: 121 PETFFTVWANVFQLGKLQPGESILIHGGASGIGTTAVLLCHALGMTVYATVGQDEK-IAA 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L+  A  AINY  +DF E + + T   G+D+ILD+VG  Y N++L +L K+G+L+II F+
Sbjct: 180 LRPYAT-AINYKTDDFAEKIGQLTHDEGVDVILDIVGGPYFNRNLGILKKDGRLVIIGFM 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG IA E+++  ++ KR TITGST+R RT   KQ I ++L+  +WPLL +    P+I+  
Sbjct: 239 GGRIAHEVDIQTLMLKRATITGSTMRGRTAAEKQEIAEALRRHVWPLLEAGKCKPMIYAS 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P+ +VA AH  ++  +H+GK+++
Sbjct: 299 YPMAEVAEAHACLDSGQHLGKVVI 322


>gi|163737251|ref|ZP_02144669.1| Alcohol dehydrogenase, zinc-binding protein [Phaeobacter
           gallaeciensis BS107]
 gi|161389855|gb|EDQ14206.1| Alcohol dehydrogenase, zinc-binding protein [Phaeobacter
           gallaeciensis BS107]
          Length = 330

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 152/324 (46%), Positives = 217/324 (66%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +   G  +V+   + P+P P   ++++KV   GVNRPD +QR G Y PP  A+ +
Sbjct: 5   MRAIEIQEPGGPSVLQACQRPVPSPGHGQVVLKVAYAGVNRPDALQRAGKYAPPPTASDL 64

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G++V +G   +   +GD VCAL+ GGGYAEY  +   H LP+P G +  QAA L
Sbjct: 65  PGLEASGEVVAIGAGVSELTVGDRVCALLPGGGYAEYVATPAAHCLPVPAGLSMKQAACL 124

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVW+N+F    L++G+  L+HGGSSGIGTTAIQLAS  GA V+TTA S+EKC  C
Sbjct: 125 PETCFTVWSNVFTRGGLQAGERFLVHGGSSGIGTTAIQLASQLGARVFTTAGSDEKCAVC 184

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           LKLGA+ AINY  EDF+E+L+ E    G ++ILDMVG +Y+ +++  L+ +G+++ I+FL
Sbjct: 185 LKLGAERAINYRDEDFVEVLKTEG---GANLILDMVGGDYIPRNVRALADDGRMVHIAFL 241

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    E+N   I+++R+T+TGSTLR ++D+AK  I   L+  +WPL+ +   APV+   
Sbjct: 242 SGP-KVELNFAQIMARRLTLTGSTLRPQSDLAKAQIAQDLREVVWPLIEAGKFAPVMDQT 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L + A AH  ME S HIGKI+L
Sbjct: 301 FALEEAAAAHARMESSAHIGKIVL 324


>gi|170749371|ref|YP_001755631.1| PIG3 family NAD(P)H quinone oxidoreductase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655893|gb|ACB24948.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 337

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 212/325 (65%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
            MR +  +G G   V+ L  +P+P P   ++LI+V A GVNRPDV QR G+YPPP  A  
Sbjct: 9   SMRQIRYAGSGGPEVISLETAPVPSPGPGQVLIEVVAAGVNRPDVAQRSGVYPPPPGATE 68

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLEVAG++V LG    +   GDEVCALV  GGYAEY ++   H LP PK    + A  
Sbjct: 69  IPGLEVAGRVVALGSGVENLTEGDEVCALVISGGYAEYAVAEAAHCLPRPKAVALVDAGG 128

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+FFTV++N+ Q   L  G++ L+HGGSSGIG TAIQ+A + GA V+ TA S EKC  
Sbjct: 129 LPETFFTVYSNVVQRGRLARGESFLVHGGSSGIGATAIQIAKHVGARVFATAGSTEKCRF 188

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C  LGA  AI+Y + DF E +++ T+GRG+D+ILDM+GA YL ++L  L+ +G+L++I+ 
Sbjct: 189 CEDLGADAAIDYKQADFAEEVKRLTEGRGVDVILDMIGASYLARNLKSLAPDGRLVMIAL 248

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           +GG     +N+ PI+  R+T TGSTLR R    K +I D L+  IWP L +  I  V H 
Sbjct: 249 MGGYKVDGLNITPIMRNRLTFTGSTLRPRAKADKAAIADGLRRDIWPELEAGRIRSVTHA 308

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL +   AH++ME S H+GKI+L
Sbjct: 309 TFPLERAREAHELMESSAHLGKILL 333


>gi|238795031|ref|ZP_04638625.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           intermedia ATCC 29909]
 gi|238725632|gb|EEQ17192.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           intermedia ATCC 29909]
          Length = 326

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 153/325 (47%), Positives = 213/325 (65%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G   V+   + P P P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 1   MVAIEITQSGGPEVLAAVQRPTPMPAAGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG++V +  + + + IGD VC L+ GGGYA+YC+ H+ + LPIP     I+A++L
Sbjct: 61  PGLEVAGEVVAIAADVSRFKIGDRVCGLIAGGGYAQYCVIHETNALPIPANLTDIEASAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLA 185
           PE+FFTVW NLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FGA TV  T  SEEK  A
Sbjct: 121 PETFFTVWTNLFQRGHFSAGETVLIHGGSSGIGTTAILLSKAFGAQTVIVTVGSEEKRQA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CLKLGA  AINY  +DF+   ++ T G+G D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 181 CLKLGADVAINYHTQDFVAETKRVTVGKGADVIVDLIAGDYVERNYEAAAMNGRIVQIGT 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             GN A ++NL  ++ KR+T TGSTLR R+   K  I   L+ ++WP+L    + P I  
Sbjct: 241 QNGN-AKDLNLMLMLLKRLTHTGSTLRSRSVAEKALIAQELEQQVWPMLGKGNMKPQICQ 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL + + AH++ME S HIGKI+L
Sbjct: 300 TFPLAEASKAHELMESSTHIGKIVL 324


>gi|290512769|ref|ZP_06552134.1| NADPH2:quinone reductase [Klebsiella sp. 1_1_55]
 gi|289774652|gb|EFD82655.1| NADPH2:quinone reductase [Klebsiella sp. 1_1_55]
          Length = 326

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 223/324 (68%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+++A+S  G   V+ + E  IP   + E+LI V+A GVNRPD++QR+GLYP PK   P+
Sbjct: 1   MKYIAISQPGGPEVLQIREGEIPAIGENEVLIAVKAAGVNRPDILQRQGLYPMPKGVTPV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +V++G   T +  GD VCAL NGGGYAEYC    G TLPIP G +  +AA++
Sbjct: 61  PGLEVAGVVVEVGAQVTAFAPGDRVCALTNGGGYAEYCAVPAGQTLPIPAGLSFSEAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWAN+FQ   L+ G+++LIHGG+SGIGTTA+ L    G TVY T   +EK +A 
Sbjct: 121 PETFFTVWANVFQLGKLQPGESILIHGGASGIGTTAVLLCHALGMTVYATVGQDEK-IAA 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L+  A  AINY  +DF E + + T   G+D+ILD+VG  Y N++L +L K+G+L+II F+
Sbjct: 180 LRPYAT-AINYKTDDFAEKISQLTHDEGVDVILDIVGGPYFNRNLGILKKDGRLVIIGFM 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG IA E+++  ++ KR TITGST+R RT   KQ I ++L+  +WPLL +    P+I+  
Sbjct: 239 GGRIAHEVDIQTLMLKRATITGSTMRGRTAAEKQEIAEALRRHVWPLLEAGKCKPMIYAS 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P+ +VA AH  ++  +H+GK+++
Sbjct: 299 YPMAEVAEAHACLDSGQHLGKVVI 322


>gi|167836046|ref|ZP_02462929.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Burkholderia thailandensis MSMB43]
          Length = 339

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 159/334 (47%), Positives = 220/334 (65%), Gaps = 11/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ +G  +V+ L E P P+P++ E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MKAIEITEFGAPDVLKLTERPQPEPKRGEVLIKVAASGVNRPDVFQRKGAYAPPPGASDL 60

Query: 67  LGLEVAGKIV-----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            GLEVAG IV     D   N     +GD VCAL+ GGGYA+Y  +     LP PKG   +
Sbjct: 61  PGLEVAGVIVGGDLSDPAANPFGLKLGDRVCALLAGGGYAQYVAAPLAQCLPAPKGLTDV 120

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           +AASLPE+FFTVW+N+F  A L +G+     T+L+ GGSSGIG  AIQ+A   G  V+ T
Sbjct: 121 EAASLPETFFTVWSNVFDRAQLGAGEGGAQETLLVQGGSSGIGVAAIQIAHALGFRVFAT 180

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A +++KC AC  LGA+ AINY  EDF+E+++  T  RG+D+ILDMV   Y+ + LT L+ 
Sbjct: 181 AGTDDKCRACETLGAERAINYKTEDFVEVVKSLTHDRGVDVILDMVAGAYVPRELTALAD 240

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G+L++I+ LGG   +EIN+  I+ +R+TITGSTLR R    K  I   L+ ++WPL+  
Sbjct: 241 GGRLVVIALLGGA-KSEINVAEILRRRLTITGSTLRPRPVEFKARIAAQLKARVWPLIEG 299

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + PV++  LP  + A AH +ME SEH+GKI+L
Sbjct: 300 GRVKPVVYRALPAAQAADAHALMESSEHVGKIVL 333


>gi|27376614|ref|NP_768143.1| quinone oxidoreductase [Bradyrhizobium japonicum USDA 110]
 gi|27349755|dbj|BAC46768.1| quinone oxidoreductase [Bradyrhizobium japonicum USDA 110]
          Length = 332

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 148/325 (45%), Positives = 216/325 (66%), Gaps = 1/325 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           +M  VA+S  G   V+   +  +PQP  +EIL+KV+A GVNRPDV QR G YPPP  A+ 
Sbjct: 7   QMTVVAISKPGGPEVLVPEQRALPQPGPDEILVKVQAAGVNRPDVAQRSGAYPPPPGASD 66

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           + GLE+AG++V +G N     IGD+V +LV GGGYA+YC++     + +P   +  +A +
Sbjct: 67  LPGLEIAGEVVAVGGNAKRHKIGDKVMSLVAGGGYAQYCIAQDAQAMSVPPALSIKEAGA 126

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+  TVW N+F+   L++G+T+LIHGGSSGIGT AIQLA  FGA V+ T  S++K  A
Sbjct: 127 LPETLMTVWHNVFERGGLKAGETLLIHGGSSGIGTMAIQLAKAFGAKVFVTVGSQDKIDA 186

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CLKLGA  AINY  EDF+ +++ ET   G+++ILDMV  EY++++    + +G+++ I+ 
Sbjct: 187 CLKLGADRAINYKTEDFVAVVKTETGNAGVNLILDMVAGEYVDRNYDAAAVDGRIVQIAT 246

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           L G     +N+  ++ KR+T TGSTLR R++  K ++  +++ K+ PLL    + PV+ +
Sbjct: 247 LNGP-KVSVNIAKVMVKRLTHTGSTLRPRSNADKAAMVAAIEAKVMPLLREGRVKPVMDS 305

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL K A AH  ME S HIGKI+L
Sbjct: 306 AFPLEKAADAHRRMETSAHIGKIVL 330


>gi|238795659|ref|ZP_04639173.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           mollaretii ATCC 43969]
 gi|238720385|gb|EEQ12187.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           mollaretii ATCC 43969]
          Length = 336

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 155/325 (47%), Positives = 211/325 (64%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G   V+     P P P   EILIKV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 11  MVAIEITQSGGPEVLLPITRPTPMPASGEILIKVSAAGVNRPDVMQRRGQYAPPSGASDI 70

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG++V    + + + IGD VC L+ GGGYA+YC+ H+ + LPIP     I+AA+L
Sbjct: 71  PGLEVAGEVVATAADVSRFKIGDRVCGLIAGGGYAQYCVIHETNALPIPDSLTDIEAAAL 130

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLA 185
           PE+FFTVW NLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FGA TV  T  SEEK  A
Sbjct: 131 PETFFTVWTNLFQRGHFTAGETVLIHGGSSGIGTTAILLSKAFGAKTVIVTVGSEEKRQA 190

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA  AINY  +DF+   ++ T G+G D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 191 CLALGADVAINYHTQDFVAETKRATSGKGADVIVDLIAGDYVARNYEAAAMNGRIVQIGT 250

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             G+ A ++NL  ++ KR+T TGSTLR R+   K  I   L+ ++WPLL+   + P I  
Sbjct: 251 QNGH-AKDLNLMLMLLKRLTHTGSTLRSRSVAEKALIAKELEQQVWPLLSESKMKPQIFR 309

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL + A AH++ME S HIGKI+L
Sbjct: 310 TFPLEEAAKAHELMEGSTHIGKIVL 334


>gi|304411277|ref|ZP_07392892.1| NAD(P)H quinone oxidoreductase, PIG3 family [Shewanella baltica
           OS183]
 gi|307306560|ref|ZP_07586303.1| NAD(P)H quinone oxidoreductase, PIG3 family [Shewanella baltica
           BA175]
 gi|304350470|gb|EFM14873.1| NAD(P)H quinone oxidoreductase, PIG3 family [Shewanella baltica
           OS183]
 gi|306910851|gb|EFN41279.1| NAD(P)H quinone oxidoreductase, PIG3 family [Shewanella baltica
           BA175]
          Length = 333

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 216/322 (67%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           H+ +   G   VM L+ SP+P P   ++LI+V A GVN PDV QR G YPPP  A+PI+G
Sbjct: 10  HIHVEQPGTPEVMQLSRSPLPVPAAGQVLIRVHAAGVNGPDVKQRVGAYPPPPGASPIIG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG I  LGE  + W IGD+VCALV GGGY EY L++  H LPIP G++ +QAA+LPE
Sbjct: 70  LEVAGDICALGEGVSQWQIGDKVCALVPGGGYGEYALTYAAHCLPIPTGFSYVQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW NLF  A L++G+TVLIHGGS GIG+TAIQLAS  G+ V  T   +EK   CL 
Sbjct: 130 TFFTVWGNLFMRAGLKAGETVLIHGGSGGIGSTAIQLASALGSKVIATTGQDEKRDYCLS 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA   INY   +F+E +   TQ +G++++ D+ G +++N  L  L+ +G+++ ++   G
Sbjct: 190 LGAAEVINYRTHNFVEPVMALTQDKGVNVVFDIAGGDFINLDLQALALDGRMVSVAMQRG 249

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+ +  +++KRI  TGSTLR ++  AK +I   L  K+WPLLN+H I P I    P
Sbjct: 250 PKA-EVEIFRLMAKRIMWTGSTLRPQSVEAKAAIAAELFEKVWPLLNAHKIVPNIFATFP 308

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           LG+ A AH +ME  EH GK++L
Sbjct: 309 LGEAAKAHALMESGEHRGKVVL 330


>gi|90422310|ref|YP_530680.1| zinc-binding alcohol dehydrogenase [Rhodopseudomonas palustris
           BisB18]
 gi|90104324|gb|ABD86361.1| Alcohol dehydrogenase, zinc-binding [Rhodopseudomonas palustris
           BisB18]
          Length = 332

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 148/329 (44%), Positives = 215/329 (65%), Gaps = 1/329 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           PI  +M  + +S  G   V+     P+P P   EIL+KV+A GVNRPDV QR G+YPPP 
Sbjct: 3   PIPSQMTVIGISKPGGPEVLLPETRPVPTPGPGEILVKVQAAGVNRPDVAQRAGVYPPPP 62

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A+ + GLEVAG++V LGE  +   +GD V +LV GGGYA YC++     + +P G + I
Sbjct: 63  GASDLPGLEVAGQVVGLGEGASRHKLGDSVMSLVAGGGYAPYCIAQDAQAMAVPIGLSII 122

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
           +A + PE+  TVW N+F+   L+ G+T+LIHGGSSGIGT AIQLA  FG+ V  T  S +
Sbjct: 123 EAGATPETLMTVWHNVFERGGLKPGETLLIHGGSSGIGTMAIQLAKAFGSKVIVTVGSND 182

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           K  AC+K+GA  AI+Y  EDF+ I+++ T+G G D+ILDMVG +Y+ ++    + +G+++
Sbjct: 183 KAAACVKIGADRAIDYKAEDFVAIVKEFTEGHGADVILDMVGGDYIEKNYDAAAIDGRIV 242

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I+FL G  AT +N   ++ KR+  TGSTLR R++  K ++  +++ K+ PL  +  + P
Sbjct: 243 QIAFLHGPKAT-VNFVKLMMKRLQHTGSTLRPRSNADKAAMVAAIEAKVLPLFAAGQVKP 301

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +I    PL + A AH  ME S+HIGKI+L
Sbjct: 302 LIDGTFPLAEAAEAHRRMESSQHIGKIVL 330


>gi|255037072|ref|YP_003087693.1| NAD(P)H quinone oxidoreductase, PIG3 family [Dyadobacter fermentans
           DSM 18053]
 gi|254949828|gb|ACT94528.1| NAD(P)H quinone oxidoreductase, PIG3 family [Dyadobacter fermentans
           DSM 18053]
          Length = 334

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 162/334 (48%), Positives = 213/334 (63%), Gaps = 13/334 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNA-NP 65
           M+ + ++  G   V+ + E  +P P   ++ IKV A GVNRPDV QRKG YPPP +A   
Sbjct: 1   MKAIVITQPGGPEVLQMQEVAMPHPTGSQVRIKVFAAGVNRPDVFQRKGNYPPPPDAPQD 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI---- 121
           I GLEVAG I   G   T W  GD VCAL+ GGGYAEY L+   H LPIP  +N      
Sbjct: 61  IPGLEVAGIIDQTGPEVTIWKPGDSVCALLAGGGYAEYALAEASHCLPIPVAFNHYSDAF 120

Query: 122 -QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            +AASLPE+ FTVW N+FQ   LR G+  L+HGG+SGIG TAIQLA  FGA+V+TTA SE
Sbjct: 121 ARAASLPETVFTVWHNVFQRGRLRKGERFLVHGGTSGIGITAIQLARAFGASVFTTAGSE 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC  LGA  +INY + DF E L++     G D+ILDMVG  Y+ ++L LL +EG+L
Sbjct: 181 EKCAACDALGADISINYREADFEEQLRE----LGTDVILDMVGGNYIPKNLRLLREEGRL 236

Query: 241 IIISFL-GGNIATE--INLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297
           + I+ + GG +  E  ++ + I+ KR+T+TGSTLR R    K ++   ++  +WP++   
Sbjct: 237 VFINTMKGGKVTGEDVVDFSLIMRKRLTVTGSTLRNRDHAFKAALAHEIRENVWPVMERG 296

Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
               VI    PL + A AH +ME S+HIGKIILL
Sbjct: 297 AFQTVIAETFPLAEAARAHALMESSDHIGKIILL 330


>gi|238785471|ref|ZP_04629455.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           bercovieri ATCC 43970]
 gi|238713626|gb|EEQ05654.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           bercovieri ATCC 43970]
          Length = 336

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 212/325 (65%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G   V+     PIP P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 11  MVAIEIAQSGGPEVLVSVTRPIPMPVSGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDI 70

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG++V    + + + IGD VC L+ GGGYA+YC+ H+ + L IP     I+AA+L
Sbjct: 71  PGLEVAGEVVATAADISRFKIGDRVCGLIAGGGYAQYCVIHETNALQIPDSLTDIEAAAL 130

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLA 185
           PE+FFTVW NLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FGA TV  T  SEEK  A
Sbjct: 131 PETFFTVWTNLFQRGHFTAGETVLIHGGSSGIGTTAILLSKAFGAKTVIVTVGSEEKQQA 190

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA  AINY  +DF+   ++ T G+G+D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 191 CLTLGADIAINYHTQDFVAETKRATSGKGVDVIVDLIAGDYVARNYEAAAMNGRIVQIGT 250

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             GN+  ++NL  ++ KR+T TGSTLR R+   K  I   L+ ++WPLL+   I P I  
Sbjct: 251 QNGNV-KDLNLMLMLLKRLTHTGSTLRSRSVAEKALIAKELEQQVWPLLSESKIKPQIFR 309

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL + + AH++ME S HIGKI+L
Sbjct: 310 TFPLEEASKAHELMEGSTHIGKIVL 334


>gi|152999174|ref|YP_001364855.1| quinone oxidoreductase putative PIG3 [Shewanella baltica OS185]
 gi|151363792|gb|ABS06792.1| Quinone oxidoreductase putative PIG3 [Shewanella baltica OS185]
          Length = 333

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 216/322 (67%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           H+ +   G   VM L+ SP+P P   ++LI+V A GVN PDV QR G YPPP  A+PI+G
Sbjct: 10  HIHVEQPGAPEVMQLSRSPLPVPAAGQVLIRVHAAGVNGPDVKQRVGAYPPPPGASPIIG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG I  LG+  + W IGD+VCALV GGGY EY L++  H LPIP G++ +QAA+LPE
Sbjct: 70  LEVAGDICALGDGVSQWQIGDKVCALVPGGGYGEYALTYAAHCLPIPTGFSYVQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW NLF  A L++G+TVLIHGGS GIG+TAIQLAS  G+ V  T   +EK   CL 
Sbjct: 130 TFFTVWGNLFMRAGLKAGETVLIHGGSGGIGSTAIQLASALGSKVIATTGQDEKRDYCLS 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA   INY   +F+E +   TQ +G++++ D+ G +++N  L  L+ +G+++ ++   G
Sbjct: 190 LGAAEVINYRTHNFVEPVMALTQDKGVNVVFDIAGGDFINLDLQALAMDGRMVSVAMQRG 249

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+ +  +++KRI  TGSTLR ++  AK +I   L  K+WPLLN+H I P I    P
Sbjct: 250 PKA-EVEIFRLMAKRIMWTGSTLRPQSVEAKAAIAAELFEKVWPLLNAHKIVPNIFATFP 308

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           LG+ A AH +ME  EH GK++L
Sbjct: 309 LGEAAKAHALMESGEHRGKVVL 330


>gi|159042804|ref|YP_001531598.1| quinone oxidoreductase putative PIG3 [Dinoroseobacter shibae DFL
           12]
 gi|157910564|gb|ABV91997.1| quinone oxidoreductase putative PIG3 [Dinoroseobacter shibae DFL
           12]
          Length = 328

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 154/330 (46%), Positives = 212/330 (64%), Gaps = 4/330 (1%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + + MR V ++  G   V+     P+P P   +ILIKV   GVNRPD +QR G Y PP
Sbjct: 1   MTLPETMRAVEITEPGGPEVLRPCTRPMPVPGAGQILIKVAYAGVNRPDALQRAGSYAPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+ + GLEVAG++V  G +   W +GD+VCAL  GGGYAEY +    H LP+P G   
Sbjct: 61  PTASDLPGLEVAGEVVATGPDVARWAVGDQVCALTPGGGYAEYVVCPAAHALPVPDGMPL 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA+L E+ +TVW+N+     L  G+  L+HGGSSGIGT AIQLA   GA V+ TA S 
Sbjct: 121 DQAAALCENHYTVWSNVVTRGGLTGGERFLVHGGSSGIGTVAIQLAHALGARVFATAGSA 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
            KC AC+ LGA+ AINY +EDF+ +LQ E    G ++ILDMVG +Y+ ++L  L+++G+L
Sbjct: 181 AKCAACMDLGAERAINYREEDFVPVLQDEG---GANLILDMVGGDYIPRNLKSLAEDGRL 237

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+FL G     +N  P++ +R+TITGSTLR ++D+AK  I   L+ ++WPLL++  I 
Sbjct: 238 VQIAFLQGP-KVAVNFAPLMMRRLTITGSTLRPQSDLAKARIAAELEREVWPLLSAGRIK 296

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            V+ +   L   A AH  ME S HIGKI+L
Sbjct: 297 VVMDSEFALDDAAKAHARMESSAHIGKIVL 326


>gi|237745433|ref|ZP_04575913.1| zinc-binding dehydrogenase domain-containing protein [Oxalobacter
           formigenes HOxBLS]
 gi|229376784|gb|EEO26875.1| zinc-binding dehydrogenase domain-containing protein [Oxalobacter
           formigenes HOxBLS]
          Length = 358

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 145/324 (44%), Positives = 217/324 (66%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +   G +  + L E PIP  ++ E+LIKV A G+NRPDV+QR G Y  PK A  I
Sbjct: 33  MKAIEIIDQGSAGYLQLTERPIPVAKEGEVLIKVHAAGINRPDVLQRVGRYVVPKGAPDI 92

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG+IV    + + +  GD VCALV GGGYAEYC +     LP+PKG   I+AASL
Sbjct: 93  PGLEIAGEIVGGDVSGSDFRKGDMVCALVQGGGYAEYCTACTKLCLPVPKGLTPIEAASL 152

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVW+N++    L+  ++ L+  G+SGIG TAIQ+A   G  V+ TA++E+KC AC
Sbjct: 153 PETYFTVWSNVYDMGGLKGKESFLVQAGASGIGVTAIQMAHAMGHRVFATARTEDKCRAC 212

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+  IN   E+F E ++K T G+G+D+ILD++GA  L++ +  L+ EG+L++I++L
Sbjct: 213 EALGAERCINSTTENFAEYIKKATDGKGVDVILDIIGAAVLDKEIDCLADEGRLVLIAYL 272

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG + T ++L  I+ +++T+TGSTLR R++  K  I  +L+  +WPL++   I PVI+ V
Sbjct: 273 GGRLGT-VDLAQIVHRQLTVTGSTLRPRSNAFKAEIAKNLRKHVWPLIDEGKIKPVIYKV 331

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL +   A  +M+ + H GKI+L
Sbjct: 332 FPLAEAMQAQKLMQSNTHFGKIVL 355


>gi|299530739|ref|ZP_07044154.1| PIG3 family NAD(P)H quinone oxidoreductase [Comamonas testosteroni
           S44]
 gi|298721255|gb|EFI62197.1| PIG3 family NAD(P)H quinone oxidoreductase [Comamonas testosteroni
           S44]
          Length = 330

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 153/327 (46%), Positives = 215/327 (65%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++ YG  +V+ +    +P   + E+LI+V A G+NRPDV+QRKG Y PP  A+ +
Sbjct: 1   MRAVEITSYGAPDVLRMGVRLMPVAAEGEVLIRVAASGINRPDVLQRKGHYAPPAGASDL 60

Query: 67  LGLEVAGKIVDLGENT---THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
            GLEVAG IV   E       + +GD VCALV GGGYA +C +     LP+P G++ +QA
Sbjct: 61  PGLEVAGVIVAGDEAAMAKAGFKLGDRVCALVAGGGYASFCAAPVDQCLPVPAGFSDVQA 120

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A+LPE+FFTVW+N+F    L+ G+T+L+ GGSSGIG TAIQLA  +GATV  TA S+ KC
Sbjct: 121 AALPETFFTVWSNVFDRGALQPGETLLVQGGSSGIGVTAIQLAKAWGATVIVTAGSDAKC 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             CLKLGA HAINY  +DF   +Q+ T G G+++ILDMV   Y+ + +  L+ +G+L+II
Sbjct: 181 DDCLKLGADHAINYKTQDFAAEVQRITAGEGVNVILDMVAGSYVAREVQCLAPDGRLVII 240

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           +  GG +  E +   ++ KR+T+TGSTLR R+   K +I ++L+  +WPLL S  + P I
Sbjct: 241 AVQGG-VKAEFDAGLVLRKRLTVTGSTLRPRSVAFKAAIAEALKRNVWPLLESGKVRPAI 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +        A AH +ME S+H GKI+L
Sbjct: 300 YREFDAADAAQAHALMESSQHTGKIVL 326


>gi|260223145|emb|CBA33416.1| hypothetical protein Csp_B18940 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 337

 Score =  305 bits (781), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 214/333 (64%), Gaps = 10/333 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR   ++  G  +V+ L + P P+    E+ I+V A GVNRPDV+QR G YP P  A+ I
Sbjct: 1   MRAFEITSPGAPDVLRLVDRPAPKFGAGELCIRVSASGVNRPDVLQRLGKYPAPAGASDI 60

Query: 67  LGLEVAGKIVDLGENT---THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
            GLEVAG IV+            +GD VCALV GGGYAE C++     LP+P G++ ++A
Sbjct: 61  PGLEVAGMIVEGDAEALAQAGLKLGDRVCALVAGGGYAELCVAPVAQCLPVPDGWSDVEA 120

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A LPE++FTVW+N+F+   L+SG+ +L+ GG+SGIG TAIQLA   GATV  TA S+EKC
Sbjct: 121 AGLPETYFTVWSNVFERGRLQSGEVLLVQGGTSGIGVTAIQLAKSLGATVIATAGSDEKC 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
            A LKLGA  AINY  +DF     + T GRG+D+ILDMV   Y+ + +  L+++G+L+II
Sbjct: 181 AASLKLGADFAINYRTQDFEAEALRITGGRGVDVILDMVAGPYVAKEVQCLAEDGRLVII 240

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           +  GG + +E+N   I+ KR+T+TGSTLR R    K +I  +L+  +WPLL    + PV+
Sbjct: 241 AVQGG-VQSEVNAGLILRKRLTVTGSTLRARPVAFKAAIASALRKHVWPLLADKNVRPVV 299

Query: 304 HTVLPLG------KVAMAHDIMEKSEHIGKIIL 330
           H V  +G        A AH +ME + HIGK++L
Sbjct: 300 HQVFAVGAAQTSEAAAQAHAVMESNAHIGKLVL 332


>gi|296284799|ref|ZP_06862797.1| NADPH quinone oxidoreductase [Citromicrobium bathyomarinum JL354]
          Length = 330

 Score =  305 bits (781), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 150/325 (46%), Positives = 206/325 (63%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAES-PIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           M+ +  +  G   V+ L +  P+PQP   EIL+KV   GVNRPD +QR G YP P  A+P
Sbjct: 1   MQAIGFAEPGGPEVLRLEQDVPVPQPGPGEILLKVAYAGVNRPDCIQRAGNYPAPPGASP 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           ILGLE AG+IV +GE      +G+ VCAL  GG YA+YC    GHTLP+P      +AA+
Sbjct: 61  ILGLEAAGEIVAVGEGVDPARLGEHVCALTPGGAYAQYCAVPAGHTLPVPDAITLAEAAA 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+ FTVW N+FQ    R G+T+L+HGG+SGIGT AI L   FG  V  TA SEEKC A
Sbjct: 121 LPETLFTVWHNVFQRGMARDGETLLVHGGTSGIGTMAIMLGKAFGLKVIVTAGSEEKCEA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
             ++GA HAI+Y   DF+E +   T G G+D++LDMV  +Y+ ++L  L   G+ + I+ 
Sbjct: 181 ARRVGADHAIDYKTTDFVEAIGNITGGEGVDLVLDMVSGDYVARNLKCLKPGGRHVTIAV 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           LGG +  EIN+  ++SKR+ +TGSTLR R+D  K ++   +  + W L+    + PV+  
Sbjct: 241 LGG-MKAEINMALVMSKRLVLTGSTLRPRSDAFKAALGSEIAREAWSLVEEGAVRPVMDE 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
           + PL + A AH  ME  +HIGKI+L
Sbjct: 300 IFPLAEAAAAHTRMEAGDHIGKIVL 324


>gi|90418931|ref|ZP_01226842.1| NADPH, quinone oxidoreductase protein, possible zinc-containing
           dehydrogenase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337011|gb|EAS50716.1| NADPH, quinone oxidoreductase protein, possible zinc-containing
           dehydrogenase [Aurantimonas manganoxydans SI85-9A1]
          Length = 335

 Score =  305 bits (781), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 224/330 (67%), Gaps = 2/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M I + M+   + G+G   V+     P+P+P   E+L+ V A GVNRPDVMQR+G+YP P
Sbjct: 1   MTIPQDMQAALLDGFGGPEVLKPGTRPVPKPAAGEVLVAVAAAGVNRPDVMQRQGMYPAP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
            +A    GLE+AG +  LGE  + + +GD V ALV GGGYAEY    + + +P+P   + 
Sbjct: 61  ADAPDWPGLEIAGTVAALGEGASRFAVGDRVMALVPGGGYAEYATVAEVNAIPVPTSLSM 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           I+AA +PE++FTVW N+FQ A L +G++ L+HGG+SGIGTTAIQLA +FGA V+ TA S+
Sbjct: 121 IEAAGVPETYFTVWHNVFQRARLTAGESFLVHGGTSGIGTTAIQLAKHFGARVFATAGSD 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +KC A   LGA+  INY  +DF+E L+++T G+G+D+ILDMVG EY  ++L L +++G++
Sbjct: 181 DKCRAAESLGAEACINYRTQDFVEGLREKTDGKGVDVILDMVGGEYTPRNLQLAAEDGRI 240

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+FL G   T+I+L P++ KR+T TGSTLR R    K  I   L  ++ PLL +  + 
Sbjct: 241 VQIAFLKGP-KTQIDLTPLMRKRLTFTGSTLRNRPVSFKAVIASELTEQVVPLLEAGTVK 299

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P+I  V PL K A AH  M++ +HIGKIIL
Sbjct: 300 PLIDEVYPLEKAADAHRHMDE-DHIGKIIL 328


>gi|316932457|ref|YP_004107439.1| NAD(P)H quinone oxidoreductase [Rhodopseudomonas palustris DX-1]
 gi|315600171|gb|ADU42706.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhodopseudomonas
           palustris DX-1]
          Length = 332

 Score =  305 bits (780), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 150/329 (45%), Positives = 215/329 (65%), Gaps = 1/329 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           PI  +M  V +S  G   V+      +P P K E+L+KV A GVNRPDV QR G YPPP 
Sbjct: 3   PIPSQMTVVGISKPGGPEVLKPETRDVPAPGKGELLVKVAAAGVNRPDVAQRSGSYPPPP 62

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A+ + GLE+AG +V LG+  +   +GD+V +LV GGGYAEYC++     + +P  Y+ I
Sbjct: 63  GASDLPGLEIAGTVVALGDGASRHKLGDKVMSLVAGGGYAEYCIAQDAQAIRVPAAYSMI 122

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
           +A + PE+  TVW N+F+   L SG+T+L+HGGSSGIGT AIQLA   GATV TT  S++
Sbjct: 123 EAGATPETLMTVWHNVFERGRLVSGETLLVHGGSSGIGTMAIQLAVARGATVITTVGSQD 182

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           K  AC+KLGA  AINY  EDF+  +++ T G+G D+ILDMVG +Y+ ++    + +G+++
Sbjct: 183 KADACVKLGASRAINYKTEDFVAAVKEATGGKGADVILDMVGGDYIERNYDAAAIDGRVV 242

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I+FLGG  A  +N   +++KR+  TGSTLR R++  K ++  +++ ++ PLL+   I P
Sbjct: 243 QIAFLGGAKAN-VNFAKLMTKRLQHTGSTLRPRSNADKAAMVAAIEAEVMPLLDQGRIKP 301

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +I     L   A AH  ME S+HIGKI+L
Sbjct: 302 LIDGTFELRDAADAHRRMETSQHIGKIVL 330


>gi|160873780|ref|YP_001553096.1| PIG3 family NAD(P)H quinone oxidoreductase [Shewanella baltica
           OS195]
 gi|160859302|gb|ABX47836.1| NAD(P)H quinone oxidoreductase, PIG3 family [Shewanella baltica
           OS195]
 gi|315266006|gb|ADT92859.1| NAD(P)H quinone oxidoreductase, PIG3 family [Shewanella baltica
           OS678]
          Length = 333

 Score =  305 bits (780), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 216/322 (67%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           H+ +   G   VM L+ SP+P P   ++LI+V A GVN PDV QR G YPPP  A+PI+G
Sbjct: 10  HIHVEQPGAPEVMQLSRSPLPVPVAGQVLIRVHAAGVNGPDVKQRVGAYPPPPGASPIIG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG I  LGE  + W IGD+VCALV GGGY EY L++  H LPIP G++ +QAA+LPE
Sbjct: 70  LEVAGDICALGEGVSQWQIGDKVCALVPGGGYGEYALTYAAHCLPIPTGFSYVQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW NLF  A L++G+TVLIHGGS GIG+TAIQLAS  G+ V  T   +EK   CL 
Sbjct: 130 TFFTVWGNLFMRAGLKAGETVLIHGGSGGIGSTAIQLASALGSKVIATTGQDEKRDYCLS 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA   INY   +F+E +   T+ +G++++ D+ G +++N  L  L+ +G+++ ++   G
Sbjct: 190 LGAAEVINYRTHNFVEPVMALTEDKGVNVVFDIAGGDFINLDLQALAMDGRMVSVAMQRG 249

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+ +  +++KRI  TGSTLR ++  AK +I   L  K+WPLLN+H I P I    P
Sbjct: 250 PKA-EVEIFRLMAKRIMWTGSTLRPQSVEAKAAIAAELFEKVWPLLNAHKIVPNIFATFP 308

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           LG+ A AH +ME  EH GK++L
Sbjct: 309 LGEAAKAHALMESGEHRGKVVL 330


>gi|192289412|ref|YP_001990017.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhodopseudomonas
           palustris TIE-1]
 gi|192283161|gb|ACE99541.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhodopseudomonas
           palustris TIE-1]
          Length = 332

 Score =  305 bits (780), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 149/329 (45%), Positives = 215/329 (65%), Gaps = 1/329 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           PI  +M  V +S  G   V+      +P+P   EIL+KV A GVNRPDV QR G YPPP 
Sbjct: 3   PIPSQMTVVGISKPGGPEVLLPETRDVPKPGPGEILVKVTAAGVNRPDVAQRSGSYPPPP 62

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A+ + GLE+AG++V LG+  +   +GD+V +LV GGGYAEYC++     + +P  Y+ I
Sbjct: 63  GASDLPGLEIAGEVVALGDGASRHKLGDKVMSLVAGGGYAEYCIAQDSQAMKVPAAYSMI 122

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
           +A + PE+  TVW NLF+   L+ G+T+L+HGGSSGIGT AIQLA   G+ V TT  S++
Sbjct: 123 EAGATPETLMTVWHNLFERGGLQPGETLLVHGGSSGIGTMAIQLAVALGSKVITTVGSQD 182

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           K  ACLKLGA  AINY  EDF+  +++ T G+G+++ILDMVG +Y+ ++    + +G+++
Sbjct: 183 KADACLKLGASRAINYKTEDFVAAVKEATGGKGVEVILDMVGGDYIERNYDAAAMDGRIV 242

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I+FLGG  A  +N   +++KR+  TGSTLR R++  K ++  +++ K+ PLL    I P
Sbjct: 243 QIAFLGGAKAN-VNFVKLMTKRLHHTGSTLRPRSNADKAAMVAAIEAKVLPLLEQGRIKP 301

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +I     L   A AH  ME S+HIGKI+L
Sbjct: 302 LIDGTFALRDAADAHRRMETSQHIGKIVL 330


>gi|126175925|ref|YP_001052074.1| alcohol dehydrogenase [Shewanella baltica OS155]
 gi|125999130|gb|ABN63205.1| Alcohol dehydrogenase, zinc-binding domain protein [Shewanella
           baltica OS155]
          Length = 333

 Score =  305 bits (780), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 216/322 (67%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           H+ +   G   VM L+ SP+P P   ++LI+V A GVN PDV QR G YPPP  A+PI+G
Sbjct: 10  HIHVEQPGTPEVMQLSRSPLPVPASGQVLIRVHAAGVNGPDVKQRVGAYPPPPGASPIIG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG I  LG+  + W IGD+VCALV GGGY EY L++  H LPIP G++ +QAA+LPE
Sbjct: 70  LEVAGDICALGDGVSQWQIGDKVCALVPGGGYGEYVLTYAAHCLPIPTGFSYVQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW NLF  A L++G+TVLIHGGS GIG+TAIQLAS  G+ V  T   +EK   CL 
Sbjct: 130 TFFTVWGNLFMRAGLKAGETVLIHGGSGGIGSTAIQLASALGSKVIATTGQDEKRDYCLS 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA   INY   +F+E +   TQ +G++++ D+ G +++N  L  L+ +G+++ ++   G
Sbjct: 190 LGATEVINYRTHNFVEPVMTLTQDKGVNVVFDIAGGDFINLDLQALALDGRMVSVAMQRG 249

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+ +  +++KRI  TGSTLR ++  AK +I   L  K+WPLLN+H I P I    P
Sbjct: 250 PKA-EVEIFRLMAKRIMWTGSTLRPQSVEAKATIAAELFEKVWPLLNAHKIVPNIFATFP 308

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           LG+ A AH +ME  EH GK++L
Sbjct: 309 LGEAAKAHALMESGEHRGKVVL 330


>gi|217971846|ref|YP_002356597.1| NAD(P)H quinone oxidoreductase, PIG3 family [Shewanella baltica
           OS223]
 gi|217496981|gb|ACK45174.1| NAD(P)H quinone oxidoreductase, PIG3 family [Shewanella baltica
           OS223]
          Length = 333

 Score =  304 bits (779), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 215/322 (66%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           H+ +   G   VM L+ SP+P P   ++LI+V A GVN PDV QR G YPPP  A+PI+G
Sbjct: 10  HIHVEQPGAPEVMQLSRSPLPVPAAGQVLIRVHAAGVNGPDVKQRVGAYPPPPGASPIIG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG I  LGE  + W IGD+VCALV GGGY EY L++  H LPIP G++ +QAA+LPE
Sbjct: 70  LEVAGDICALGEGVSQWQIGDKVCALVPGGGYGEYALTYAAHCLPIPTGFSYVQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW NLF  A L++G+ VLIHGGS GIG+TAIQLAS  G+ V  T   +EK   CL 
Sbjct: 130 TFFTVWGNLFMRAGLKAGEIVLIHGGSGGIGSTAIQLASALGSKVIATTGQDEKRDYCLS 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA   INY   +F+E +   TQ +G++++ D+ G +++N  L  L+ +G+++ ++   G
Sbjct: 190 LGAAEVINYRTHNFVEPVMALTQDKGVNVVFDIAGGDFINLDLQALAMDGRMVSVAMQRG 249

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+ +  +++KRI  TGSTLR ++  AK +I   L  K+WPLLN+H I P I    P
Sbjct: 250 PKA-EVEIFRLMAKRIMWTGSTLRPQSVEAKAAIAAELFEKVWPLLNAHKIVPNIFATFP 308

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           LG+ A AH +ME  EH GK++L
Sbjct: 309 LGEAAKAHALMESGEHRGKVVL 330


>gi|39933992|ref|NP_946268.1| putative NADPH quinone oxidoreductase [Rhodopseudomonas palustris
           CGA009]
 gi|39647839|emb|CAE26359.1| putative NADPH quinone oxidoreductase [Rhodopseudomonas palustris
           CGA009]
          Length = 332

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 148/329 (44%), Positives = 215/329 (65%), Gaps = 1/329 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           PI  +M  V +S  G   V+      +P+P   EIL+KV A GVNRPDV QR G YPPP 
Sbjct: 3   PIPSQMTVVGISKPGGPEVLLPETRDVPKPGPGEILVKVAAAGVNRPDVAQRSGSYPPPP 62

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A+ + GLE+AG++V LG+  +   +GD+V +LV GGGYAEYC++     + +P  Y+ I
Sbjct: 63  GASDLPGLEIAGEVVALGDGASRHKLGDKVMSLVAGGGYAEYCIAQDAQAMKVPAAYSMI 122

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
           +A + PE+  TVW N+F+   L+ G+T+L+HGGSSGIGT AIQLA   G+ V TT  S++
Sbjct: 123 EAGATPETLMTVWHNVFERGGLQPGETLLVHGGSSGIGTMAIQLAVALGSKVITTVGSQD 182

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           K  ACLKLGA  AINY  EDF+  +++ T G+G+++ILDMVG +Y+ ++    + +G+++
Sbjct: 183 KADACLKLGASRAINYKTEDFVAAVKEATGGKGVEVILDMVGGDYIERNYDAAAMDGRIV 242

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I+FLGG  A  +N   +++KR+  TGSTLR R++  K ++  +++ K+ PLL    I P
Sbjct: 243 QIAFLGGAKAN-VNFVKLMTKRLHHTGSTLRPRSNADKAAMVAAIEAKVLPLLEQGRIKP 301

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +I     L   A AH  ME S+HIGKI+L
Sbjct: 302 LIDGTFALRDAADAHRRMETSQHIGKIVL 330


>gi|312960388|ref|ZP_07774897.1| zinc-containing alcohol dehydrogenase superfamily [Pseudomonas
           fluorescens WH6]
 gi|311285273|gb|EFQ63845.1| zinc-containing alcohol dehydrogenase superfamily [Pseudomonas
           fluorescens WH6]
          Length = 332

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 212/330 (64%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + K M  + ++  G   V+   +  +P     EILI+V A GVNRPD +QR G YP  
Sbjct: 1   MTLPKDMTLIEITAPGGPEVLQPRQVDVPVAGPGEILIRVHAAGVNRPDALQRAGKYPLK 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
              +P  GLEVAG++V LG+  + +N+GD+VCAL NGGGYA+YC    G  LPIP+G + 
Sbjct: 61  PGMSPYPGLEVAGEVVALGDGVSTFNLGDKVCALTNGGGYAQYCAVPAGQALPIPEGMDW 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           IQAA++PE+FFTVWANLF   +  +GQ VLIHGG+SGIGTTA+ L   FG   + TA S 
Sbjct: 121 IQAAAVPETFFTVWANLFGLGDAHTGQRVLIHGGTSGIGTTALMLCREFGIQAFATAGSA 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +KC A   LG +  INY ++DF +++ ++T  +G+D+ILD++G  YLN +L  L+ +G L
Sbjct: 181 DKCAAIATLGGE-PINYREQDFAQVIAEQTHDQGVDVILDIMGGSYLNNNLKALAMDGHL 239

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +I+ FLGG  A +++L  I+ KR  ITGS LR RT   K +I + L+  IWP+L +    
Sbjct: 240 VILGFLGGARANDVDLLTILGKRAVITGSLLRPRTGEEKAAIAEQLREYIWPVLAAGRCL 299

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P+I  V      A AH  ME  +HIGKI+L
Sbjct: 300 PIIDKVYDYTDAAQAHARMEGGDHIGKIVL 329


>gi|255642907|gb|ACU22674.1| unknown [Glycine max]
          Length = 325

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 148/326 (45%), Positives = 211/326 (64%), Gaps = 1/326 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++  G   V+ L E   P    +E+LI V A  +NR D  QRKG YPPPK A+P 
Sbjct: 1   MKAIVITRPGGPEVLQLEEVEDPLVGDDELLIGVHATSLNRADTFQRKGSYPPPKGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G ++ LG+N + W IGD+VCAL+ GGGYAE      G  LP+P G +   AAS 
Sbjct: 61  LGLECSGTVLSLGKNVSSWKIGDQVCALLAGGGYAEKVAVPVGQVLPVPAGVSLTDAASF 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F  + L  G+T+L+HGGSSGIGT AIQ+A Y G+ V+ TA SEEK   C
Sbjct: 121 PEVACTVWSTVFMMSRLSQGETLLVHGGSSGIGTFAIQIAKYRGSRVFVTAGSEEKLAFC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             +GA   INY  EDF+  +++ET G+G+D+ILD +GA Y  ++L  L+ +G+L II F 
Sbjct: 181 KSIGADVGINYKTEDFVARVKEETGGQGVDVILDCMGASYYQRNLDSLNFDGRLFIIGFQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG ++T+ +L P+++KR+T+ G+ LR R+   K  I   ++  +WP +    + PV++  
Sbjct: 241 GG-VSTQADLRPLLAKRLTVQGAGLRNRSLENKAVIVSEVEKNVWPAIAEGKVKPVVYKS 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILLP 332
            PL + A AH +ME S+HIGKI+LLP
Sbjct: 300 FPLSEAAEAHQLMESSQHIGKILLLP 325


>gi|241763285|ref|ZP_04761342.1| NAD(P)H quinone oxidoreductase, PIG3 family [Acidovorax delafieldii
           2AN]
 gi|241367560|gb|EER61847.1| NAD(P)H quinone oxidoreductase, PIG3 family [Acidovorax delafieldii
           2AN]
          Length = 328

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 150/328 (45%), Positives = 218/328 (66%), Gaps = 6/328 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++ +G   V+ L E P+P   + E LI+V A G+NRPDV+QR G Y PP   + +
Sbjct: 1   MRAVEITAFGAPEVLRLGERPMPHAGEGEALIRVSASGINRPDVLQRLGHYAPPPGTSDL 60

Query: 67  LGLEVAGKIVDLGENTT----HWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            GLEVAG +V+ G+          +GD VCALV GGGYA++C++     LP+P G   I+
Sbjct: 61  PGLEVAG-VVEGGDEAALSRAGLKLGDRVCALVAGGGYAQWCVAPVEQCLPVPAGLTDIE 119

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AASLPE+FFTVW+N+F    L+ G+T+L+ GG+SGIG TAIQLA  +GATV  TA S+EK
Sbjct: 120 AASLPETFFTVWSNVFDRGRLQPGETLLVQGGTSGIGVTAIQLARAWGATVIVTAGSDEK 179

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C ACL LGA HAINY  +DF+  + + T G+G+D++LDMV  +Y+ + +  L+++G+L+I
Sbjct: 180 CAACLSLGAHHAINYKSQDFVAEVARITAGKGVDVVLDMVAGDYVAREVECLAEDGRLVI 239

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+  GG + +  N   ++ +R+TITGSTLR R    K +I  +L+ ++WP++    + PV
Sbjct: 240 IAVQGG-VKSAFNAGLVLRRRLTITGSTLRPRPVAFKGAIARALRERVWPMIEEGKVRPV 298

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           IH+       A AH +ME ++H GKI+L
Sbjct: 299 IHSTFEAADAAQAHALMESNQHTGKIVL 326


>gi|119714447|ref|YP_921412.1| alcohol dehydrogenase [Nocardioides sp. JS614]
 gi|119535108|gb|ABL79725.1| Alcohol dehydrogenase, zinc-binding domain protein [Nocardioides
           sp. JS614]
          Length = 325

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 208/324 (64%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V  +G G  +V+ +AE P P+P   E+L+ V A G+NR D++QR+G YPPP  A+ +
Sbjct: 1   MRAVIATGAGGPDVLSVAELPDPEPGPGEVLLAVAAAGLNRADLLQRQGFYPPPPGASDV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           +G+E +G +  LGE    W +GD  CAL+ GGGYAE      G  +P+P G + + AA+L
Sbjct: 61  IGMECSGTVAALGEGVEGWAVGDPACALLAGGGYAELVAVPSGQLMPVPDGVDLVTAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F    L+ G+  L+HGG+ GIGT AIQLA   GA V TTA + EK  AC
Sbjct: 121 PEVACTVWSNVFMLGGLKPGEAFLVHGGAGGIGTFAIQLAHQLGAQVLTTAGTAEKRAAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   I+Y  +DF+E+ +  T+GRG+D++LD +GA+YL+++L  L+ EG+L+II   
Sbjct: 181 AALGADVTIDYRDQDFVEVARAATEGRGVDLVLDNMGAKYLDRNLDALATEGRLVIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E+++N ++ KR  I  +TLR R    K +I  S+   +WPL+   ++ PV+H  
Sbjct: 241 GGTRA-ELDINKLLRKRGAIIATTLRARPTEEKSAICASVVEHVWPLVAEGLVRPVVHGT 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           +PL +   AH +ME  EH GKI+L
Sbjct: 300 MPLAEAGAAHALMESGEHSGKILL 323


>gi|317402115|gb|EFV82708.1| putative NADPH quinone oxidoreductase [Achromobacter xylosoxidans
           C54]
          Length = 325

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 215/324 (66%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  V +S  G   V+  AE P P+  K E+LIKV A GVNRPDV QRKG Y PP  A+ +
Sbjct: 1   MHCVEISRPGGPEVLVPAERPTPEAGKGEVLIKVSAAGVNRPDVFQRKGNYAPPPGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG+IV      + + +GD+VCALV GGGYAEYC++     LPIPKG + I+AA L
Sbjct: 61  PGLEVAGEIVGGDLAGSGFALGDKVCALVAGGGYAEYCVAPAAQCLPIPKGLSDIEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVW+N+F    L  G+ +L+HGG+SGIGTTAIQLA   G  VY T  S+++  A 
Sbjct: 121 PETYFTVWSNVFDRGRLADGEILLVHGGASGIGTTAIQLARAMGNPVYATVGSDDRARAV 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY  +DF++ ++  T GRG+D+ILDMV  +Y+ + +  L+ +G+++II+ L
Sbjct: 181 EALGAARGINYKTQDFVKEVKDATGGRGVDVILDMVAGDYIARDMQCLADDGRIVIIAQL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A  ++ + ++ +R+TITGSTLR R    K +I  +L+ + WPLL    I P++H  
Sbjct: 241 GGAQAN-VDTSQVMRRRLTITGSTLRPRPVDFKGAIARALRERAWPLLEQGAIKPIVHAT 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH +ME  E+IGKIIL
Sbjct: 300 FPLAQAAQAHAMMESGENIGKIIL 323


>gi|157377155|ref|YP_001475755.1| alcohol dehydrogenase [Shewanella sediminis HAW-EB3]
 gi|157319529|gb|ABV38627.1| alcohol dehydrogenase, zinc-binding domain protein [Shewanella
           sediminis HAW-EB3]
          Length = 345

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 148/332 (44%), Positives = 215/332 (64%), Gaps = 11/332 (3%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           HVA    G + VM++  SP+P     ++LIKV + GVN PDV QR+GLYPPPK A+PILG
Sbjct: 12  HVAFDRPGMAEVMYMTRSPMPILAPGQVLIKVHSAGVNGPDVAQRRGLYPPPKEASPILG 71

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG+I  + +    W  GD VCALV GGGY EY +++  H LP+P G++  QAA++PE
Sbjct: 72  LEVAGEISKVAKGVDQWEPGDMVCALVPGGGYGEYAVAYARHCLPVPCGWSFQQAAAIPE 131

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW NLF  A L++G+TVLI+G S GIG+ AI LA  FGA V  T+ S+EKC+ C  
Sbjct: 132 TFFTVWGNLFMRAGLKAGETVLINGASGGIGSAAIVLAKAFGARVIVTSGSDEKCVYCRN 191

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA  AINY  +DF+  + + T+ +G++++ D+ G +++N +L +L+ +G+++ ++   G
Sbjct: 192 LGADLAINYQDKDFVGSVMEYTRDKGVEVVFDVAGGDFINLNLKVLAMDGRMVSVAMQRG 251

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHV---------- 298
             A ++++  I++KRIT TGSTLR ++  AK  I D L   +WP+L              
Sbjct: 252 AKA-QVDIFRIMAKRITWTGSTLRPQSVTAKAGIADELMAHVWPMLQQSTKSGSKRLICN 310

Query: 299 IAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           + P I    PL +   AH++ME   H GKI+L
Sbjct: 311 LIPNIFAKFPLDECVCAHELMESGAHRGKIVL 342


>gi|260574193|ref|ZP_05842198.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhodobacter sp. SW2]
 gi|259023659|gb|EEW26950.1| NAD(P)H quinone oxidoreductase, PIG3 family [Rhodobacter sp. SW2]
          Length = 329

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 147/305 (48%), Positives = 204/305 (66%), Gaps = 4/305 (1%)

Query: 26  SPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHW 85
           +P+P P   +I+IK+   GVNRPD +QR GLY PP +A+ + GLE AG++  +G   T W
Sbjct: 26  APVPVPGHGQIVIKLAYAGVNRPDALQRAGLYAPPPSASKLPGLEGAGEVAAVGPGVTRW 85

Query: 86  NIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRS 145
            +GD VCAL+ GGGYAEY L+H  H LPIPKG    +AA LPE+ FTVW+N+     L++
Sbjct: 86  AVGDLVCALLPGGGYAEYALTHADHALPIPKGLTLREAACLPETCFTVWSNVVNRGGLQA 145

Query: 146 GQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEI 205
           GQ  L+HGG+SGIGTTAIQ+A   GA V+TTA S+ KC  C  LGA+ AINY  EDF+EI
Sbjct: 146 GQRFLVHGGTSGIGTTAIQIARALGARVFTTAGSDAKCQVCRDLGAEVAINYRTEDFVEI 205

Query: 206 LQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRIT 265
           L+K     G D+ILDMVG  YL +++  L+ +G+L+ I+FL G    E+N   ++++R+T
Sbjct: 206 LRKAG---GADVILDMVGGNYLPRNIRALADDGRLVQIAFLTGA-KVELNFAEVMTRRLT 261

Query: 266 ITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHI 325
           ITGSTLR ++D+AK      ++  +WP++ S    PVI +   L     AH  +E + H+
Sbjct: 262 ITGSTLRPQSDLAKARYARDIETHVWPMIESGAFKPVIDSEFVLSDAPAAHWRIESAGHV 321

Query: 326 GKIIL 330
           GKI+L
Sbjct: 322 GKIVL 326


>gi|226329955|ref|ZP_03805473.1| hypothetical protein PROPEN_03868 [Proteus penneri ATCC 35198]
 gi|225200750|gb|EEG83104.1| hypothetical protein PROPEN_03868 [Proteus penneri ATCC 35198]
          Length = 339

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 151/324 (46%), Positives = 216/324 (66%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  +A++  G  + +    SPIP      +LIKV A GVNRPD+ QR+G YPPP +A+PI
Sbjct: 9   MLEIAITEPGGIDKLKPQRSPIPTLPPHYLLIKVAASGVNRPDIFQRQGSYPPPADASPI 68

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG++V LG+  T W +GD VCALV GGGYA+YC++H+   LP       I+AA+L
Sbjct: 69  PGLEVAGEVVALGDGCTKWQLGDRVCALVAGGGYAQYCIAHEDIALP-SMNLTDIEAAAL 127

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVWANLFQ   L+ G++VLIHGG+SGIG+TAI LA   GATVYTT  SEEK    
Sbjct: 128 PENVFTVWANLFQLGKLKQGESVLIHGGTSGIGSTAIMLAHTIGATVYTTVGSEEKAAVA 187

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA + INY + DF + +   T+G+G+D+ILD++G +Y+ ++  + SK G++I +  +
Sbjct: 188 RDLGADYVINYKQADFAKEIPILTEGKGVDVILDIIGGDYVEKNYQVASKFGRVIQVGMM 247

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G +   +N+ P++ KR+  TGST+R R+   K  I   L+ ++WPL+    I P+I+ +
Sbjct: 248 KG-MPKNLNMMPMMIKRLIHTGSTMRSRSIEEKAQIAQELKQQVWPLIAEGKIKPMINAI 306

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL +V  AH +ME  + IGK++L
Sbjct: 307 FPLKEVGKAHKLMESGDLIGKVML 330


>gi|86751592|ref|YP_488088.1| alcohol dehydrogenase [Rhodopseudomonas palustris HaA2]
 gi|86574620|gb|ABD09177.1| Alcohol dehydrogenase superfamily, zinc-containing
           [Rhodopseudomonas palustris HaA2]
          Length = 332

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 146/329 (44%), Positives = 212/329 (64%), Gaps = 1/329 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           P+  +M  + +S  G   V+      +P P   EIL+KV A GVNRPDV QR G YPPP 
Sbjct: 3   PVPSQMTVIGISKPGGPEVLLPETRAVPTPGPGEILVKVAAAGVNRPDVAQRSGSYPPPP 62

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A+ + GLE+AG++V +G+  T   +GD+V +LV GGGYAEYC++     + +P G++ I
Sbjct: 63  GASDLPGLEIAGEVVAIGDGATRHKLGDKVMSLVAGGGYAEYCIAQDAQAMTVPAGFSMI 122

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
           +A + PE+  TVW N+F+   L+ G+T+L+HGGSSGIGT AIQLA  FGA V  T  + +
Sbjct: 123 EAGATPETLMTVWHNVFERGALQPGETLLVHGGSSGIGTMAIQLAVAFGAKVIATVGAPD 182

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           K  ACLKLGA  AINY  EDF+  +++ T G+G D+ILDMVG +Y+ ++    + +G+++
Sbjct: 183 KAEACLKLGATRAINYKTEDFVAAVKETTSGKGADVILDMVGGDYIERNYDAAAMDGRIV 242

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I+FLGG   T +N   ++ KR+  TGSTLR R++  K ++  +++ ++ PLL    I P
Sbjct: 243 QIAFLGGA-KTTVNFTKLMIKRLHHTGSTLRPRSNADKAAMVAAIETRVMPLLAEGRIKP 301

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +I     L   A AH  ME S+HIGKI+L
Sbjct: 302 LIDGTFALQDAAAAHRRMETSQHIGKIVL 330


>gi|126725110|ref|ZP_01740953.1| NADPH/quinone reductase and related Zn-dependent oxidoreductase
           [Rhodobacterales bacterium HTCC2150]
 gi|126706274|gb|EBA05364.1| NADPH/quinone reductase and related Zn-dependent oxidoreductase
           [Rhodobacterales bacterium HTCC2150]
          Length = 331

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 218/331 (65%), Gaps = 5/331 (1%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAES-PIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPP 59
           M I + M  V ++  G   V+ L E+ P+P     E+LIKV   GVNRPD +QR GLY P
Sbjct: 1   MTIPETMNAVEITQSGGPEVLVLNENRPVPTVGFGEVLIKVAYAGVNRPDALQRAGLYNP 60

Query: 60  PKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYN 119
           PK A+ + GLE +G IV +G   + W IGD VCAL+ GGGYAEY  +   H LPIP G +
Sbjct: 61  PKGASDLPGLEASGHIVAIGAGVSKWKIGDAVCALLPGGGYAEYVTTEASHCLPIPAGMS 120

Query: 120 AIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKS 179
            ++AA LPE+ FTV++NL   A L+SG+T+LIHGGSSGIGTTAIQLA   G  V+ TA S
Sbjct: 121 LLKAAGLPENHFTVYSNLVVRAGLKSGETILIHGGSSGIGTTAIQLACSMGCRVFVTAGS 180

Query: 180 EEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGK 239
           EEKC AC+ LGA+ A NY + DF  + + + +GR  D++LDMVG  Y+ +++  L+ +G+
Sbjct: 181 EEKCAACVALGAEAAFNYRETDF--VAEMKQRGRA-DVVLDMVGGPYMQRNIKALADDGR 237

Query: 240 LIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVI 299
           L+ I+FL G  A E+N+  ++++R+T+TGSTLR ++ +AK  I   L   +WP L +  I
Sbjct: 238 LVQIAFLQGPKA-ELNMVEMMTRRLTLTGSTLRPQSILAKSRIATGLSADVWPKLENGQI 296

Query: 300 APVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             VI +   L   A AH+ ME S HIGKI+L
Sbjct: 297 DVVIDSEFALSDAAKAHERMETSAHIGKIML 327


>gi|91978805|ref|YP_571464.1| zinc-binding alcohol dehydrogenase [Rhodopseudomonas palustris
           BisB5]
 gi|91685261|gb|ABE41563.1| Alcohol dehydrogenase, zinc-binding [Rhodopseudomonas palustris
           BisB5]
          Length = 332

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 149/329 (45%), Positives = 215/329 (65%), Gaps = 1/329 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           PI  +M  V +S  G   V+      +P+P   EIL+KV A GVNRPDV QR G YPPP 
Sbjct: 3   PIPSQMTVVGISKPGGPEVLLPETRDVPKPGPGEILVKVAAAGVNRPDVAQRSGSYPPPP 62

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A+ + GLE+AG++V LGE  T   +GD+V +LV GGGYA+YC++     + +P GY+ I
Sbjct: 63  GASDLPGLEIAGEVVALGEGATKHKLGDKVMSLVAGGGYAQYCIAQDAQAMTVPAGYSMI 122

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
           +A +  E+  TVW N+F+   L  G+T+L+HGGSSGIGT AIQLA   G+ V TT  S+E
Sbjct: 123 EAGATAETLMTVWHNVFERGRLAPGETLLVHGGSSGIGTMAIQLAVALGSKVITTVGSQE 182

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           K  ACLKLGA  AINY  +DF+  +++ T G+G+++ILDMVG +Y+ ++    + +G+++
Sbjct: 183 KADACLKLGATRAINYKTDDFVAAVEEATGGKGVEVILDMVGGDYIERNYEAAAMDGRIV 242

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I+FLGG   T +N   ++ KR+  TGSTLR R++  K ++  +++ K+ PLL+   I P
Sbjct: 243 QIAFLGGA-KTTVNFTKLMIKRLHHTGSTLRPRSNADKAAMVAAIEAKVMPLLHEGRIKP 301

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +I     L + A AH  ME S+HIGKI+L
Sbjct: 302 LIDGTFALHQAADAHRRMETSQHIGKIVL 330


>gi|224078882|ref|XP_002305665.1| predicted protein [Populus trichocarpa]
 gi|222848629|gb|EEE86176.1| predicted protein [Populus trichocarpa]
          Length = 325

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 147/325 (45%), Positives = 214/325 (65%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G   V+ L E   PQ  ++E+LIKVEA  +NR D +QR+G YPPPK A+P 
Sbjct: 1   MKAVVITTPGGPEVLQLQEVEDPQINEDEVLIKVEATALNRADTLQRQGKYPPPKGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G I  +G+N + W IGD+VCAL++GGGYAE      G  LP+P+G +   AA+L
Sbjct: 61  PGLECSGTIEAVGKNVSRWKIGDQVCALLSGGGYAEKVAVPAGQVLPVPQGVSLKDAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F  + L +G+T L+HGGSSGIGT AIQ+A + G  V+ TA SEEK   C
Sbjct: 121 PEVACTVWSTVFMMSRLSAGETFLVHGGSSGIGTFAIQIAKHQGVKVFVTAGSEEKLAVC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY  EDF+  +++ET G+G+D+ILD VGA Y  +++  L+ +G+L ++ F+
Sbjct: 181 KDLGADVCINYKTEDFVARVKEETGGKGVDVILDSVGAPYFQKNVDSLNIDGRLFLLGFM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG + T++NL  + +KRIT+  + LR RT   K  I   ++  +WP + +  + PV++  
Sbjct: 241 GGAV-TQVNLASLFAKRITVQAAGLRTRTLENKAEIVSEVEKNVWPAIVAGKVKPVVYKY 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           LPL + A  H +ME S+HIGKI+L+
Sbjct: 300 LPLSEAAEGHRLMESSQHIGKILLV 324


>gi|72160476|ref|YP_288133.1| quinone oxidoreductase [Thermobifida fusca YX]
 gi|71914208|gb|AAZ54110.1| putative quinone oxidoreductase [Thermobifida fusca YX]
          Length = 328

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 152/327 (46%), Positives = 212/327 (64%), Gaps = 3/327 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +S  G    +   E P PQP   E+L++V A  VNR D+ QR+G YPPP  A   
Sbjct: 1   MRAIVVSAPGGPENLVWQEVPDPQPGPGEVLVEVAATAVNRGDISQREGNYPPPPGAPEY 60

Query: 67  LGLEVAGKIVDLGENT--THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           LGLE +G+I+  G  T  + + +GDEVCAL++GGGYAE      G  LP+PKG   ++AA
Sbjct: 61  LGLECSGRIIAFGPGTEDSGYRVGDEVCALLSGGGYAERVAVPVGQLLPVPKGVGLVEAA 120

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           +LPE   TVWAN+F TA LR G+ +L+HGG+SGIGT AIQ A  FGA V TTA SE K  
Sbjct: 121 ALPEVACTVWANVFMTAQLREGEALLVHGGASGIGTFAIQAARAFGARVLTTAGSEAKLA 180

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
            C +LGA  AINY  EDF   +++ET GRG+D++LD++G  YL  +L  L+  G+L++I 
Sbjct: 181 RCRELGADVAINYRSEDFAARVREETGGRGVDVVLDIMGGSYLEANLRSLAVGGRLVVIG 240

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
            +GG  A E++L  ++ KR+++  +TLR R    K +I   +  ++WPL+    I PV+ 
Sbjct: 241 LMGGRRA-ELDLGRMLIKRLSVHAATLRSRPLEEKAAIVAQVTERVWPLVERGEIRPVVD 299

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIILL 331
            VLPL + A AH ++E SEH+GKI+L+
Sbjct: 300 RVLPLSQAAEAHRVLEASEHVGKILLV 326


>gi|254450587|ref|ZP_05064024.1| alcohol dehydrogenase, zinc-containing [Octadecabacter antarcticus
           238]
 gi|198264993|gb|EDY89263.1| alcohol dehydrogenase, zinc-containing [Octadecabacter antarcticus
           238]
          Length = 327

 Score =  302 bits (774), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 216/324 (66%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G   V+ L + P P+P   ++ IKV   GVNRPD +QR GLY PPK A+P+
Sbjct: 6   MKAVEIAKAGGPEVLTLIDMPKPEPAFGQVRIKVAYAGVNRPDALQRAGLYNPPKGASPL 65

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG I  +G   T W IGD VCAL+ GGGYA+  ++   H LP+P G +  QAA L
Sbjct: 66  PGLEAAGAISAIGAGVTGWAIGDAVCALLPGGGYAQEVVTPAAHCLPLPDGLSLKQAACL 125

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    LR+G+  L+HGGSSGIGTTAIQL   FGA V+TTA SE KC AC
Sbjct: 126 PETFFTVWSNVFMRGGLRAGERFLVHGGSSGIGTTAIQLGHAFGARVFTTAGSEAKCRAC 185

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA+  +NY   DF++  + + QG G ++ILDMVG +YL +++  L+ +G+L+ I+FL
Sbjct: 186 LDLGAEVVMNYRDVDFVD--EIKAQG-GANLILDMVGGDYLPRNVRALADDGRLVQIAFL 242

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    E+N   ++ +R+TITGSTLR ++D+AK  I   L+  +WPLL S  I+PV+   
Sbjct: 243 QGPT-IELNFAHLMMRRLTITGSTLRPQSDLAKAEIALQLRTHVWPLLASGKISPVMDQE 301

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   + AH  ME S+HIGKI+L
Sbjct: 302 FALADASAAHTRMESSQHIGKIVL 325


>gi|217072752|gb|ACJ84736.1| unknown [Medicago truncatula]
          Length = 325

 Score =  302 bits (773), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 147/325 (45%), Positives = 212/325 (65%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++  G+  V+ L E   PQ + +E+LIKV A  +NR D +QRKG YPPP+ A+P 
Sbjct: 1   MKAIVITKPGEPEVLQLQEVQDPQIKDDEVLIKVHATALNRADTLQRKGAYPPPQGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G I  +G+N + W IGD+VCAL+ GGGYAE     +G  LP+P G +   AAS 
Sbjct: 61  PGLECSGIIEFVGKNVSKWKIGDQVCALLAGGGYAEKVAVAEGQVLPVPPGISLKDAASF 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F T+ L  G+T+LIHGGSSGIGT AIQ+A Y G+ V+ TA SEEK   C
Sbjct: 121 PEVACTVWSTIFMTSRLSKGETLLIHGGSSGIGTFAIQIAKYLGSRVFVTAGSEEKLAFC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             +GA   INY  EDF+  +++ET G+G+D+ILD +GA Y  ++L  L+ +G+L II F 
Sbjct: 181 KSIGADVGINYKTEDFVARVKEETGGQGVDVILDCMGASYYQRNLASLNFDGRLFIIGFQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG ++TE++L  +  KR+T+  + LR R+   K  I   ++  +WP +    + PV++  
Sbjct: 241 GG-VSTELDLRALFGKRLTVQAAGLRSRSPENKAVIVAEVEKNVWPAIAEGKVKPVVYKS 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
            PL + A AH +ME S+HIGKI+L+
Sbjct: 300 FPLSEAAEAHRLMESSQHIGKILLV 324


>gi|120597520|ref|YP_962094.1| alcohol dehydrogenase [Shewanella sp. W3-18-1]
 gi|120557613|gb|ABM23540.1| Alcohol dehydrogenase, zinc-binding domain protein [Shewanella sp.
           W3-18-1]
          Length = 333

 Score =  301 bits (772), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 216/322 (67%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           H+ +   G   VM LA SP+P P   ++LI+V A GVN PD+ QR G+YPPP  A+PI+G
Sbjct: 10  HIHIEQAGAPEVMQLARSPLPIPSAGQVLIRVHAAGVNGPDIKQRVGIYPPPPGASPIIG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG+I  LG+    W IGD+VCALV GGGY EY L++  H LPIP  ++ +QAA+LPE
Sbjct: 70  LEVAGEICALGDGVNQWQIGDKVCALVPGGGYGEYALTYAAHCLPIPTDFSYVQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           + FTVW NLF  A L++G+TVLIHGGS GIG+TAIQLAS  GA V  T   +EK   CL 
Sbjct: 130 TLFTVWGNLFMRAGLKAGETVLIHGGSGGIGSTAIQLASALGAKVIATTGKDEKRDYCLG 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA   INY  ++F+E +   TQ +G++++ D+ G +++N +L  L+ +G+++ ++   G
Sbjct: 190 LGAHEVINYQSQNFVEAVMAFTQDKGVNVVFDIAGGDFINLNLQALAMDGRMVSVAMQRG 249

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+ L  +++KRI  TGSTLR ++  +K +I + LQ  +WPLL+SH I P I    P
Sbjct: 250 PKA-EVELFRLMAKRIVWTGSTLRPQSVESKAAIANELQTTVWPLLDSHKIVPNIFATFP 308

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           L +   AH +ME  EH GK++L
Sbjct: 309 LNEAPKAHALMESGEHRGKVVL 330


>gi|206563946|ref|YP_002234709.1| putative GroES binding Zinc alcohol dehydrogenase [Burkholderia
           cenocepacia J2315]
 gi|198039986|emb|CAR55965.1| putative GroES binding Zinc alcohol dehydrogenase [Burkholderia
           cenocepacia J2315]
          Length = 343

 Score =  301 bits (772), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 145/317 (45%), Positives = 214/317 (67%), Gaps = 2/317 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  +V+  A  P+P+P  E++LI+V A GVN PDV QRKG Y PP  A+ I GLE+AG++
Sbjct: 21  GGPDVLVPARRPVPRPTDEQVLIRVHAAGVNGPDVFQRKGFYNPPPGASDIPGLEIAGEV 80

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +D+G     +  GD VCALV GGGYAEY ++    T+ +PKG   ++AA++PE+F TVW 
Sbjct: 81  IDVGSAVKRFKRGDVVCALVTGGGYAEYAVADHRVTMTLPKGLGVVEAAAMPETFMTVWL 140

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHA 194
           NLFQ   L++G++VLIHGG+SGIGTTA  LA  FGA+ V TT  SE    A L+LGA HA
Sbjct: 141 NLFQRGKLQAGESVLIHGGASGIGTTATMLAKAFGASKVMTTVGSEVHREASLRLGANHA 200

Query: 195 INYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEI 254
           INY  EDF+E + + T G G+D+ILD++  +Y+ ++ T+ +  G+++ +S L G  A ++
Sbjct: 201 INYRDEDFVEKVNEFTNGNGVDVILDIIAGDYVARNYTIAAMNGRILQVSVLKGP-AKDL 259

Query: 255 NLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAM 314
           +L P+++KR+T  GSTLR RT   K  I   L++ +WPL+ + ++ P ++   PL     
Sbjct: 260 DLWPMMTKRLTHIGSTLRSRTPNEKAEIIRELEMHVWPLIQAGMVKPQVYKTFPLKDARG 319

Query: 315 AHDIMEKSEHIGKIILL 331
           AH++++   HIGKI+L+
Sbjct: 320 AHELIDSGVHIGKIVLV 336


>gi|300023966|ref|YP_003756577.1| NAD(P)H quinone oxidoreductase, PIG3 family [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525787|gb|ADJ24256.1| NAD(P)H quinone oxidoreductase, PIG3 family [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 336

 Score =  301 bits (772), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 154/330 (46%), Positives = 216/330 (65%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M     M+ V + G G   V+ + + P+P P   ++LIKV A GVNRPDV+QR+G YP P
Sbjct: 6   MSAQTSMKAVVIKGKGGPEVLQVRDLPVPTPGAGDVLIKVAAAGVNRPDVLQRQGNYPAP 65

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K  + + GLEVAG +  LGE      +GD V AL  GGGYAEY ++     +  P+  + 
Sbjct: 66  KGHSELPGLEVAGLVAALGEGVNGLAVGDAVLALTPGGGYAEYAIAPALCCIRKPEALSF 125

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           I AA++PE+FFTVW N+F+   L++G+T L+HGG+SGIG TAIQLA  FGA V TT  S+
Sbjct: 126 IDAAAIPETFFTVWHNVFERGALKAGETFLVHGGTSGIGVTAIQLAKAFGARVITTVGSD 185

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC A   LGA  AINY  +DF E+++ ET  RG+D+ILDMVG +Y+++++  L+ +G+L
Sbjct: 186 EKCEAARALGADIAINYRTQDFSEVVKTETGKRGVDVILDMVGGDYIDKNIRALADDGRL 245

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I++  G+ AT I+   ++ KR+TITGSTLR R++  K  I  +L+ K+ PL+ S  I 
Sbjct: 246 VNIAYQKGSTAT-IDFIRVMLKRLTITGSTLRIRSNDVKGGIARALEEKVIPLVASGKIK 304

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + +  PL   A AH  ME SEHIGKI+L
Sbjct: 305 IPVDSTFPLADAAKAHARMESSEHIGKIVL 334


>gi|114762286|ref|ZP_01441744.1| Zinc-containing alcohol dehydrogenase superfamily protein
           [Pelagibaca bermudensis HTCC2601]
 gi|114544904|gb|EAU47908.1| Zinc-containing alcohol dehydrogenase superfamily protein
           [Roseovarius sp. HTCC2601]
          Length = 333

 Score =  301 bits (772), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 151/329 (45%), Positives = 212/329 (64%), Gaps = 1/329 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + +  R V   G G   V+ + E P P+P   ++LI+V A G+NRPDVMQR+G YPPP  
Sbjct: 1   MTETTRAVIADGAGGPEVLRVTEIPRPEPGPGQLLIEVHAAGINRPDVMQRQGNYPPPPG 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A  + GLE+AG +  LGE    + IGD V  LV+ G YA++ L      +P+P+G +  +
Sbjct: 61  ATDVFGLELAGAVAALGEGVEGFAIGDRVMGLVHSGAYADWALLDAPIAIPVPEGMSMAE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           A ++PE+FFTVW+N+F+ A L+ G+T+LIHGG+SGIGTTAI LA   G+TV  TA S+EK
Sbjct: 121 AGAVPETFFTVWSNVFERAALQPGETLLIHGGTSGIGTTAILLAKALGSTVIVTAGSDEK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C A   LGA HAINY  +DF+   +  T GRG D+ILDMVG  Y+ +++ LL+ +G++  
Sbjct: 181 CAAARALGADHAINYRTQDFVAEGRALTDGRGPDVILDMVGGSYMQRNIELLAADGRIAQ 240

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+F  G+ A E++L P++ KR TIT STLR R    K  +  +L   + PLL S  + P 
Sbjct: 241 IAFQQGSKA-ELDLLPLLMKRGTITASTLRARPVEMKARLARALTEHVVPLLASGAVRPP 299

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
           + +  PL  VA AH  M+ S H+GKI+LL
Sbjct: 300 VDSTFPLADVAKAHARMDSSAHVGKIVLL 328


>gi|92119008|ref|YP_578737.1| zinc-binding alcohol dehydrogenase [Nitrobacter hamburgensis X14]
 gi|91801902|gb|ABE64277.1| Alcohol dehydrogenase, zinc-binding protein [Nitrobacter
           hamburgensis X14]
          Length = 332

 Score =  301 bits (771), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 215/326 (65%), Gaps = 1/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           ++M  + +S  G   V+     P+P P   EILI+V   GVNRPDV QR G YPPP  A+
Sbjct: 6   EQMTVIGISRPGGPEVLVPETRPVPAPGPNEILIRVAVAGVNRPDVAQRSGTYPPPPGAS 65

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            + GLEVAG++V LGE  + +  GD+V +LV+GGGYA+YC++H+   +  P G + ++A 
Sbjct: 66  DLPGLEVAGEVVALGEGASQYKPGDKVMSLVSGGGYAQYCVAHESIAMRNPAGLSMLEAG 125

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           + PE+  TVW N+F+   L++G+T+LIHGGSSGIGT AIQLA  FGA V  T  S++K  
Sbjct: 126 ATPETLMTVWHNVFERGGLKAGETLLIHGGSSGIGTMAIQLAKAFGAKVIVTVGSKDKAD 185

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           ACL+LGA HA+NY  +DF+  ++  T G G D+ILDMVG +Y+ ++  + + +G+++ I+
Sbjct: 186 ACLRLGADHAVNYKTQDFVAEVKALTGGTGADLILDMVGGDYIEKNYDVAAIDGRIVQIA 245

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           FLGG  AT +N   ++ KR+  TGSTLR R+   K ++  +++ ++ PL+    I P+I 
Sbjct: 246 FLGGAKAT-VNFAKLMVKRLHHTGSTLRPRSIADKAAMVGAIEARVLPLMREGRIKPLID 304

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +  PL K A AH  ME   HIGKI+L
Sbjct: 305 SSFPLDKAADAHRRMETGAHIGKIVL 330


>gi|114328012|ref|YP_745169.1| quinone oxidoreductase [Granulibacter bethesdensis CGDNIH1]
 gi|114316186|gb|ABI62246.1| quinone oxidoreductase [Granulibacter bethesdensis CGDNIH1]
          Length = 336

 Score =  301 bits (771), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 216/330 (65%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +  +M  + + G G    +    +P+P P + E++I+V A G+NRPD+MQR GLYPPP
Sbjct: 4   MTLPDRMAMIRVDGAGGPETLRYENAPLPVPAEGEVMIRVRAAGINRPDLMQRSGLYPPP 63

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             A+P LGLEVAG++  LG   T    G++V AL NGGGYAEYC       LP P+G++ 
Sbjct: 64  PGASPHLGLEVAGEVATLGAGVTTLQQGEKVTALTNGGGYAEYCAVPATQCLPYPEGFDD 123

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           I+AA+LPE+FFTVWAN+F    L+ G+ +L+HGGS GIG++AIQLAS  GATVY TA   
Sbjct: 124 IRAAALPETFFTVWANVFMLGRLQKGEKLLVHGGSGGIGSSAIQLASTMGATVYATAGGA 183

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           EKC AC   GA  +I+Y  ++F + + + T  +G+D+ILDM+G  YL  ++  L+  G+L
Sbjct: 184 EKCAACRAWGAVESIDYKTKNFADAVAELTGKKGVDVILDMIGGSYLAANIRSLAAGGRL 243

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I+  GG    E +L  ++++R+T+TGSTLR R+   K +I  +L+  +WPLL++  I 
Sbjct: 244 VTIALQGGAKG-EADLARVMTRRLTLTGSTLRPRSKEEKAAIAQALKEHVWPLLSAGRIG 302

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P +H V PL K   AH +ME   H GKIIL
Sbjct: 303 PHVHAVFPLHKAEEAHRLMESGAHTGKIIL 332


>gi|262281213|ref|ZP_06058995.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257444|gb|EEY76180.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 332

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 155/330 (46%), Positives = 211/330 (63%), Gaps = 2/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   M+ + ++  G   V+ + E+ IP PQ +E+LI+V+A G+NRPDV+QR GLYP P
Sbjct: 1   MTLPTTMKIIEITAPGGPEVLKVQEANIPVPQADEVLIEVKAAGINRPDVLQRMGLYPMP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K    I GLEVAG +V +G+    + +GD+VCAL NGGGYAEYC       LPIP+  + 
Sbjct: 61  KGVTQIPGLEVAGVVVAVGDQVQQFKVGDKVCALTNGGGYAEYCAVAATQVLPIPENLSF 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA++PE+FFTVWANLF    L++ +T LIHGG+SGIGTTA+ +    G   + T  SE
Sbjct: 121 TQAAAIPETFFTVWANLFDIGRLKANETALIHGGASGIGTTALAICHALGIKTFATVGSE 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +K  A   L    AINY  +DF + + K TQ +G+D+ILD+VG  Y  ++L LL ++G+L
Sbjct: 181 DKVEALSDLTT--AINYKTQDFEQEILKHTQDQGVDVILDIVGGSYFQKNLNLLKRDGRL 238

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +II F+GG IA E +L  +I KR TITGST+R RT   K  I  SL   +WPLL      
Sbjct: 239 VIIGFMGGRIAKEFDLQKLILKRATITGSTMRARTSEEKAQIAQSLHKHVWPLLAQGKCL 298

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I+       V  AH+ ME+ +HIGKI+L
Sbjct: 299 PQIYKTYAFSDVQSAHECMEQGDHIGKIVL 328


>gi|85375464|ref|YP_459526.1| NADPH quinone oxidoreductase [Erythrobacter litoralis HTCC2594]
 gi|84788547|gb|ABC64729.1| NADPH quinone oxidoreductase [Erythrobacter litoralis HTCC2594]
          Length = 336

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 146/326 (44%), Positives = 210/326 (64%), Gaps = 1/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           K M  + M   G  +V+    + +PQP   E+L++V   GVNRPD +QR G YP P  A+
Sbjct: 7   KNMTAIGMDRPGAPDVLRTETADVPQPGPGEVLVQVAWAGVNRPDCIQRAGHYPAPPGAS 66

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           PILGLEV+G+I+ LG+      +G+ VCAL  GGGYAEYC    GH LP+P      QAA
Sbjct: 67  PILGLEVSGRIIALGDGVPETLLGETVCALTPGGGYAEYCKVPVGHCLPVPDDLPLDQAA 126

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           ++PE+ FTVW N+FQ    R G+T+L+HGG+SGIGT A  LA  F   V  T   + KC 
Sbjct: 127 AVPETLFTVWHNVFQRGCAREGETLLVHGGTSGIGTMATMLAKAFDMQVIVTCGDDAKCE 186

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           A  ++GA HAINY  +DF+E ++  T+G+G++++LDMV  +Y+ ++L  L+++G+ + I+
Sbjct: 187 AAREVGADHAINYKTQDFVEEVKAITRGKGVEVVLDMVSGDYVARNLKCLAEDGRHVTIA 246

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
            LGG +  E+N+  I+S+R+T+TGSTLR R+D  K ++ D +    WPL+ +  I PV+ 
Sbjct: 247 VLGG-MQAELNMAFIMSRRLTLTGSTLRPRSDAFKTALCDEIGQIAWPLILNGTIRPVMD 305

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
              PL   A AH  ME  +HIGKI+L
Sbjct: 306 RSFPLADAASAHARMEAGDHIGKIVL 331


>gi|226953244|ref|ZP_03823708.1| zinc-containing NADPH dependent oxydoreductase protein, quinone
           oxidoreductase [Acinetobacter sp. ATCC 27244]
 gi|226836012|gb|EEH68395.1| zinc-containing NADPH dependent oxydoreductase protein, quinone
           oxidoreductase [Acinetobacter sp. ATCC 27244]
          Length = 334

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 211/326 (64%), Gaps = 2/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           ++M+++ ++  G   V+ + +   P+ +++E+LI+V A G+NRPD++QR+GLYP PK   
Sbjct: 7   EQMKYIEITQAGGPEVLKVIQGKKPEIKEDEVLIEVYATGINRPDILQRQGLYPMPKGVT 66

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            I GLEVAG I  +G     + +GD+VCAL NGGGYAEYC      TL IPK  + I+AA
Sbjct: 67  QIPGLEVAGIISQIGSKVEKFKVGDKVCALTNGGGYAEYCAVPANQTLSIPKNLSFIEAA 126

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           ++PE++FTVWANLFQ   L+  +TVLIHGG+SGIG+TA+ L    G   ++T  SEEK  
Sbjct: 127 AIPETYFTVWANLFQIGQLKKKETVLIHGGASGIGSTALSLCHAMGIQTFSTVGSEEKVE 186

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
               +     INY K+DF + +   T  +G+D+ILD++GA Y NQ+L LL ++G+L+II 
Sbjct: 187 KLSSIST--VINYQKQDFEQEILSRTDQQGVDVILDIIGAAYFNQNLRLLKRDGRLVIIG 244

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           F+GG      ++  ++ KR  +TGST+R RT+  K  I   L+  +WPL+ +    P+I+
Sbjct: 245 FMGGRKVDGFDIQELMLKRAVVTGSTMRARTNDEKAKITQELEQLVWPLIETGQCKPIIY 304

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
                 +VA AH  +E SEHIGK++L
Sbjct: 305 KTFAFEEVAAAHQCLESSEHIGKVVL 330


>gi|229589886|ref|YP_002872005.1| putative dehydrogenase [Pseudomonas fluorescens SBW25]
 gi|229361752|emb|CAY48634.1| putative dehydrogenase [Pseudomonas fluorescens SBW25]
          Length = 332

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 150/330 (45%), Positives = 215/330 (65%), Gaps = 1/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + ++M  + ++  G   V+    + +P     EILI+V A GVNRPD +QR G YP  
Sbjct: 1   MTLPQEMTLIEITTPGGPEVLQPRRAEVPVAGPGEILIRVHAAGVNRPDALQRAGKYPMK 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
              +PI GLEVAG++V LG+  + + +GD+VCAL NGGGYA++C       LPIP+G + 
Sbjct: 61  PGFSPIPGLEVAGEVVALGDGVSEYQLGDKVCALTNGGGYAQFCSVPASQALPIPEGMDW 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           IQAA++PE+FFTVWANLF   +  +GQ VLIHGG+SGIGTTA+ L   FG   + TA S 
Sbjct: 121 IQAAAVPETFFTVWANLFGLGDAHTGQRVLIHGGTSGIGTTALMLCREFGIQAFATAGSA 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +KC A   LGA+  INY ++DF E++ ++T  +G+++ILD++GA YLN +L  L+ +G L
Sbjct: 181 DKCAAIATLGAE-PINYREQDFAEVIAQKTDDQGVNVILDIMGASYLNNNLKALAMDGHL 239

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +++ FLGG  A +++L  I++KR  ITGS LR R+   K +I + L+  IWP+L +    
Sbjct: 240 VMLGFLGGGKANDVDLLSILAKRAVITGSLLRARSKDEKAAIAEQLREYIWPVLAAGRCL 299

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P+I  V      A AH  ME  +HIGKI+L
Sbjct: 300 PIIDKVYAYTDAAQAHARMEGGDHIGKIVL 329


>gi|146338204|ref|YP_001203252.1| putative NADPH quinone oxidoreductase [Bradyrhizobium sp. ORS278]
 gi|146191010|emb|CAL75015.1| putative NADPH quinone oxidoreductase [Bradyrhizobium sp. ORS278]
          Length = 340

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 147/325 (45%), Positives = 213/325 (65%), Gaps = 1/325 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           +M  VA+S  G   V+     P+P+P   EILIKV+A GVNRPDV QR G YPPP  A+ 
Sbjct: 15  QMTVVAISQPGGPEVLKPETRPVPKPGPGEILIKVKAAGVNRPDVAQRSGSYPPPPGASD 74

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           + GLEVAG++V LGE      +GD V +LV GGGYA+YC++     + +    + ++A +
Sbjct: 75  LPGLEVAGEVVALGEGAVRHKLGDTVMSLVAGGGYAQYCIAQDAQAMTVAPALSILEAGA 134

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+  TVW N+F+   L+ G+T+L+HGGSSGIGT AIQLA  FGA V  T  S++K  A
Sbjct: 135 LPETLMTVWHNVFERGGLKEGETLLVHGGSSGIGTMAIQLAKAFGAKVLVTVGSQDKADA 194

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C+KLGA  AINY  EDF+ ++++ T G+G ++ILDMVG +Y+ ++    + +G+++ I+F
Sbjct: 195 CVKLGADRAINYKTEDFVAVVKEATGGKGANVILDMVGGDYIERNYDAAATDGRIVQIAF 254

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           LG   AT +N   ++ KR+T TGSTLR R++  K ++  +++ K+ P L    I P++ +
Sbjct: 255 LGSPKAT-VNFVKLMVKRLTHTGSTLRPRSNADKAAMVAAIEAKVMPFLREGRIKPLMDS 313

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
              L   A AH  ME S+HIGKI+L
Sbjct: 314 TFQLSDAAKAHARMETSQHIGKIVL 338


>gi|319427701|gb|ADV55775.1| NAD(P)H quinone oxidoreductase, PIG3 family [Shewanella
           putrefaciens 200]
          Length = 333

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 216/322 (67%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           H+ +   G   VM LA SP+P P   ++LI+V A GVN PD+ QR G+YPPP  A+PI+G
Sbjct: 10  HIHIEQAGAPEVMQLARSPLPIPSAGQVLIRVHAAGVNGPDIKQRVGIYPPPPGASPIIG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG+I  LG+    W IGD+VCALV GGGY EY L++  H LPIP  ++ +QAA+LPE
Sbjct: 70  LEVAGEICALGDGVNQWQIGDKVCALVPGGGYGEYALTYAAHCLPIPTDFSYVQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           + FTVW NLF  A L++G+TVLIHGGS GIG+TAIQLAS  G+ V  T   +EK   CL 
Sbjct: 130 TLFTVWGNLFMRAGLKAGETVLIHGGSGGIGSTAIQLASALGSKVIATTGKDEKRDYCLG 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA   INY  ++F+E +   TQ +G++++ D+ G +++N +L  L+ +G+++ ++   G
Sbjct: 190 LGAHEVINYQSQNFVEAVMAFTQDKGVNVVFDIAGGDFINLNLQALAMDGRMVSVAMQRG 249

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+ L  +++KRI  TGSTLR ++  +K +I + LQ  +WPLL+SH I P I    P
Sbjct: 250 PKA-EVELFRLMAKRIVWTGSTLRPQSVESKAAIANELQTTVWPLLDSHKIVPNIFATFP 308

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           L +   AH +ME  EH GK++L
Sbjct: 309 LNEAPKAHALMESGEHRGKVVL 330


>gi|146294339|ref|YP_001184763.1| alcohol dehydrogenase [Shewanella putrefaciens CN-32]
 gi|145566029|gb|ABP76964.1| Alcohol dehydrogenase, zinc-binding domain protein [Shewanella
           putrefaciens CN-32]
          Length = 333

 Score =  300 bits (769), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 216/322 (67%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           H+ +   G   VM LA SP+P P   ++LI+V A GVN PD+ QR G+YPPP  A+PI+G
Sbjct: 10  HIHIEQAGAPEVMQLARSPLPIPSAGQVLIRVHAAGVNGPDIKQRVGIYPPPPGASPIIG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG+I  LG+    W IGD+VCALV GGGY EY L++  H LPIP  ++ +QAA+LPE
Sbjct: 70  LEVAGEICALGDGVNRWQIGDKVCALVPGGGYGEYALTYAAHCLPIPTDFSYVQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           + FTVW NLF  A L++G+TVLIHGGS GIG+TAIQLAS  G+ V  T   +EK   CL 
Sbjct: 130 TLFTVWGNLFMRAGLKAGETVLIHGGSGGIGSTAIQLASALGSKVIATTGKDEKRDYCLG 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA   INY  ++F+E +   TQ +G++++ D+ G +++N +L  L+ +G+++ ++   G
Sbjct: 190 LGAHEVINYQSQNFVEAVMAFTQDKGVNVVFDIAGGDFINLNLQALAMDGRMVSVAMQRG 249

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+ L  +++KRI  TGSTLR ++  +K +I + LQ  +WPLL+SH I P I    P
Sbjct: 250 PKA-EVELFRLMAKRIVWTGSTLRPQSVESKAAIANELQTTVWPLLDSHKIVPNIFATFP 308

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           L +   AH +ME  EH GK++L
Sbjct: 309 LNEAPKAHALMESGEHRGKVVL 330


>gi|309811748|ref|ZP_07705525.1| NAD(P)H quinone oxidoreductase, PIG3 family [Dermacoccus sp.
           Ellin185]
 gi|308434294|gb|EFP58149.1| NAD(P)H quinone oxidoreductase, PIG3 family [Dermacoccus sp.
           Ellin185]
          Length = 323

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 150/325 (46%), Positives = 215/325 (66%), Gaps = 5/325 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESP-IPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           M+ + +S +G  NVM LAE P +P P+ + I IKV A GVNR D++QR+G YPPP   + 
Sbjct: 1   MKAIMLSEFGDENVMTLAEVPDLPAPEGDSIRIKVAAAGVNRADLLQRQGHYPPPAGESD 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           +LGLEV+G I  LG +   W +GDEVCAL+ GGGYAEY     G  LP+P+G + + AA+
Sbjct: 61  VLGLEVSGTIDALGPDVVGWRVGDEVCALLAGGGYAEYVNVRVGQVLPVPRGVDLMTAAA 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE   TVW+N+  TA+L+ G+ +L+HGGSSGIGT AIQLA+  GA V  TA S EK  A
Sbjct: 121 LPEVAATVWSNVVFTADLQPGELLLVHGGSSGIGTMAIQLATALGARVAVTAGSAEKLAA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C  LGA+  INY +EDF++ +  E    G ++ILD+VGA+YL++++  L+  G+L+II  
Sbjct: 181 CKALGAQILINYREEDFVDAVAAEG---GANVILDVVGAKYLSRNIDALAPNGRLVIIGM 237

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
            GG  A E++L  +++KR  +T ++LR R    K +I   ++  +WPL+ S  + P++H 
Sbjct: 238 QGGAKA-ELDLAKLLAKRAQVTATSLRSRPLAEKAAIVREVRDTVWPLVESGAVRPIVHA 296

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL + A AH  +  S HIGK++L
Sbjct: 297 TYPLAQAADAHRELAASGHIGKVLL 321


>gi|238758137|ref|ZP_04619317.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           aldovae ATCC 35236]
 gi|238703675|gb|EEP96212.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           aldovae ATCC 35236]
          Length = 326

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 214/325 (65%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +S +G   V+     P P P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 1   MVAIEISQFGGPEVLSAVTRPTPMPAASEILVKVSAAGVNRPDVMQRRGHYAPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG++V +  + + + IGD+VC L+ GGGYA++C  H+ + L IP G  AI+AA+L
Sbjct: 61  PGLEVAGEVVAMAADVSRFKIGDKVCGLIAGGGYAQFCAIHETNALRIPAGLTAIEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLA 185
           PE+FFTVWANLFQ  +L +G+TVLIHGGSSGIGTTA  L+  FGA  V  T  SEEK  A
Sbjct: 121 PETFFTVWANLFQRGHLTAGETVLIHGGSSGIGTTATLLSKAFGAKMVIVTVGSEEKRQA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA  AINY   DF+   ++ T G+G+D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 181 CLSLGADVAINYHTHDFVAETKRATAGKGVDVIVDLIAGDYVARNYEAAAMNGRIVQIGT 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             GN A ++NL  ++ KR+T TGSTLR R+   K  I   L+ ++WPLL    + P I  
Sbjct: 241 QNGN-AKDLNLMLLLLKRLTHTGSTLRSRSVAEKALIARELEQQVWPLLGESKMKPQIFR 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL +V+ AH++ME S HIGKI+L
Sbjct: 300 TFPLEQVSKAHELMESSTHIGKIVL 324


>gi|260548927|ref|ZP_05823149.1| NADPH:quinone oxidoreductase [Acinetobacter sp. RUH2624]
 gi|260408095|gb|EEX01566.1| NADPH:quinone oxidoreductase [Acinetobacter sp. RUH2624]
          Length = 332

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 155/330 (46%), Positives = 210/330 (63%), Gaps = 2/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   M+ V ++  G   V+ L +S +P PQ +E+LI+++A G+NRPDV+QR GLYP P
Sbjct: 1   MSLPTTMKIVEITVPGGPEVLKLQDSDVPVPQADEVLIEIKAAGINRPDVLQRMGLYPMP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K    I GLEVAG +V +G+   H+ +GD+VCAL NGGGYAEYC       LPIP+  + 
Sbjct: 61  KGVTQIPGLEVAGVVVAVGDQVQHFKVGDKVCALTNGGGYAEYCTVTATQVLPIPENLSF 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA++PE+FFTVWANLF    L+  +T LIHGG+SGIGTTA+ +    G   + T  SE
Sbjct: 121 TQAAAIPETFFTVWANLFDIGRLKENETALIHGGASGIGTTALAICHALGIKTFATVGSE 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +K  A   L    AINY  +DF + + K TQ +G+D+ILD+VG  Y +++L LL ++G+L
Sbjct: 181 DKVEALSNLTT--AINYKTQDFEQEILKHTQDQGVDVILDIVGGSYFSKNLNLLKRDGRL 238

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +II F+GG IA E +L  +I KR TITGST+R R    K  I  SL   +WPLL      
Sbjct: 239 VIIGFMGGRIAKEFDLQKLILKRATITGSTMRARNSQEKAQIAQSLHEHVWPLLAQGKCL 298

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I+       V  AH  ME+ +HIGKI+L
Sbjct: 299 PQIYKTYDFSDVQSAHACMEQGDHIGKIVL 328


>gi|212711869|ref|ZP_03319997.1| hypothetical protein PROVALCAL_02944 [Providencia alcalifaciens DSM
           30120]
 gi|212685391|gb|EEB44919.1| hypothetical protein PROVALCAL_02944 [Providencia alcalifaciens DSM
           30120]
          Length = 325

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 211/314 (67%), Gaps = 2/314 (0%)

Query: 18  SNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVD 77
           S+ + L E P+P+     +++KVEA GVNRPD+ QRKG YPPP +A+PI+GLEV+G +V 
Sbjct: 12  SDELQLIEIPLPKLLAGHLIVKVEAAGVNRPDIFQRKGSYPPPPDASPIMGLEVSGTVVA 71

Query: 78  LGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANL 137
             ++ T WNIGD +CALV GGGYAEYCL HQ   LP+    +  + A++PE+FFTVWAN+
Sbjct: 72  KADDVTQWNIGDRICALVAGGGYAEYCLVHQDIALPL-GNLSFEEGAAIPENFFTVWANM 130

Query: 138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINY 197
           FQ   L+ G+TVLIHGG+SGIG+ AI LA  FGATV TT  SEEK      LGA   INY
Sbjct: 131 FQIGQLKQGETVLIHGGTSGIGSVAIMLAKAFGATVITTVGSEEKAAVAKSLGADCVINY 190

Query: 198 LKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLN 257
              DF+   Q  T  +G+++++D++G +Y++++  + +K G++I I  + GN  T++N+ 
Sbjct: 191 RTNDFVTATQDFTSHKGVNMVVDIIGGDYVSKNYVVAAKFGRIIQIGMMKGN-PTQLNMM 249

Query: 258 PIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHD 317
           P++ KR+  TGST+R R++  K  I   L  ++W ++ S  I P+I+ +  L +V  AH 
Sbjct: 250 PLMVKRLIHTGSTMRSRSNEEKAQIARELYQQVWDIVQSGKIKPIINKIYTLNQVESAHQ 309

Query: 318 IMEKSEHIGKIILL 331
            ME  + IGKIIL+
Sbjct: 310 HMESGDLIGKIILI 323


>gi|295095490|emb|CBK84580.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 341

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 143/325 (44%), Positives = 210/325 (64%), Gaps = 2/325 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           +M+ + ++  G   V+ +++  IP+  + E+LI V+A GVNRPD+MQR+G YP P+   P
Sbjct: 16  EMKLIEITKPGGPEVLKVSQGKIPECGENEVLISVKAAGVNRPDIMQREGKYPMPEGVTP 75

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           + GLEVAG +  +G+N TH+++GD VCAL NGGGYAE+C       LP P   +  +AA+
Sbjct: 76  VPGLEVAGIVHAIGKNVTHFSVGDRVCALTNGGGYAEFCAVPVSQVLPAPNNLSLTEAAA 135

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE++FTVWANLF    ++ G  VLIHG +SGIGTTA+ L S     ++ T  S+E+ LA
Sbjct: 136 LPETYFTVWANLFALGKVKPGDVVLIHGAASGIGTTALALCSAMNIKLFGTVGSDEQVLA 195

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
             K G    IN+  ++F E +   T G+G+D+ILD+VGA Y N++L +L K+G+L++I F
Sbjct: 196 LKKYG--EMINFRTQNFEEEILGRTDGKGVDVILDIVGASYFNKNLHILKKDGRLVLIGF 253

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           +GG +  E ++  +I KR  +TGST+R R +  K  I   L   +WPL+ S    PVIH 
Sbjct: 254 MGGRVVKEFDIQELILKRALVTGSTMRSRNNAEKGEIAQQLIQNVWPLIESGKCKPVIHR 313

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
           V+    V  AH+++E   HIGK+IL
Sbjct: 314 VVKFEDVRTAHELLEAGNHIGKVIL 338


>gi|217976297|ref|YP_002360444.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylocella
           silvestris BL2]
 gi|217501673|gb|ACK49082.1| NAD(P)H quinone oxidoreductase, PIG3 family [Methylocella
           silvestris BL2]
          Length = 328

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 150/324 (46%), Positives = 208/324 (64%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR+    G G   V+ + E+  P P   E+LI+V A GVNRPD MQR G YPPP   + I
Sbjct: 1   MRYAYFDGAGGPEVIRIGEAARPAPGPGEVLIEVVAAGVNRPDCMQRAGSYPPPPGESNI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG+IV LGE  T +  GD VCAL+  GGYA+Y ++     LP P+G +  +AA+L
Sbjct: 61  PGLEVAGRIVALGEGVTGFEAGDSVCALLGSGGYADYAVAAAPLCLPAPQGLSFEEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTV+ N+F    L +G+T L+HGGSSGIG+ AIQLA   GA V  TA S+ KC  C
Sbjct: 121 PENVFTVYDNVFTRGRLAAGETFLVHGGSSGIGSIAIQLAKASGAIVIATAGSDAKCAFC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA  +INY  +DF    +      G+D+ILDMVGA YL ++L+LL+ EG+L+ I+  
Sbjct: 181 RTLGADLSINYKTQDFAAETKAFAGEHGVDVILDMVGAPYLAKNLSLLAFEGRLVEIACS 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG      NL P++ +R+T+TGSTLR RT   K ++  +++ ++WPL+ +  + P++H  
Sbjct: 241 GGGRVEAFNLWPVLIRRLTLTGSTLRARTLAQKAAVAAAVRERVWPLIEAGKVRPLVHAT 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL +   AH++ME S H GKI+L
Sbjct: 301 FPLEQTWAAHELMESSAHTGKIVL 324


>gi|238764355|ref|ZP_04625305.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           kristensenii ATCC 33638]
 gi|238697381|gb|EEP90148.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           kristensenii ATCC 33638]
          Length = 332

 Score =  299 bits (765), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 158/325 (48%), Positives = 213/325 (65%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G   V+   + P P P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 1   MVSIEITQPGGPKVLVPVDRPTPMPAAGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +V +  + + + IGD+VC LV GGGYA+YC+ H+ + LPIP     I+AA+L
Sbjct: 61  PGLEVAGTVVAVAADVSRFKIGDKVCGLVAGGGYAQYCVIHETNALPIPPNLTEIEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLA 185
           PE+FFTVW NLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FGA  V  T  SEEK LA
Sbjct: 121 PETFFTVWTNLFQRGHFTAGETVLIHGGSSGIGTTAIMLSKAFGAKIVIVTVGSEEKRLA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA  AINY  +DF+   ++ T G+G+D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 181 CLALGADIAINYHTDDFVAETKRATAGKGVDVIIDLIAGDYVARNYEAAAMSGRIVQIGT 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             GN A ++NL  ++ KR+T TGSTLR RT   K  I   L+  +WPLL +  I P+I  
Sbjct: 241 QNGN-AKDLNLMLMLLKRLTHTGSTLRSRTVAEKALIATELEQHVWPLLCNGQIKPLIFQ 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL   A AH++ME S HIGKI+L
Sbjct: 300 TFPLKDAAKAHELMESSTHIGKIVL 324


>gi|326778202|ref|ZP_08237467.1| NAD(P)H quinone oxidoreductase, PIG3 family [Streptomyces cf.
           griseus XylebKG-1]
 gi|326658535|gb|EGE43381.1| NAD(P)H quinone oxidoreductase, PIG3 family [Streptomyces cf.
           griseus XylebKG-1]
          Length = 330

 Score =  298 bits (764), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 146/325 (44%), Positives = 210/325 (64%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +  AE P P P + E+L++V A  VNR DV+QR+G Y PP  A+P 
Sbjct: 1   MHAITIPEPGGPEALVWAEVPDPVPGEGEVLVEVVASAVNRADVLQRQGFYNPPPGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG+++ LG   T W +GD VCAL+ GGGYAE      G  LP+PKG + ++AA+L
Sbjct: 61  PGLECAGRVLALGPGVTGWAVGDAVCALLAGGGYAEKVAVPAGQLLPVPKGVDLVEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A+LR G+T L+HGGSSGIGT AIQLA   GA V  TA S EK   C
Sbjct: 121 PEVTATVWSNVFMVAHLRPGETFLVHGGSSGIGTMAIQLAKAVGARVAVTAGSPEKLARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   +NY ++DF+E L++ T G G D+ILD++GA+YL+++++ L+  G+L II   
Sbjct: 181 AELGADILVNYREQDFVEELRENTAGSGADVILDLIGAKYLDRNVSALAVNGRLAIIGLQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG    E+NL  +++KR  +T ++LR R    K +I  +++  +WPL+   V+ PV+   
Sbjct: 241 GGA-KGELNLGALLTKRAAVTATSLRGRPLHEKAAIVAAVREHVWPLIEDGVVRPVVDRA 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           LP+   A AH ++E S HIGK++L+
Sbjct: 300 LPMADAAEAHRVLESSAHIGKVLLV 324


>gi|255560828|ref|XP_002521427.1| quinone oxidoreductase, putative [Ricinus communis]
 gi|223539326|gb|EEF40917.1| quinone oxidoreductase, putative [Ricinus communis]
          Length = 325

 Score =  298 bits (764), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 148/325 (45%), Positives = 212/325 (65%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G   V+ L E   PQ + +E+LIKV A  VNR D +QR G +PPPK A+P 
Sbjct: 1   MKAVVITTLGGPEVLQLQEVEDPQIKDDEVLIKVHATAVNRADTLQRLGKHPPPKGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G I  +G+  + W +GDEVCAL++GGGYAE      G  LP+P G +   A + 
Sbjct: 61  PGLECSGTIEAVGKLVSRWKVGDEVCALLSGGGYAEKVAVPAGQVLPVPPGISLKDATAF 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F  + L +G+T LIHGGSSGIGT AIQ+A Y G  V+ TA S+EK  AC
Sbjct: 121 PEVACTVWSTVFMMSRLSAGETFLIHGGSSGIGTFAIQMAKYQGVRVFITAGSQEKLAAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY  EDF+  +++ET G+G+D+ILD +GA YL ++L  L+  G+L II F+
Sbjct: 181 KELGADVCINYRTEDFVARVKEETNGKGVDVILDCMGASYLQRNLDSLNVGGRLFIIGFM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +A E+NL  +++KR+T+  + LR R+   K  I + ++  +WP +    + PV++T 
Sbjct: 241 GGAVA-ELNLASLLAKRLTLQAAGLRGRSSENKADIVNEVEKNVWPAIIEGKMKPVVYTS 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
            PL + A AH ++E S+HIGKI+LL
Sbjct: 300 FPLSEAAEAHRLLESSQHIGKILLL 324


>gi|294650442|ref|ZP_06727802.1| oxydoreductase protein [Acinetobacter haemolyticus ATCC 19194]
 gi|292823662|gb|EFF82505.1| oxydoreductase protein [Acinetobacter haemolyticus ATCC 19194]
          Length = 334

 Score =  298 bits (764), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 209/326 (64%), Gaps = 2/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           ++M+++ ++  G   V+ +     P+ +++E+LI+V A G+NRPD++QR+GLYP PK   
Sbjct: 7   EQMKYIEITQAGGPEVLKVVHGEKPKIKEDEVLIEVYATGINRPDILQRQGLYPMPKGVT 66

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            I GLEVAG I  +G     + +GD+VCAL NGGGYAEYC      TL IPK  + I+AA
Sbjct: 67  QIPGLEVAGIISQIGSKVEKFKVGDKVCALTNGGGYAEYCAVPANQTLSIPKNLSFIEAA 126

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           ++PE++FTVWANLFQ   L+  +TVLIHGG+SGIG+TA+ L    G   ++T  S+EK  
Sbjct: 127 AIPETYFTVWANLFQIGQLKRNETVLIHGGASGIGSTALSLCHAMGIQTFSTVGSDEKAE 186

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
               +     INY K+DF + +   T   G+D+ILD++GA Y NQ+L LL ++G+L+II 
Sbjct: 187 KLSSIST--VINYKKQDFEQEMLSRTDQHGVDVILDIIGAAYFNQNLRLLKRDGRLVIIG 244

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           F+GG      ++  ++ KR  +TGST+R RT+  K  I   L+  +WPL+ +    P+I+
Sbjct: 245 FMGGRKVDGFDIQELMLKRAVVTGSTMRARTNDEKAKITQELEQLVWPLIETGQCKPIIY 304

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
                 +VA AH  +E SEHIGK++L
Sbjct: 305 KTFAFEEVAAAHQCLESSEHIGKVVL 330


>gi|84515150|ref|ZP_01002513.1| alcohol dehydrogenase, zinc-containing [Loktanella vestfoldensis
           SKA53]
 gi|84511309|gb|EAQ07763.1| alcohol dehydrogenase, zinc-containing [Loktanella vestfoldensis
           SKA53]
          Length = 327

 Score =  298 bits (764), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 217/324 (66%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G   V+ L E P+P+P  ++++IKV   GVNRPD +QR GLY PP  A+ +
Sbjct: 2   MQAVEITQPGGPEVLALTERPMPEPAHDQVVIKVAYAGVNRPDALQRAGLYNPPAGASDL 61

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG+I  +G   T W IGD VCAL+ GGGYA Y  +   H LP+P G    QAA L
Sbjct: 62  PGLEAAGEIAAIGAGVTDWKIGDRVCALLPGGGYAAYVATPGAHCLPVPAGLTLAQAACL 121

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    L++G+  L+HGGSSGIGTTAIQLA  FGA V+TTA S++KC AC
Sbjct: 122 PETFFTVWSNVFMRGGLQAGERFLVHGGSSGIGTTAIQLAHVFGARVFTTAGSDDKCAAC 181

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA+ A NY + DF+E +++     G D+ILDMVG  Y+ +++  L+ +G+L+ I+FL
Sbjct: 182 LGLGAEAAFNYRETDFVEKMKELG---GADLILDMVGGPYIQRNIAALADDGRLVQIAFL 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    E+NL  ++++R+TITGSTLR ++D+AK  I   L+  +WPL+ +  + PV+   
Sbjct: 239 QGP-KVELNLVQMMTRRLTITGSTLRPQSDLAKARIAQDLRKHVWPLVAAGRVQPVMDQT 297

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   A AH  ME S HIGKI+L
Sbjct: 298 FALADAAAAHARMESSAHIGKIVL 321


>gi|116623611|ref|YP_825767.1| alcohol dehydrogenase [Candidatus Solibacter usitatus Ellin6076]
 gi|116226773|gb|ABJ85482.1| Alcohol dehydrogenase, zinc-binding domain protein [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 333

 Score =  298 bits (763), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 212/326 (65%), Gaps = 8/326 (2%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + M+ +++   G   V+ LAE   P P   E++I+VEA GVNRPD+ QR G YPPP +A+
Sbjct: 13  RVMKFISLEAPGGPEVLHLAEGAEPTPGPTEVVIRVEAAGVNRPDLQQRAGKYPPPPDAS 72

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           P+LGLEVAG +   G  +     G+ VCAL  GGGYAEYCL      LP+P+G +  +AA
Sbjct: 73  PVLGLEVAGIVAAAGAESG-LREGESVCALTPGGGYAEYCLVAGVQCLPVPRGLSMEEAA 131

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
            +PE+FFTVWAN+FQ   L +G+  L+HGGSSGIGTTAIQLA  FGATV+TTA SE KC 
Sbjct: 132 GIPETFFTVWANVFQIGRLVAGEKFLVHGGSSGIGTTAIQLAHAFGATVFTTAGSEAKCR 191

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           A   LGA  AINY + DF+       +  G+D+ILD+VGA Y  +++  L+  G+L+ I+
Sbjct: 192 ASEALGAARAINYKERDFV------AEFAGVDLILDIVGAAYTPRNIECLAPRGRLVQIA 245

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
              G  AT +NL  ++ KR+TITGST+R R+   K +I   L  K+WPLL S  +  ++ 
Sbjct: 246 VQKGAEAT-VNLAKVMQKRLTITGSTMRPRSVAEKGAIARELYEKVWPLLESGRVKVLVD 304

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
            V PL + A AH  +E  EHIGK+IL
Sbjct: 305 RVFPLAEAAEAHRYLEAGEHIGKVIL 330


>gi|226529636|ref|NP_001150639.1| LOC100284272 [Zea mays]
 gi|194693420|gb|ACF80794.1| unknown [Zea mays]
 gi|195637216|gb|ACG38076.1| quinone oxidoreductase [Zea mays]
 gi|195640790|gb|ACG39863.1| quinone oxidoreductase [Zea mays]
          Length = 329

 Score =  298 bits (763), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 213/329 (64%), Gaps = 3/329 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAE-SPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           +MR V ++  G   V+   E    P   + E+L++V A GVNR D +QR G YPPP  A+
Sbjct: 2   RMRAVVITCAGGPEVLEAREVEDHPALGEGEVLLEVAAAGVNRADTVQRMGRYPPPAGAS 61

Query: 65  PILGLEVAGKIVDLGENT-THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           P  GLE +G I+ LG N  + W +GD+VCAL++GGGYA+  ++  G  LPIP+G +   A
Sbjct: 62  PYPGLECSGTILALGPNVPSRWAVGDKVCALLSGGGYADKVVAPAGQLLPIPEGVSLTHA 121

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A LPE   TVW+ +F T++L  G++ LIHGGSSGIGT AIQ+A + G  V+ TA SEEK 
Sbjct: 122 AGLPEVACTVWSTVFMTSHLSPGESFLIHGGSSGIGTFAIQIAKHLGIKVFVTAGSEEKL 181

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
            AC  LGA   INY  EDF+E +++ET G+G+D+ILD +G  YL ++L  L  +G+L II
Sbjct: 182 AACKALGADVCINYRTEDFVERIKQETNGKGVDVILDNIGGSYLQRNLNSLGVDGRLFII 241

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
            F GG IA E+NL  ++++R+TI  + LR R+   K  I   ++  +WP + +  + PVI
Sbjct: 242 GFQGG-IAAEVNLQAVLARRLTIQAAGLRNRSLANKAEIVSEVEKNVWPAVAAGKVKPVI 300

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
           +   PL + A AH +ME S HIGKI+LLP
Sbjct: 301 YKTFPLCEAAEAHRLMEASTHIGKILLLP 329


>gi|114046051|ref|YP_736601.1| alcohol dehydrogenase [Shewanella sp. MR-7]
 gi|113887493|gb|ABI41544.1| Alcohol dehydrogenase, zinc-binding domain protein [Shewanella sp.
           MR-7]
          Length = 332

 Score =  298 bits (763), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 217/322 (67%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           H+ +   G   VM L  SP+P P   ++LI+  A+GVN PD+ QR G+YPPP  A+PI+G
Sbjct: 10  HIYLEQPGAPEVMQLTRSPLPVPSAGQVLIRNCAVGVNGPDIKQRMGIYPPPPGASPIIG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG+I  LGE  T W +GD+VCALV GGGY EY L++  H LPIP+G++ +QAA+LPE
Sbjct: 70  LEVAGEICALGEGVTQWQLGDKVCALVPGGGYGEYTLTYAVHCLPIPQGFSEVQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW NLF  A L++G+TVLIHGGS GIG+TAI LA + GATV TT   +EK   C  
Sbjct: 130 TFFTVWGNLFMRAGLKAGETVLIHGGSGGIGSTAISLAKHLGATVITTTGQDEKRDYCSG 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA   +NY  ++F+E +   TQG+G++++ D+ G +++N +L  L+ +G+++ +S    
Sbjct: 190 LGAHLVVNYNTQNFVEEVMAFTQGKGVNVVFDIAGGDFINLNLQALALDGRMVSVSTQRS 249

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+N+  +++KRI  TGSTLR +T  AK  I   L   +WPLL+S  I P I    P
Sbjct: 250 AKA-EVNILQLMAKRIVWTGSTLRPQTVEAKAEIAKQLAEHVWPLLDSQQIVPHICATFP 308

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           L + A AH +M+  EH GK++L
Sbjct: 309 LAEAAKAHALMQSGEHRGKVVL 330


>gi|145589237|ref|YP_001155834.1| alcohol dehydrogenase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047643|gb|ABP34270.1| Alcohol dehydrogenase, zinc-binding domain protein
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 332

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 152/331 (45%), Positives = 215/331 (64%), Gaps = 8/331 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESP---IPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNA 63
           MR + +  +G   ++     P    P     E+LIKV A G+NRPDV+QRKG YP P  A
Sbjct: 1   MRVIEIKEFGAPEMLVPNTRPDLAAPAAGSGEVLIKVLAAGINRPDVLQRKGHYPVPAGA 60

Query: 64  NPILGLEVAGKIV--DL--GENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYN 119
           + I GLEVAG+I+  DL   +N     +GD+VCALV GGGYA+ C +     LP P G++
Sbjct: 61  SDIPGLEVAGEIIGGDLSHADNAFGLKLGDKVCALVQGGGYADLCTAPIAQCLPYPTGFS 120

Query: 120 AIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKS 179
             +AA+LPE+F+TVW+N+F    L  G+T+L+ GGSSGIG TAI +A   G  V+ TA +
Sbjct: 121 DQEAAALPETFYTVWSNVFMRGELSEGETLLVQGGSSGIGVTAILIAKALGHKVFVTAGT 180

Query: 180 EEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGK 239
           +EKC AC+ LGA  AINY  +DF+E ++K T G+G+++ILDMV   Y+ + +  L+ +G+
Sbjct: 181 DEKCAACVALGADLAINYKTQDFVEEIKKATDGKGVNVILDMVTGAYVQREIDCLADDGR 240

Query: 240 LIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVI 299
           ++II+  GG+ A E++ N I+ +R+TITGSTLR R    K+ I   L   IWPLLN+  +
Sbjct: 241 IVIIAIQGGSKA-EVSTNQILRRRLTITGSTLRPRPVSFKKQITKQLYDNIWPLLNAGKL 299

Query: 300 APVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            P I+    L + A AH +ME SEH+GKI+L
Sbjct: 300 KPSIYKTFTLDQAADAHSLMESSEHVGKIVL 330


>gi|104781940|ref|YP_608438.1| Zinc-dependent dehydrogenase [Pseudomonas entomophila L48]
 gi|95110927|emb|CAK15645.1| putative Zinc-dependent dehydrogenase [Pseudomonas entomophila L48]
          Length = 338

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 141/329 (42%), Positives = 215/329 (65%), Gaps = 2/329 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I   M  + ++  G   V+       P+P   E+L++V A GVN PD++QRKGLY PP  
Sbjct: 5   IPSHMTAIDITQPGGPEVLLPTTRDTPRPGPREVLVQVHAAGVNGPDLLQRKGLYAPPPG 64

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ I GLE+AG++V LGE  + + +GD V ALV GGGYAEY ++ +  T P+P   + ++
Sbjct: 65  ASDIPGLEIAGRVVALGEQVSRFVVGDAVIALVPGGGYAEYAVADERTTAPLPANLSMVE 124

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEE 181
            A+LPE+F TVW NLFQ    ++G++VLIHGG+SGIGTTA QLA  FGA+ ++TT K  E
Sbjct: 125 GAALPETFMTVWVNLFQRGGFKAGESVLIHGGASGIGTTATQLAKAFGASKIFTTVKDAE 184

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           +  A L LGA  A++Y +EDF+E + + T G+G+D+I+D++  +Y+ ++    + +G+++
Sbjct: 185 QQAASLALGADVAVDYTREDFVEHVMQHTNGQGVDVIVDIIAGDYVARNFKAAAMDGRIV 244

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I  + G  A+E++L P++ KR+T  GSTLR R+   K +I D LQ ++WP +    + P
Sbjct: 245 QIGVVKGP-ASEVDLFPLLVKRLTHIGSTLRARSIDDKAAILDDLQARVWPHVCGGSVKP 303

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +IH   PL     AH++ME   HIGK++L
Sbjct: 304 LIHATFPLTAARQAHELMESGRHIGKVVL 332


>gi|313676396|ref|YP_004054392.1| nad(p)h quinone oxidoreductase, pig3 family [Marivirga tractuosa
           DSM 4126]
 gi|312943094|gb|ADR22284.1| NAD(P)H quinone oxidoreductase, PIG3 family [Marivirga tractuosa
           DSM 4126]
          Length = 324

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 149/325 (45%), Positives = 218/325 (67%), Gaps = 4/325 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNA-NP 65
           M+ + +   G   V+ L E   P+PQ  E+LI+V+A G+NRPDV QR G YP P  A + 
Sbjct: 1   MQAIIIKNPGGPEVLQLKERESPKPQPSEVLIEVKAAGINRPDVFQRMGGYPAPAGAPDD 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLEVAG I ++G++   WN+G++VCALV GGGYA    +     LPIP+G + ++ AS
Sbjct: 61  IPGLEVAGIIKEVGKDVMQWNVGEKVCALVAGGGYASQVTAPAVQCLPIPQGLSFVEGAS 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+FFTVW+N+F   N + G++ L+HGG+SGIG TAIQ+    G  V+TTA ++EKC  
Sbjct: 121 LPETFFTVWSNVFDRGNFQKGESFLVHGGTSGIGVTAIQMVKSMGGKVFTTAGTQEKCDV 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
            + LGA  AINY  +DF + L+++ +   +D+ILDMVG +Y  +++ +L+ EG+L+II+ 
Sbjct: 181 AINLGADLAINYKVQDFEKYLKEKKE--EVDVILDMVGGDYTAKNINILNPEGRLVIINA 238

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           +  N  + IN+  ++ KR+TITGSTLR R+   K +I + L+  IWP +    I PVI+ 
Sbjct: 239 M-KNAESTINMKKVMVKRLTITGSTLRARSPEFKGAIAEKLKKNIWPKIEIGEIKPVIYR 297

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL + + AH++ME SEHIGKI+L
Sbjct: 298 TFPLAEASKAHELMESSEHIGKIVL 322


>gi|209515647|ref|ZP_03264511.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp. H160]
 gi|209503883|gb|EEA03875.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp. H160]
          Length = 343

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 141/316 (44%), Positives = 208/316 (65%), Gaps = 2/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  +V+   + P+P P  +E+LI++ A GVN PDV+QRKGLY PP  A+ I GLEVAGKI
Sbjct: 21  GGPDVLAPVQRPVPAPADDEVLIRLHAAGVNGPDVLQRKGLYDPPPGASDIPGLEVAGKI 80

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V +G N T + +GD VCALV GGGYAEY ++H+ +TL +P G   ++AA++PE+F TVW 
Sbjct: 81  VSVGRNVTRFAVGDLVCALVPGGGYAEYAVAHESNTLAVPAGLTLVEAAAIPETFLTVWL 140

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHA 194
           NLFQ    ++G+TVLIHGG+SGIGTTA  LA  FGA+ + TT  S+    A + LGA  A
Sbjct: 141 NLFQRGKFKAGETVLIHGGASGIGTTATTLAKAFGASKIITTVGSDAHRTASIALGADVA 200

Query: 195 INYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEI 254
           ++Y  EDF+E + + T GRG+D+++D++  +Y+ ++    +  G+++ I  + G  A  +
Sbjct: 201 VDYRNEDFVEEVMRATDGRGVDVVVDIIAGDYVARNYAAAAMNGRIVQIGVIKGP-AQAL 259

Query: 255 NLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAM 314
           +L P+++KR+T  GSTLR RT   K  + + L+  +WP +    + PVI+    L     
Sbjct: 260 DLFPMLAKRLTHIGSTLRSRTHEEKAELIEDLKRSVWPHIRRGAVKPVIYRTFDLDDARG 319

Query: 315 AHDIMEKSEHIGKIIL 330
           AH +M+   HIGKI+L
Sbjct: 320 AHALMDSGTHIGKIVL 335


>gi|268589674|ref|ZP_06123895.1| NADPH:quinone reductase [Providencia rettgeri DSM 1131]
 gi|291314985|gb|EFE55438.1| NADPH:quinone reductase [Providencia rettgeri DSM 1131]
          Length = 336

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 145/309 (46%), Positives = 207/309 (66%), Gaps = 2/309 (0%)

Query: 23  LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT 82
           L + P+P+     +L+KVEA GVNRPD+ QRKG YPPP +A+PI+GLE+AG IV   ++ 
Sbjct: 28  LIDIPLPRISAGYLLVKVEAAGVNRPDIFQRKGSYPPPTDASPIMGLEIAGTIVAKADDV 87

Query: 83  THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTAN 142
             W +GD+VC LV GGGYAEYCL H+   LP+    + I+ A++PE+FFTVWAN+FQ   
Sbjct: 88  EEWQLGDKVCGLVAGGGYAEYCLVHKNIALPLGN-LSFIEGAAIPENFFTVWANVFQIGK 146

Query: 143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDF 202
           L+  +TVLIHGG+SGIG+ AI LA  FGATV TT  SE+K      LGA   INY  +DF
Sbjct: 147 LKKDETVLIHGGTSGIGSVAIMLAKAFGATVITTVGSEDKVQVAKSLGANCVINYRNDDF 206

Query: 203 LEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISK 262
           +E     T  RG+D+++D++G +Y+ ++  + +K G++I I  + GN   E+N+ P++ K
Sbjct: 207 VEATLNYTSSRGVDMVVDIIGGDYVAKNYQVAAKFGRIIQIGMMKGN-PKELNMMPLMVK 265

Query: 263 RITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS 322
           R+T TGST+R RT   K  I   L+ ++W LL +  I P+I+ +  L +V  AH+ ME  
Sbjct: 266 RLTHTGSTMRSRTIEEKAVIAQELKKQVWGLLQNGEIKPIINKIYHLSQVRSAHEYMESG 325

Query: 323 EHIGKIILL 331
           + +GKI+LL
Sbjct: 326 DLVGKIVLL 334


>gi|320009802|gb|ADW04652.1| NAD(P)H quinone oxidoreductase, PIG3 family [Streptomyces
           flavogriseus ATCC 33331]
          Length = 328

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 205/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G    +  AE P P P + E+L++V +  VNR DV+QR+G Y PP  A+P  GLE AG+I
Sbjct: 10  GGPEALVWAEVPDPVPGEGEVLVEVVSSAVNRADVLQRQGFYNPPPGASPYPGLECAGRI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
            ++G   T W +GDEVC L+ GGGYAE      G  LP+P G +  QAA+LPE   TVW+
Sbjct: 70  AEVGPGVTGWAVGDEVCGLLAGGGYAEKVAVPAGQLLPVPDGVDLAQAAALPEVAATVWS 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  A+LR G+T+L+HGGSSGIGT AIQLA   GA V  TA   EK   C +LGA   I
Sbjct: 130 NVFMVAHLRPGETLLVHGGSSGIGTMAIQLAKAVGARVAVTAGGPEKLARCQELGADILI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           +Y ++DF+E L++ T G G D+ILD+VGA+YL++++  L+  G+L II   GG    E+N
Sbjct: 190 DYREQDFVEELRQATDGAGADVILDIVGAKYLDRNVRALAVNGRLAIIGLQGGA-KGELN 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L+ ++SKR  +T ++LR R    K +I  +++  +WPLL   V+ P++   +P+ + A A
Sbjct: 249 LSALLSKRAAVTATSLRARPLSEKAAIIAAVREHVWPLLADGVVKPIVDRTMPMSEAAEA 308

Query: 316 HDIMEKSEHIGKIIL 330
           H +ME S HIGKI+L
Sbjct: 309 HRLMESSSHIGKILL 323


>gi|46203947|ref|ZP_00050724.2| COG0604: NADPH:quinone reductase and related Zn-dependent
           oxidoreductases [Magnetospirillum magnetotacticum MS-1]
          Length = 305

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 144/299 (48%), Positives = 206/299 (68%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + MR +   G G   V+ +   P+P+P   ++L++V A GVNRPD+MQR+G YPPPK A 
Sbjct: 7   ETMRQIRFQGAGGPEVIAVETVPLPKPGAGQVLVEVVAAGVNRPDIMQRQGSYPPPKGAT 66

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            I GLE+AG+I  LGE  T +++GDEVCALV  GGYAE+ ++  G  L  P+  + ++AA
Sbjct: 67  EIPGLEIAGRIAALGEGVTGFSVGDEVCALVISGGYAEFAVAEIGQVLRKPESLSLVEAA 126

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
            LPE+ FTV++ + Q   L+ G+T L+HGGSSGIGTTAIQ+A   GA V TTA S EKC 
Sbjct: 127 GLPETVFTVYSTVIQRGRLQKGETFLVHGGSSGIGTTAIQIAKQHGARVLTTAGSAEKCR 186

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
            C +LGA  AINY + DF E +++ T G+G+D+ILDMVGA YL++++  L+ EG+L+ I+
Sbjct: 187 FCEELGADAAINYREADFAEEVKRLTDGKGVDVILDMVGAAYLSRNIASLAVEGRLVQIA 246

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           F+ G  A  + L PI+ KR+TITG+TLR +   AK +I + L+  +WPL+ +  I P++
Sbjct: 247 FMQGYKAESLTLTPIMLKRLTITGATLRAQAKEAKAAIAEGLKRDVWPLVEAGKIRPIV 305


>gi|260425855|ref|ZP_05779834.1| putative quinone oxidoreductase [Citreicella sp. SE45]
 gi|260420347|gb|EEX13598.1| putative quinone oxidoreductase [Citreicella sp. SE45]
          Length = 333

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 149/329 (45%), Positives = 212/329 (64%), Gaps = 1/329 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + +  R V   G G   V+ + E+  P+P   ++LI+V A G+NRPDVMQR+G YPPP  
Sbjct: 1   MTETTRAVIAEGAGGPEVLRVIETTRPEPGPGQLLIEVHAAGINRPDVMQRQGNYPPPPG 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE+AG +  LGE  T + IGD V  LV+ G YA++ L      +P+P+  +  +
Sbjct: 61  ASEVFGLELAGVVARLGEGVTGFAIGDRVMGLVHSGAYADWALLDAPIAIPVPRSLSMAE 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           A ++PE+FFTVW+N+F+ A L+ G+T+LIHGG+SGIGTTAIQLA   G+TV  TA S+ K
Sbjct: 121 AGAVPETFFTVWSNVFERAALKPGETLLIHGGTSGIGTTAIQLAKALGSTVIVTAGSDGK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C A   LGA HAINY  +DF+E+ ++ T GRG D+ILDMVG  Y+ + + LL+ +G++  
Sbjct: 181 CQAARDLGADHAINYRTQDFVEVARELTGGRGPDVILDMVGGSYIQRDIELLAADGRISQ 240

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+F  G+ A E++  P++ KR TIT STLR R    K  +  +L   + PLL S  + P 
Sbjct: 241 IAFQQGSKA-EVDFLPLLMKRGTITASTLRARPVEMKAKLARALTEHVVPLLASGAVRPP 299

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
           I +   L  VA AH  M+   H+GKI+LL
Sbjct: 300 IDSTFALEDVARAHARMDGGAHVGKIVLL 328


>gi|188026016|ref|ZP_02960555.2| hypothetical protein PROSTU_02508 [Providencia stuartii ATCC 25827]
 gi|188021279|gb|EDU59319.1| hypothetical protein PROSTU_02508 [Providencia stuartii ATCC 25827]
          Length = 344

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 149/329 (45%), Positives = 214/329 (65%), Gaps = 2/329 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I   M+ + ++ +G +  + + E P+P   +  +L+KVEA GVNRPDV+QR G YPPP +
Sbjct: 16  IPNTMKVINIAEHGGAEKLQIIEQPLPVLSEGYLLVKVEAAGVNRPDVLQRMGAYPPPPD 75

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+PILGLEVAG IV   ++   W IGD +CALV GGGYAEYCL HQ   LP+    + ++
Sbjct: 76  ASPILGLEVAGTIVAKADDVQQWQIGDNICALVAGGGYAEYCLVHQDIALPLGH-LSFVE 134

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
            A++PE+FFTVWAN+FQ   L+ G+TVLIHGG+SGIG+ AI LA  FGATV TT  S EK
Sbjct: 135 GAAIPENFFTVWANVFQIGKLKKGETVLIHGGTSGIGSVAIMLAKAFGATVITTVGSAEK 194

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
                 LGA   INY  +DF++     T+ +G+D+++D+VG +Y++++  + +K G++I 
Sbjct: 195 VEVAKSLGADCIINYRNDDFVQHTLDYTRSQGVDMVVDIVGGDYVDKNYQVAAKFGRIIQ 254

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I  + GN    +NL P++ KR+  TGST+R RT   K SI   L+  +W +L    + P 
Sbjct: 255 IGMMKGN-PKSLNLMPLMIKRLIHTGSTMRSRTVAEKSSIAAELKQHVWGMLQKGELKPF 313

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
           ++   PL +VA AH  ME  +  GKI+L+
Sbjct: 314 VNKTYPLDQVADAHRHMESGDLYGKIVLI 342


>gi|282599673|ref|ZP_05971447.2| NADPH:quinone reductase [Providencia rustigianii DSM 4541]
 gi|282568186|gb|EFB73721.1| NADPH:quinone reductase [Providencia rustigianii DSM 4541]
          Length = 325

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 145/316 (45%), Positives = 210/316 (66%), Gaps = 2/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G ++ + L   P+P+     +++KVEA GVNRPD+ QRKG YPPP++A+PI+GLEV+G +
Sbjct: 10  GDADKLQLINIPLPKLSAGYMIVKVEAAGVNRPDIFQRKGSYPPPEDASPIMGLEVSGTV 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V + ++ T W IGD VCALV GGGYAEYCL HQ   LP+       + A++PE+FFTVWA
Sbjct: 70  VAMADDVTQWQIGDRVCALVAGGGYAEYCLVHQDIALPLGN-LTFEEGAAVPENFFTVWA 128

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+FQ   L+ G+TVLIHGG+SGIG+ AI LA  FGATV TT  S+EK      LGA   I
Sbjct: 129 NMFQIGQLKQGETVLIHGGTSGIGSVAIMLAKAFGATVITTVGSDEKVSVAKSLGADCVI 188

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY  +DF+ +  + T   G+DI++D++G +Y++++  + +K G++I I  + GN  T +N
Sbjct: 189 NYRNQDFVSVALEFTASHGVDIVVDIIGGDYVSKNYMVAAKFGRIIQIGMMKGN-PTNLN 247

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+  TGST+R R+   K  I   L+ ++W +L    I P+I+ V  L +V  A
Sbjct: 248 MMPMMVKRLQHTGSTMRSRSIDEKIHIAKELKQQVWGMLQKGEIKPIINKVYRLEQVTDA 307

Query: 316 HDIMEKSEHIGKIILL 331
           H+ ME  +  GKIIL+
Sbjct: 308 HNHMESGDLFGKIILI 323


>gi|262372559|ref|ZP_06065838.1| NADPH:quinone reductase [Acinetobacter junii SH205]
 gi|262312584|gb|EEY93669.1| NADPH:quinone reductase [Acinetobacter junii SH205]
          Length = 334

 Score =  295 bits (756), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 140/326 (42%), Positives = 210/326 (64%), Gaps = 2/326 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           ++M+++ ++  G   V+ + +   P+ +++E+LI+V A G+NRPD++QR+GLYP PK   
Sbjct: 7   EQMKYIEITQAGGPEVLKVVQGKKPEIKEDEVLIEVYATGINRPDILQRQGLYPMPKGVT 66

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            I GLEVAG I  +G     + +GD+VCAL NGGGYAEYC      TL IPK  + I+AA
Sbjct: 67  QIPGLEVAGIISQIGSKVEKFKVGDKVCALTNGGGYAEYCAVPANQTLVIPKNLSFIEAA 126

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           ++PE++FTVWANLFQ   L+  +TVLIHGG+SGIG+TA+ L    G   ++T  SEEK  
Sbjct: 127 AIPETYFTVWANLFQIGQLKKNETVLIHGGASGIGSTALSLCHAMGIQTFSTVGSEEKVE 186

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
               +     INY  ++F + +   T  +G+D+ILD++GA Y NQ+L LL ++G+L+II 
Sbjct: 187 KLSSIST--VINYKTQNFEQEILSLTDQQGVDVILDIIGAAYFNQNLRLLKRDGRLVIIG 244

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           F+GG      ++  ++ KR  +TGST+R RT+  K  I   L+  +WPL+ +    P+I+
Sbjct: 245 FMGGRKVDGFDIQELMLKRAVVTGSTMRARTNDEKAKITQELEQFVWPLIETGQCKPIIY 304

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
                 +VA AH  +E SEHIGK++L
Sbjct: 305 KTFAFEEVAAAHQCLESSEHIGKVVL 330


>gi|262368768|ref|ZP_06062097.1| NADPH:quinone reductase [Acinetobacter johnsonii SH046]
 gi|262316446|gb|EEY97484.1| NADPH:quinone reductase [Acinetobacter johnsonii SH046]
          Length = 330

 Score =  295 bits (756), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 142/324 (43%), Positives = 206/324 (63%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G  + +      IP+ + +E+L+KV A G+NRPD++QR+GLYP P     +
Sbjct: 6   MQQVIITEPGGVDKLAYETVTIPEAKADEVLVKVHAFGINRPDILQRQGLYPMPPGVTQV 65

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG++V +G   T + +GD+VC L NGGGYAEYC+  Q  TL IP+  + ++AA++
Sbjct: 66  PGLEVAGEVVAVGAEVTQFKLGDKVCGLTNGGGYAEYCVVPQSQTLHIPENVSFVEAAAI 125

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWAN+FQ    ++G+ VL+HGG+SGIGTTA+ L    G   + T  S+EK  A 
Sbjct: 126 PETFFTVWANVFQMGKAKAGEVVLVHGGTSGIGTTALMLCKALGIKTFATVGSDEKVQAI 185

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             L    AINY  +DF   + ++T   G+D+ILDMVGA YL ++L LL ++G+L+ I+FL
Sbjct: 186 ANL--TDAINYKTQDFEHEINEKTDNAGVDVILDMVGAPYLEKNLNLLRRDGRLVYIAFL 243

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E+ L  I+ KR+TITGST+R R    K  I   LQ  + PL       P+I+  
Sbjct: 244 GGAKAKEVKLGQIMMKRLTITGSTMRARNTAEKAEIAQGLQDHVAPLWAKGECLPMIYQT 303

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
               ++  AH  M+  EH+GKI++
Sbjct: 304 FEFDQIQAAHACMDTGEHVGKIVV 327


>gi|325123281|gb|ADY82804.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 336

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 208/330 (63%), Gaps = 2/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   M+ + ++  G   V+ + ++ IP+PQ +E+LI+V+A G+NRPDV+QR GLYP P
Sbjct: 5   MTLPTTMKIIEITALGGPEVLKVQDANIPKPQADEVLIEVKAAGINRPDVLQRMGLYPMP 64

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K    I GLEVAG +V +G+    + +GD+VCAL NGGGYAEYC       LPIP+  + 
Sbjct: 65  KGVTQIPGLEVAGVVVAVGDEVDQFKVGDKVCALTNGGGYAEYCAVIATQVLPIPENLSF 124

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA++PE+FFTVWANLF    L+  +T LIHGG+SGIGTTA+ +    G   + T  SE
Sbjct: 125 TQAAAIPETFFTVWANLFDIGRLKKDETALIHGGASGIGTTALAICHALGIKTFATVGSE 184

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +K  A   L    AINY  +DF + + K TQ +G+D+ILD+VG  Y  ++L LL ++G+L
Sbjct: 185 DKVEALSNLTT--AINYKTQDFEQEILKHTQDQGVDVILDIVGGSYFTKNLNLLKRDGRL 242

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +II F+GG IA E +L  +I KR TITGST+R R    K  I  SL   +WPLL      
Sbjct: 243 VIIGFMGGRIAKEFDLQKLILKRATITGSTMRARNSQEKAQIAQSLHEHVWPLLAQGKCL 302

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I+          AH  ME+ +HIGKI+L
Sbjct: 303 PQIYKTYAFSDAQHAHACMEQGDHIGKIVL 332


>gi|182437547|ref|YP_001825266.1| putative quinone oxidoreductase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|178466063|dbj|BAG20583.1| putative quinone oxidoreductase [Streptomyces griseus subsp.
           griseus NBRC 13350]
          Length = 330

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 145/325 (44%), Positives = 209/325 (64%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +  AE   P P + E+L++V A  VNR DV+QR+G Y PP  A+P 
Sbjct: 1   MHAITIPEPGGPEALVWAEVSDPVPGEGEVLVEVVASAVNRADVLQRQGFYNPPPGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG+++ LG   T W +GD VCAL+ GGGYAE      G  LP+PKG + ++AA+L
Sbjct: 61  PGLECAGRVLALGPGVTGWAVGDAVCALLAGGGYAEKVAVPAGQLLPVPKGVDLVEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A+LR G+T L+HGGSSGIGT AIQLA   GA V  TA S EK   C
Sbjct: 121 PEVTATVWSNVFMVAHLRPGETFLVHGGSSGIGTMAIQLAKAVGARVAVTAGSPEKLARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   +NY ++DF+E L++ T G G D+ILD++GA+YL+++++ L+  G+L II   
Sbjct: 181 AELGADILVNYREQDFVEELRENTAGSGADVILDLIGAKYLDRNVSALAVNGRLAIIGLQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG    E+NL  +++KR  +T ++LR R    K +I  +++  +WPL+   V+ PV+   
Sbjct: 241 GGA-KGELNLGALLTKRAAVTATSLRGRPLHEKAAIVAAVREHVWPLIEDGVVRPVVDRA 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           LP+   A AH ++E S HIGK++L+
Sbjct: 300 LPMADAAEAHRVLESSAHIGKVLLV 324


>gi|94313207|ref|YP_586416.1| alcohol dehydrogenase [Cupriavidus metallidurans CH34]
 gi|93357059|gb|ABF11147.1| Alcohol dehydrogenase, zinc-binding [Cupriavidus metallidurans
           CH34]
          Length = 344

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 217/329 (65%), Gaps = 2/329 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I   M  + ++  G  +V+   + P+P P  +E+LI++ A GVN PDVMQR+GLY PP  
Sbjct: 8   IPAAMVAIEITQPGGPDVLAPVQRPVPVPAADEVLIRIHAAGVNGPDVMQRRGLYDPPPG 67

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ I GLEVAG+IV +G +   + +GD VCALV GGGYAEY ++H+ +TL IP+G + ++
Sbjct: 68  ASDIPGLEVAGEIVSVGRDVIRFAVGDLVCALVPGGGYAEYAVAHESNTLTIPEGLSMVE 127

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEE 181
           AA+LPE+F TVW NLFQ     +G++VLIHGG+SGIGTTA  LA  FGA+ + TT  S+ 
Sbjct: 128 AAALPETFLTVWLNLFQRGKFSAGESVLIHGGASGIGTTATMLAKAFGASKIITTVGSDT 187

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           +  A + LGA  A++Y  EDF+E + + T GRG+D+++D++  +Y+ ++    + +G+++
Sbjct: 188 QRDASIALGADVAVDYRNEDFVEAVARATDGRGVDVVVDIIAGDYVARNYAAAAMDGRIV 247

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I  + G  A  ++L P+++KR+T  GSTLR RT   K  + + L+  ++P +    + P
Sbjct: 248 QIGVIKGP-AQSLDLFPMLAKRLTHIGSTLRSRTHEEKAVLIEDLEQSVFPHIRRGAVKP 306

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           V++    LG    AH++M+   HIGKI+L
Sbjct: 307 VMYKTFDLGDARRAHELMDSGTHIGKIVL 335


>gi|78063890|ref|YP_373798.1| zinc-containing alcohol dehydrogenase superfamily protein
           [Burkholderia sp. 383]
 gi|77971775|gb|ABB13154.1| Zinc-containing alcohol dehydrogenase superfamily [Burkholderia sp.
           383]
          Length = 369

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 209/316 (66%), Gaps = 2/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  +V+     P+P P+ +E+LI++ A GVN PDV QRKGLY PP  A+ I GLEVAG++
Sbjct: 42  GGPDVLVPTTRPVPSPRHDEVLIRIHAAGVNGPDVFQRKGLYDPPPGASDIPGLEVAGEV 101

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V +G + T + +GDEVCAL+ GGGYAEY ++++ +TL IP G +  +AA++PE+F TVW 
Sbjct: 102 VAVGRDVTRFALGDEVCALIPGGGYAEYAVANESNTLAIPDGLDMTEAAAMPETFMTVWL 161

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHA 194
           NLFQ     +G +VLIHGG+SGIGTTA  LA  FGA T+ TT  SE +  A L+LGA  A
Sbjct: 162 NLFQRGRFAAGDSVLIHGGASGIGTTATMLAKAFGASTIITTVGSEAQRDASLRLGADLA 221

Query: 195 INYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEI 254
           I Y  EDF++ +++ T G+G+D+I+D++  +Y+ ++    +  G+++ I  + G  A E+
Sbjct: 222 IEYRNEDFVDAVKRFTDGKGVDVIVDIIAGDYVARNFAAAAMNGRIVQIGVINGP-AKEL 280

Query: 255 NLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAM 314
           +L P+++KR+T  GSTLR RT   K  +   L+  +WPL+    + P ++    L   + 
Sbjct: 281 DLFPMLTKRLTHIGSTLRSRTYEEKAQLIRELEEAVWPLIRQGTVKPQVYRTFDLRDASG 340

Query: 315 AHDIMEKSEHIGKIIL 330
           AH +M+   HIGKI+L
Sbjct: 341 AHALMDSGRHIGKIVL 356


>gi|157145492|ref|YP_001452811.1| hypothetical protein CKO_01235 [Citrobacter koseri ATCC BAA-895]
 gi|157082697|gb|ABV12375.1| hypothetical protein CKO_01235 [Citrobacter koseri ATCC BAA-895]
          Length = 325

 Score =  295 bits (755), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 139/324 (42%), Positives = 207/324 (63%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++  G   V+ +++  +P+  + ++LI V+A GVNRPD+MQR+G YP P+   P+
Sbjct: 1   MKLIEITEAGGPEVLKVSQGKMPECGENDVLISVKAAGVNRPDIMQREGKYPMPEGVTPV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +  +G+N  H+++GD VCAL NGGGYAE+C    G  LP P+  +  +AA+L
Sbjct: 61  PGLEVAGIVHSIGKNVAHFSVGDRVCALTNGGGYAEFCAVPAGQVLPAPQNLSFTEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWANLF    ++    VLIHGG+SGIGTTA+ L +      ++T  S++K    
Sbjct: 121 PETFFTVWANLFSLGKVKKEDVVLIHGGASGIGTTALALCNAMNIKAFSTVGSDDKIPFL 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            + G    INY   DF E +   T G+G+D+ILD+VGA Y N++L LL K+G+L++I F+
Sbjct: 181 QQYG--EIINYRTHDFEEEILSRTDGKGVDVILDIVGAAYFNKNLRLLKKDGRLVLIGFM 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E ++  +I KR  +TGST+R R    K+ I   L  K+WPL+ +    PVIH +
Sbjct: 239 GGRMVKEFDIQELILKRAVVTGSTMRSRDAAEKEEIAQQLIQKVWPLIEAGKCKPVIHQI 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           +    V  AH +++   HIGK+IL
Sbjct: 299 VKFEDVRQAHTLLDAGTHIGKVIL 322


>gi|254295310|ref|YP_003061333.1| NAD(P)H quinone oxidoreductase, PIG3 family [Hirschia baltica ATCC
           49814]
 gi|254043841|gb|ACT60636.1| NAD(P)H quinone oxidoreductase, PIG3 family [Hirschia baltica ATCC
           49814]
          Length = 329

 Score =  295 bits (754), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 202/302 (66%), Gaps = 4/302 (1%)

Query: 29  PQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIG 88
           P P+ +E+LIKV A G+NR D++QR+G+YPPP+ A  I+GLEV+G +  +GE    W +G
Sbjct: 30  PSPKAKEVLIKVVAAGLNRADILQRRGMYPPPEGAPDIMGLEVSGYVEAVGEGVDDWQLG 89

Query: 89  DEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQT 148
            EVCAL+  GGYAEY ++H G  +P+P+G +  +AA LPE+  TVWAN++  A L  G+T
Sbjct: 90  QEVCALLPAGGYAEYAIAHHGSVMPVPEGVSLQEAALLPEAVLTVWANVYDIAVLHPGET 149

Query: 149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQK 208
           + I GG+SGIGTTAIQ+A   GA VY TA S+EKC AC++LGA  A NY   DF E L+ 
Sbjct: 150 LFIQGGASGIGTTAIQMAKAMGANVYVTAGSDEKCKACIELGADGAFNYKTTDFEEELKA 209

Query: 209 ETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITG 268
                G D+ILDMVG +YL +H+  L+  G+L+ I+  GG +  E+N+  ++ K++ ITG
Sbjct: 210 VG---GADVILDMVGGDYLPKHINALNFGGRLVHIAVQGG-LKGEVNILKVMMKQLNITG 265

Query: 269 STLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKI 328
           STLR R D+AK  + +    ++WP + S  + P++ +   + K   AHD M   EHIGKI
Sbjct: 266 STLRGRNDVAKMHLANMAVEEVWPWVASGQVRPIVDSSFAMQKAEKAHDRMTSGEHIGKI 325

Query: 329 IL 330
           +L
Sbjct: 326 ML 327


>gi|312796905|ref|YP_004029827.1| quinone oxidoreductase [Burkholderia rhizoxinica HKI 454]
 gi|312168680|emb|CBW75683.1| Quinone oxidoreductase (EC 1.6.5.5) [Burkholderia rhizoxinica HKI
           454]
          Length = 365

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 215/334 (64%), Gaps = 10/334 (2%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           +M+ + ++ YG   V+   E P+P  +  E+LIKV A GVNRPDV QR G YP P  A+ 
Sbjct: 31  RMKAIEITEYGAPEVLKPGERPMPALKPGEVLIKVAAAGVNRPDVFQRTGNYPVPPGASD 90

Query: 66  ILGLEVAGKIV----DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
           I GLE+AG+IV    D   N      G  VCALV GGGYA+Y  +     LP+P G + +
Sbjct: 91  IPGLEIAGEIVEGDLDGANNPFGLTRGQRVCALVQGGGYAQYASAPLAQCLPVPAGLSDV 150

Query: 122 QAASLPESFFTVWANLFQTANLRSGQ-----TVLIHGGSSGIGTTAIQLASYFGATVYTT 176
           QAASLPE+FFTVW+N+F    L +G+      +L+ GGSSGIG +AIQ+A   G  V+ T
Sbjct: 151 QAASLPETFFTVWSNVFDRGRLGAGEGGPQEALLVQGGSSGIGVSAIQIAHALGHRVFAT 210

Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSK 236
           A + +KC AC  LGA+ AINY  EDF+ +++  T  RG+D+ILDMVG  Y+ + L+ L+ 
Sbjct: 211 AGNAQKCAACEALGAERAINYKTEDFVAVVKSLTHDRGVDVILDMVGGAYVGRELSTLAD 270

Query: 237 EGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS 296
            G++++I+ LGG  A +INL  ++ +R+T+TGSTLR R+   K +I   L  ++WPL+  
Sbjct: 271 GGRIVLIALLGGANA-QINLGEVLRRRLTLTGSTLRPRSVAFKAAIAAQLHERVWPLIEQ 329

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             I PVIH V P  + A AH +ME+ EHIGKI+L
Sbjct: 330 GAIKPVIHQVFPAEQAAAAHAMMERGEHIGKIVL 363


>gi|254512680|ref|ZP_05124746.1| alcohol dehydrogenase, zinc-containing [Rhodobacteraceae bacterium
           KLH11]
 gi|221532679|gb|EEE35674.1| alcohol dehydrogenase, zinc-containing [Rhodobacteraceae bacterium
           KLH11]
          Length = 322

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 146/326 (44%), Positives = 202/326 (61%), Gaps = 4/326 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  V M G G   V+     P  QP   ++LI+V A GVN PD++QR+G YPPPK A+ +
Sbjct: 1   MNTVEMDGTGGPEVLVPGSRPTVQPAPGQVLIRVTAAGVNGPDLVQRRGHYPPPKGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEV+G+IV LGE    W +GD VCAL NGGGYA++     GH LP+P+G +   AA L
Sbjct: 61  LGLEVSGEIVALGEGAAQWQLGDRVCALTNGGGYADFVAVDAGHCLPVPEGIDETDAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F   N+  G   L+HGGS GIG+TAIQL +  G  V TT +SE      
Sbjct: 121 PETFFTVWSNVFFGQNIPQGGNFLVHGGSGGIGSTAIQLGAALGLNVITTVESEAAAEFA 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   IN+  EDF+ + +   +  G DIILD++G +Y+ +++     + ++I ++F 
Sbjct: 181 RSLGAARTINFRDEDFVPVCR---EAGGADIILDIIGGDYVARNIKASRHDARIIQLAFN 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G+   EI+L P++ KRI  TGSTLR R +  K  +   L+  +WPL  S  +  V HTV
Sbjct: 238 KGS-KIEIDLMPVMLKRIRYTGSTLRSRPETFKTEVAQDLRKTVWPLFASGKLRGVTHTV 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILLP 332
           LP+ + A AH +ME  +H GKI+L P
Sbjct: 297 LPMAEAAEAHRVMEAGKHHGKILLSP 322


>gi|332187811|ref|ZP_08389545.1| NAD(P)H quinone oxidoreductase, PIG3 family protein [Sphingomonas
           sp. S17]
 gi|332012161|gb|EGI54232.1| NAD(P)H quinone oxidoreductase, PIG3 family protein [Sphingomonas
           sp. S17]
          Length = 331

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 150/315 (47%), Positives = 208/315 (66%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+  A   +P+P + E+LI+V A GVNRPDVMQR+GLYPPP  A  I GLE+AG+I
Sbjct: 15  GGPEVLVPATRAVPRPGEGEVLIRVAAAGVNRPDVMQRQGLYPPPPGAPSIPGLEIAGEI 74

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V +GE      +G  VCAL+ GGGYAEY ++   H L +P G + +QAA++PE+ FTVW 
Sbjct: 75  VAVGEGVGAEMLGQPVCALIGGGGYAEYAVADAEHCLSVPPGLSMVQAAAMPETLFTVWT 134

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+ A  R G+T+L+HGG+SGIGT AI L   FG TV  TA S+EKC A  KLGA  AI
Sbjct: 135 NVFERAYARDGETLLVHGGTSGIGTMAIMLGKLFGVTVIVTAGSDEKCAAAEKLGAAKAI 194

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY  +DF+E ++  T+GRG+DI+LDMVG +YL ++L  L++EG+ + I+   G  A E+ 
Sbjct: 195 NYRTQDFVEGVKAFTEGRGVDIVLDMVGGDYLPRNLQCLAEEGRHVSIAVQRGAKA-EVP 253

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           +  I+ +R+ +TGSTLR R    K  + D +   +WP +    + P+I    PL   A A
Sbjct: 254 IWEIMRRRLILTGSTLRGRDRAFKAMVADEIARIVWPHVEEGRLRPLIDRTFPLADAAKA 313

Query: 316 HDIMEKSEHIGKIIL 330
           H+ ME  +H+GKI+L
Sbjct: 314 HERMEAGDHLGKIVL 328


>gi|299768922|ref|YP_003730948.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter sp. DR1]
 gi|298699010|gb|ADI89575.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter sp. DR1]
          Length = 332

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 208/330 (63%), Gaps = 2/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M + K M+ + ++  G   V+ + ++ +P PQ +E+LI+V+A G+NRPDV+QR GLYP P
Sbjct: 1   MTLPKTMKIIEITAPGGPEVLKVQDASLPVPQADEVLIEVKAAGINRPDVLQRMGLYPMP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K    I GLEVAG +V +GE    + +GD+VCAL NGGGYAEYC       LPIP+  + 
Sbjct: 61  KGVTQIPGLEVAGVVVAVGEQVDQFKVGDKVCALTNGGGYAEYCAVTATQVLPIPENLSF 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA++PE+FFTVWANLF    L+  +T LIHGG+SGIGTTA+ +    G   + T  SE
Sbjct: 121 TQAAAIPETFFTVWANLFDIGRLKKDETALIHGGASGIGTTALAICQALGIRTFATVGSE 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +K  A        AINY  +DF + + K TQ +G+D+ILD+VG  Y  ++L LL ++G+L
Sbjct: 181 DKVEALSSFTT--AINYKTQDFEQEILKHTQNQGVDVILDIVGGSYFTKNLNLLKRDGRL 238

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +II F+GG IA E +L  +I KR TITGST+R R    K  I  SL   +WPLL      
Sbjct: 239 VIIGFMGGRIAKEFDLQKLILKRATITGSTMRARNSQEKAEIAQSLHEHVWPLLAQGKCL 298

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I+       V  AH  ME+ +HIGKI+L
Sbjct: 299 PQIYKTYAFSDVQSAHACMEQGDHIGKIVL 328


>gi|238788283|ref|ZP_04632077.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           frederiksenii ATCC 33641]
 gi|238723529|gb|EEQ15175.1| NADPH:quinone reductase and Zn-dependent oxidoreductase [Yersinia
           frederiksenii ATCC 33641]
          Length = 336

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 158/325 (48%), Positives = 212/325 (65%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G   V+   + P P P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 11  MVAIEIAQAGGPEVLTPVKRPTPMPAAGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDI 70

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +V L  + + + IGD+VC L+ GGGYA+YC+ H+ + L IP     I+AA+L
Sbjct: 71  PGLEVAGVVVALAADVSRFKIGDKVCGLIAGGGYAQYCVIHETNALLIPDNLTEIEAAAL 130

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLA 185
           PE+FFTVWANLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FGA TV  T  SEEK  A
Sbjct: 131 PETFFTVWANLFQRGHFTAGETVLIHGGSSGIGTTAILLSKAFGAKTVIVTVGSEEKRQA 190

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA  AINY  EDF+   ++ T G+G D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 191 CLMLGADIAINYHTEDFVAETKRATAGKGADVIIDLIAGDYVARNYEAAAMNGRIVQIGT 250

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             GN A ++NL  ++ KR+T TGSTLR R+ + K  I   L+ ++WPLL  + I P I  
Sbjct: 251 QHGN-AKDLNLMLMLLKRLTHTGSTLRSRSVVEKALIAKELEQQVWPLLGENKIKPQIFQ 309

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL   A AH +ME S HIGKI+L
Sbjct: 310 TFPLEAAAKAHALMESSTHIGKIVL 334


>gi|239942613|ref|ZP_04694550.1| putative quinone oxidoreductase [Streptomyces roseosporus NRRL
           15998]
 gi|239989072|ref|ZP_04709736.1| putative quinone oxidoreductase [Streptomyces roseosporus NRRL
           11379]
 gi|291446075|ref|ZP_06585465.1| quinone oxidoreductase [Streptomyces roseosporus NRRL 15998]
 gi|291349022|gb|EFE75926.1| quinone oxidoreductase [Streptomyces roseosporus NRRL 15998]
          Length = 329

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 207/325 (63%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +  AE P P P   E+L++V A  VNR DV+QR+G Y PP  A+P 
Sbjct: 1   MHAITIPEPGGPEALVWAEVPDPVPGDGEVLVEVVASAVNRADVLQRQGFYDPPPGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G+I  LG   T W +GD VCAL+ GGGYAE      G  LP+P+G + ++AA+L
Sbjct: 61  PGLECSGRIAALGPGVTGWAVGDAVCALLAGGGYAEKVAVPAGQLLPVPEGVDLVEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  ++LR G+T L+HGGSSGIGT AIQLA   GA V  TA S EK   C
Sbjct: 121 PEVTSTVWSNVFMVSHLRPGETFLVHGGSSGIGTMAIQLAKAVGARVAVTAGSPEKLARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY ++DF+E +++ T G G D+ILD++GA+YL++++  L+  G+L II   
Sbjct: 181 AELGADILINYREQDFVEEIRENTAGAGADVILDLIGAKYLDRNVQALAVNGRLAIIGLQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG    E+NL  +++KR  +T ++LR R    K +I  +++  +WPL+   V+ PV+   
Sbjct: 241 GGA-KGELNLGALLTKRAAVTATSLRGRPLQEKAAIVAAVREHVWPLIGGGVVKPVVDRT 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           LP+   A AH ++E S HIGK++L+
Sbjct: 300 LPMADAAEAHRVLESSAHIGKVLLV 324


>gi|147863686|emb|CAN83618.1| hypothetical protein VITISV_008189 [Vitis vinifera]
          Length = 325

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 211/326 (64%), Gaps = 1/326 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G   V+ + E   P+    E+LI+VEA  +NR D +QRKGL+PPPK ++P 
Sbjct: 1   MKAVVITTPGDPQVLQVQEVENPEIGDNEVLIRVEASALNRADTLQRKGLHPPPKGSSPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G I  +G+    W +GD+VCAL+ GGGYAE      G  LP+P G +   AA++
Sbjct: 61  PGLECSGIIEAVGKAVVRWKVGDQVCALLAGGGYAEKVSVPAGQVLPVPSGVSLKDAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F  + L +G+T LIHGGSSGIGT AIQ+A Y GA V+ TA +EEK   C
Sbjct: 121 PEVACTVWSTVFMMSRLTAGETFLIHGGSSGIGTFAIQIAKYIGARVFVTAGNEEKLAVC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY  EDF+  +++ET G+G+D+ILD +G  Y  +++  L+ +G+L II F 
Sbjct: 181 KDLGADVCINYKTEDFVARVKEETGGKGVDVILDNIGGAYFQRNIDSLNVDGRLFIIGFQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +A E+NL+ ++++R+T+  + LR R+   K +I   ++  +WP + +  + PV++  
Sbjct: 241 GGTVA-EVNLSGLLARRLTVQAAGLRNRSLENKAAIVSEVEKNVWPAIVAGKVKPVVYKY 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILLP 332
            PL + A AH +ME S H+GKI+L+P
Sbjct: 300 FPLTEAAEAHQLMESSNHVGKILLIP 325


>gi|113971741|ref|YP_735534.1| alcohol dehydrogenase [Shewanella sp. MR-4]
 gi|113886425|gb|ABI40477.1| Alcohol dehydrogenase, zinc-binding domain protein [Shewanella sp.
           MR-4]
          Length = 332

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 217/322 (67%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           H+ +   G+  VM L  SP+P     ++LI+  A+GVN PD+ QR G+YPPP  A+PI+G
Sbjct: 10  HIYLEQPGEPEVMQLTRSPLPVLSAGQVLIRNCAVGVNGPDIKQRMGMYPPPPGASPIIG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG+I  LG+  T W +GD+VCALV GGGY EY L++  H LPIP+G++ +QAA+LPE
Sbjct: 70  LEVAGEICALGDGVTQWQLGDKVCALVPGGGYGEYTLTYAVHCLPIPQGFSEVQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW NLF  A L++G+TVLIHGGS GIG+TAI LA + GATV TT   +EK   C  
Sbjct: 130 TFFTVWGNLFMRAGLKAGETVLIHGGSGGIGSTAISLAKHLGATVITTTGQDEKRDYCSG 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA   +NY  ++F+E +   TQG+G++++ D+ G +++N +L  L+ +G+++ +S    
Sbjct: 190 LGAHLVVNYNTQNFVEEVMAFTQGKGVNVVFDIAGGDFINLNLQALALDGRMVSVSTQRS 249

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+N+  +++KRI  TGSTLR +T  AK  I   L   +WPLL+S  I P I    P
Sbjct: 250 AKA-EVNILQLMAKRIVWTGSTLRPQTVEAKAEIAKQLAEHVWPLLDSQQIVPHICATFP 308

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           L + A AH +M+  EH GK++L
Sbjct: 309 LAEAAKAHALMQSGEHRGKVVL 330


>gi|123442818|ref|YP_001006794.1| Zinc-binding dehydrogenase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089779|emb|CAL12632.1| probable Zinc-binding dehydrogenase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 336

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 155/325 (47%), Positives = 211/325 (64%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G   V+   + P P P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 11  MVAIEITQPGGPEVLTPIQRPTPMPAAGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDI 70

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG +V +  + T + IGD+VC L+ GGGYA+YC+ H+ + L IP     I+AA+L
Sbjct: 71  PGLEIAGVVVAVAADVTRFKIGDKVCGLIAGGGYAQYCVIHETNALFIPPSLTEIEAAAL 130

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLA 185
           PE+FFTVW NLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FGA  V  T  SEEK  A
Sbjct: 131 PETFFTVWTNLFQRGHFTAGETVLIHGGSSGIGTTAILLSKAFGAKMVIVTVGSEEKRQA 190

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA  AINY  EDF+   ++ T G+G+D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 191 CLTLGADIAINYHTEDFVTETKRATAGKGVDVIVDLIAGDYVARNYEAAAMNGRIVQIGT 250

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             G+ A ++NL  ++ KR+T TGSTLR RT   K  I   L+ ++WPLLN   + P I  
Sbjct: 251 QNGH-AKDLNLMLMLLKRLTHTGSTLRSRTVAEKALIAKELEQQVWPLLNDGKMKPQIFQ 309

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL   A AH++ME S HIGKI+L
Sbjct: 310 TFPLEDAAKAHELMESSTHIGKIVL 334


>gi|332161289|ref|YP_004297866.1| Zinc-binding dehydrogenase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318605200|emb|CBY26698.1| putative Zinc-binding dehydrogenase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665519|gb|ADZ42163.1| Zinc-binding dehydrogenase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863574|emb|CBX73687.1| putative quinone oxidoreductase [Yersinia enterocolitica W22703]
          Length = 336

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 155/325 (47%), Positives = 210/325 (64%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G   V+   + P P P   EIL+KV A GVNRPDVMQR+G Y PP  A+ I
Sbjct: 11  MVAIEITQPGDPEVLTPIQRPTPMPAAGEILVKVSAAGVNRPDVMQRRGQYAPPPGASDI 70

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG +V +  + T + IGD+VC L+ GGGYA+YC+ H+ + L IP     I+AA+L
Sbjct: 71  PGLEIAGVVVAVAADVTRFKIGDKVCGLIAGGGYAQYCVIHETNALFIPPSLTEIEAAAL 130

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLA 185
           PE+FFTVW NLFQ  +  +G+TVLIHGGSSGIGTTAI L+  FGA  V  T  SEEK  A
Sbjct: 131 PETFFTVWTNLFQRGHFTAGETVLIHGGSSGIGTTAILLSKAFGAKMVIVTVGSEEKRQA 190

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA  AINY  EDF+   ++ T G+G D+I+D++  +Y+ ++    +  G+++ I  
Sbjct: 191 CLTLGADIAINYHTEDFVAETKRATAGKGADVIVDLIAGDYVTRNYEAAAMNGRIVQIGT 250

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             G+ A ++NL  ++ KR+T TGSTLR RT   K  I   L+ ++WPLLN   + P I  
Sbjct: 251 QNGH-AKDLNLMLMLLKRLTHTGSTLRSRTVAEKALIAKELEQQVWPLLNDGKMKPQIFQ 309

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL   A AH++ME S HIGKI+L
Sbjct: 310 TFPLEDAAKAHELMESSTHIGKIVL 334


>gi|318062338|ref|ZP_07981059.1| quinone oxidoreductase [Streptomyces sp. SA3_actG]
 gi|318078591|ref|ZP_07985923.1| quinone oxidoreductase [Streptomyces sp. SA3_actF]
          Length = 326

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 140/324 (43%), Positives = 211/324 (65%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +S  G  +V+  +E   P+P   E+L++V A  VNR D++QR+G Y PP  A+P 
Sbjct: 1   MHAITISEPGGPDVLLWSEVDDPRPAPGEVLVEVVASAVNRADLLQRQGFYDPPPGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G+I  LG   + W +GDEVCAL+ GGGYAE      G  LP+P G + ++AA+L
Sbjct: 61  PGLEVSGRIAALGAGVSGWAVGDEVCALLGGGGYAEKVAVPAGQLLPVPSGVDLVEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A LR G+T+L+HGGSSGIGT AIQLA    A V  TA +  K  +C
Sbjct: 121 PEVVCTVWSNVFMVAGLRPGETLLVHGGSSGIGTMAIQLAKAVDARVAVTAGTAAKLESC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY ++DF+  L K T+G G D+ILD +GA+YL++++  L+  G+L II   
Sbjct: 181 RELGADILINYREQDFVAELGKATEGHGADVILDNMGAKYLDRNIQALATSGRLAIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E+NL+ +++KR  +T ++LR R    K ++  +++  +WPLL+S  + PV+   
Sbjct: 241 GG-VKGELNLSALMNKRAAVTATSLRARPATEKAAVVAAVREHVWPLLSSGAVKPVVDRR 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           +P+ + A  H ++++S HIGK++L
Sbjct: 300 IPMSEAATGHRVLDESTHIGKVLL 323


>gi|206562005|ref|YP_002232768.1| putative quinone oxidoreductase [Burkholderia cenocepacia J2315]
 gi|198038045|emb|CAR53991.1| putative quinone oxidoreductase [Burkholderia cenocepacia J2315]
          Length = 345

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 208/316 (65%), Gaps = 2/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  +V+  A   +P P  +++LI++ A GVN PDV QRKGLY PP  A+ I GLE+AG++
Sbjct: 10  GGPDVLVPATRAVPVPGPDDVLIRIHAAGVNGPDVFQRKGLYDPPPGASDIPGLEIAGEV 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V +G + T + +GD VCAL+ GGGYAEY ++++ +TL IP G    +AA+LPE+F TVW 
Sbjct: 70  VAVGRDVTRFAVGDRVCALIPGGGYAEYAVANESNTLAIPDGLGMAEAAALPETFMTVWL 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHA 194
           NLFQ   L  G++VLIHGG+SGIGTTA  LA  FGA T+ TT  SE +  A ++LGA  A
Sbjct: 130 NLFQRGRLSPGESVLIHGGASGIGTTATMLAKAFGASTIITTVGSEAQRDASMRLGADLA 189

Query: 195 INYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEI 254
           I+Y  EDF+E + + T G+G+D+I+D++  +Y+ ++    +  G+++ I  + G  A E+
Sbjct: 190 IDYRSEDFVEAVARFTGGKGVDVIVDIIAGDYVARNFAAAAMNGRIVQIGVINGP-AKEL 248

Query: 255 NLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAM 314
           +L P+++KR+T  GSTLR RT   K  I   L+  +WPL+    + P ++ +  L     
Sbjct: 249 DLFPMLTKRLTHIGSTLRSRTYAEKAQIIRELEEAVWPLIRQGTVKPRVYRLFDLRDARA 308

Query: 315 AHDIMEKSEHIGKIIL 330
           AH++M+   HIGKI+L
Sbjct: 309 AHELMDSGRHIGKIVL 324


>gi|282863264|ref|ZP_06272323.1| NAD(P)H quinone oxidoreductase, PIG3 family [Streptomyces sp. ACTE]
 gi|282561599|gb|EFB67142.1| NAD(P)H quinone oxidoreductase, PIG3 family [Streptomyces sp. ACTE]
          Length = 328

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 204/315 (64%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G    +  AE P P P + E+L++V +  VNR DV+QR+G Y PP  A+P  GLE AG++
Sbjct: 10  GGPEALVWAEVPDPVPGEGEVLVEVVSSAVNRADVLQRQGFYNPPPGASPYPGLECAGRV 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
             LG   T W++GDEVC L+ GGGYAE      G  LP+P+G +   AA+LPE   TVW+
Sbjct: 70  AALGPGVTGWSVGDEVCGLLAGGGYAEKVAVPSGQLLPVPEGVDLTVAAALPEVTATVWS 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  A+LR G+T+L+HGGSSGIGT AIQLA   GA V  TA   EK   C +LGA   I
Sbjct: 130 NVFMVAHLRPGETLLVHGGSSGIGTMAIQLAKAVGARVAVTAGGPEKLARCKELGADILI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           +Y ++DF+E L++ T G G D+ILD+VGA+YL++++  L+  G+L II   GG    E+N
Sbjct: 190 DYREQDFVEELRQATDGVGADVILDIVGAKYLDRNVRALAVNGRLAIIGLQGGA-KGELN 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           LN +++KR  +T ++LR R    K +I  +++  +WPL+   V+ P++   LP+   A A
Sbjct: 249 LNALLTKRAAVTATSLRSRPLAEKAAIIAAVREHVWPLIADGVVRPIVDRTLPMADAAEA 308

Query: 316 HDIMEKSEHIGKIIL 330
           H ++E S HIGK++L
Sbjct: 309 HRVLESSTHIGKVLL 323


>gi|325525085|gb|EGD02980.1| PIG3 family NAD(P)H quinone oxidoreductase [Burkholderia sp. TJI49]
          Length = 349

 Score =  292 bits (748), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 207/317 (65%), Gaps = 2/317 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+      +P P   E+LI+V A GVN PDV QRKGLY PP  A+ I GLE+AG++
Sbjct: 17  GGPEVLVPTTRAVPSPAPGEVLIRVHAAGVNGPDVFQRKGLYDPPPGASDIPGLEIAGEV 76

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V +G + T + IGD VCAL+ GGGYA+Y ++ + +TL IP+G    +AA++PE+F TVW 
Sbjct: 77  VAIGRDVTRFAIGDRVCALIPGGGYAQYAVADEHNTLAIPQGLGMAEAAAMPETFMTVWL 136

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHA 194
           NLFQ     +G++VLIHGG+SGIGTTA  LA  FGA+ + TT  S+ +  A ++LGA HA
Sbjct: 137 NLFQRGRFTAGESVLIHGGASGIGTTATMLARAFGASKIITTVGSDAQRDASVRLGADHA 196

Query: 195 INYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEI 254
           I+Y +EDF+E + + T G+G+D+I+D++  +Y+ ++    +  G+++ I  + G  A E+
Sbjct: 197 IDYRREDFIEAVARHTDGKGVDVIVDIIAGDYVARNFAAAAVNGRIVQIGVIKGP-AKEL 255

Query: 255 NLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAM 314
           +L P+++KR+T  GSTLR RT   K  I   L+  +WPL+    + P ++ +  L     
Sbjct: 256 DLFPMLTKRLTHIGSTLRSRTHAEKAQIIGELEAAVWPLIRQGSVKPQVYRLFDLRDARA 315

Query: 315 AHDIMEKSEHIGKIILL 331
           AH +M+   HIGKI+L+
Sbjct: 316 AHALMDSGRHIGKIVLV 332


>gi|322509248|gb|ADX04702.1| Putative oxydoreductase protein [Acinetobacter baumannii 1656-2]
          Length = 326

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 206/324 (63%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G   V+ L +S +P PQ +E+LI+V+A+G+NRPDV+QR GLYP PK    I
Sbjct: 1   MKIVEITVPGGPEVLKLQDSNVPVPQADEVLIEVKAVGINRPDVLQRMGLYPMPKGVTQI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +V +GE    + +GD+VCAL NGGGYAEYC       LPIP+  +  QAA++
Sbjct: 61  PGLEVAGVVVAVGEQVQQFKVGDKVCALTNGGGYAEYCAVTATQVLPIPENLSFTQAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWANLF    L+  +T LIHGG+SGIGTTA+ +    G   + T  SE+K  A 
Sbjct: 121 PETFFTVWANLFDIGRLKKDETTLIHGGASGIGTTALAICHALGIKTFATVGSEDKVEAL 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             L    AINY  +DF + +   TQ +G+D+ILD+VG  Y  ++L LL ++G+L+II F+
Sbjct: 181 SDLTT--AINYKTQDFEQEILNHTQEQGVDVILDIVGGSYFQKNLNLLKRDGRLVIIGFM 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG IA E +L  +I KR TITGST+R R    K  I  SL   +WPLL      P I+  
Sbjct: 239 GGRIAKEFDLQKLILKRATITGSTMRARNSQEKAQIAQSLHEHVWPLLEQGKCLPQIYKT 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
                V  AH  ME+ +HIGKI+L
Sbjct: 299 YAFSDVQSAHACMEQGDHIGKIVL 322


>gi|184159336|ref|YP_001847675.1| NADPH:quinone reductase [Acinetobacter baumannii ACICU]
 gi|332874223|ref|ZP_08442145.1| NAD(P)H quinone oxidoreductase, PIG3 family [Acinetobacter
           baumannii 6014059]
 gi|183210930|gb|ACC58328.1| NADPH:quinone reductase [Acinetobacter baumannii ACICU]
 gi|323519276|gb|ADX93657.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332737582|gb|EGJ68487.1| NAD(P)H quinone oxidoreductase, PIG3 family [Acinetobacter
           baumannii 6014059]
          Length = 332

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 155/330 (46%), Positives = 208/330 (63%), Gaps = 2/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   M+ V ++  G   V+ L +S +P PQ +E+LI+V+A+G+NRPDV+QR GLYP P
Sbjct: 1   MNLPTTMKIVEITVPGGPEVLKLQDSNVPVPQADEVLIEVKAVGINRPDVLQRMGLYPMP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K    I GLEVAG +V +GE    + +GD+VCAL NGGGYAEYC       LPIP+  + 
Sbjct: 61  KGVTQIPGLEVAGVVVAVGEQVQQFKVGDKVCALTNGGGYAEYCAVTATQVLPIPENLSF 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA++PE+FFTVWANLF    L+  +T LIHGG+SGIGTTA+ +    G   + T  SE
Sbjct: 121 TQAAAIPETFFTVWANLFDIGRLKKDETTLIHGGASGIGTTALAICHALGIKTFATVGSE 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +K  A   L    AINY  +DF + +   TQ +G+D+ILD+VG  Y  ++L LL ++G+L
Sbjct: 181 DKVEALSDLTT--AINYKTQDFEQEILNHTQEQGVDVILDIVGGSYFQKNLNLLKRDGRL 238

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +II F+GG IA E +L  +I KR TITGST+R R    K  I  SL   +WPLL      
Sbjct: 239 VIIGFMGGRIAKEFDLQKLILKRATITGSTMRARNSQEKAQIAQSLHEHVWPLLEQGKCL 298

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I+       V  AH  ME+ +HIGKI+L
Sbjct: 299 PQIYKTYAFSDVQSAHACMEQGDHIGKIVL 328


>gi|197344640|gb|ACH69670.1| putative zinc-containing alcohol dehydrogenase [uncultured
           proteobacterium]
          Length = 326

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 150/315 (47%), Positives = 204/315 (64%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G    + +A+ P P P   E+LIK+ A GVNR DV+QRKG YPPP  A    GLE AG I
Sbjct: 10  GGPEALVVAQRPTPVPNDTEVLIKIAAAGVNRADVLQRKGHYPPPPGAPSYPGLEAAGVI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
             +      + +GD+VCAL+ GGGYAEYC   +G  LPIP G N I+AASLPE++FTVW+
Sbjct: 70  AAVASAVRDFKVGDQVCALLQGGGYAEYCTVDEGQVLPIPAGLNMIEAASLPEAYFTVWS 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F    L+ G+T+L+HGGSSGIG  AIQLA+  G  V+TTA S+ KC  C +LGAK AI
Sbjct: 130 NVFGFGRLQPGETLLVHGGSSGIGVAAIQLATALGHIVFTTAGSDMKCRFCEQLGAKRAI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY  EDF + + ++T  RG+D++LDMVG  YL+ +++ L+ +G+L+II+   G    E++
Sbjct: 190 NYKTEDFAQEIAEQTAKRGVDVLLDMVGGSYLSNNISCLAPDGRLVIIATQSGT-KGEVD 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L  I+ +R+ +TGS LR R    K++I+  L   +WPLL    I P++  V PL     A
Sbjct: 249 LLRILQRRLVVTGSALRPRDVEFKRAIKGKLLEVVWPLLARGAIKPIVDKVFPLDAATDA 308

Query: 316 HDIMEKSEHIGKIIL 330
           H  ME   H GKI+L
Sbjct: 309 HAYMESGTHRGKIVL 323


>gi|37526244|ref|NP_929588.1| hypothetical protein plu2342 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785674|emb|CAE14635.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 338

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 152/311 (48%), Positives = 211/311 (67%), Gaps = 2/311 (0%)

Query: 21  MFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGE 80
           + L + P+P+P K  +L+KV A GVNRPD+ QR G YPPP +A+P+ GLE+AG++V  GE
Sbjct: 26  LHLVQVPLPRPGKGYLLVKVAAAGVNRPDIFQRMGSYPPPPDASPLPGLEIAGEVVAKGE 85

Query: 81  NTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQT 140
               WN+GD+VCALV GGGYAEYCL H    LPI  G + +QAA+LPE+FFTVWAN+FQT
Sbjct: 86  GCERWNLGDKVCALVAGGGYAEYCLVHDSVALPI-YGLDFVQAAALPENFFTVWANVFQT 144

Query: 141 ANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKE 200
             L+ G+ +LIHGG+SGIG+  I LA  FGA V TT  S+EK      LGA   INY KE
Sbjct: 145 GQLKPGENLLIHGGTSGIGSVTIMLAKAFGAKVITTVGSDEKAKVAHSLGADFVINYHKE 204

Query: 201 DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPII 260
           DF++ + K T   G+D+++D++G +Y+N++  + +K G++I I  + GN    +NL P++
Sbjct: 205 DFVDRVLKITGNHGVDMVVDLIGGDYVNKNYKVAAKFGRIIQIGMMKGN-PENLNLMPLM 263

Query: 261 SKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIME 320
            KR+T TGSTLR R+   K  I   L+ ++WPLL S  + P+I  V  L   A AH +ME
Sbjct: 264 LKRLTHTGSTLRSRSVEEKAEIAKELEKQVWPLLKSGKVTPLICKVFDLKDAADAHRMME 323

Query: 321 KSEHIGKIILL 331
             + IGK++L+
Sbjct: 324 AGDVIGKVMLV 334


>gi|84497499|ref|ZP_00996321.1| putative quinone oxidoreductase [Janibacter sp. HTCC2649]
 gi|84382387|gb|EAP98269.1| putative quinone oxidoreductase [Janibacter sp. HTCC2649]
          Length = 326

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 148/325 (45%), Positives = 206/325 (63%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +S  G    + L +   P+P+  E+ IKV A GVNR D +QR+G Y PP     I
Sbjct: 1   MKAITISEPGGPEALVLTDVDTPEPKSGEVRIKVAAAGVNRADTLQRQGFYNPPAGETDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G I  +GE  T W +GDEVCAL+ GGGYAE      G  LPIP G + I AA+L
Sbjct: 61  PGLEVSGVIDAVGEGVTEWVVGDEVCALLVGGGYAEQVTVPAGQVLPIPAGVDLIDAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F TANL+ G+T L+HGGSSGIGT AIQLA   GA V  TA S+EK   C
Sbjct: 121 PEVASTVWSNVFLTANLQPGETFLVHGGSSGIGTMAIQLAREVGARVAVTAGSQEKLDVC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+  INY  +DF+E L K T G G D+ILD +GA+YL +++  L+  G+L++I   
Sbjct: 181 RELGAEILINYRDQDFVEELAKATNGHGADVILDNMGAKYLPRNVDALATAGRLVVIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E++L  ++ KR  +  ++LR R    K +I  +++  +WP++    + P++H+ 
Sbjct: 241 GG-VKGELDLGKLLRKRGAVIATSLRARPVAEKATIVAAVREHVWPMIADGRVRPIVHSR 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
            PL   + AH  ME S+HIGKI+LL
Sbjct: 300 HPLANASDAHAEMEASQHIGKILLL 324


>gi|297803996|ref|XP_002869882.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gi|297315718|gb|EFH46141.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
          Length = 325

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 141/324 (43%), Positives = 209/324 (64%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +S  GK  V+ L +   P+ + +E+L++V A  +NR D +QR GLY PP  ++P 
Sbjct: 1   MKAIVISEPGKPEVLQLRDVADPEVKDDEVLVRVLATALNRADTLQRLGLYNPPPGSSPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I  +G+N + W +GD+VCAL++GGGYAE      G   P+P G +   A + 
Sbjct: 61  LGLECSGTIESVGKNVSRWKVGDQVCALLSGGGYAEKVSVPAGQIFPVPAGISLKDATAF 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F    L +G++ L+HGGSSGIGT AIQ+A + G  V+ TA +EEK  AC
Sbjct: 121 PEVACTVWSTVFMMGRLSAGESFLVHGGSSGIGTFAIQIAKHLGVRVFVTAGNEEKLAAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY  EDF+  ++ ET G+G+D+ILD +GA YL ++L  L+ +G+L II  +
Sbjct: 181 KELGADVCINYKTEDFVAKVKAETDGKGVDVILDCIGAPYLQKNLDSLNFDGRLCIIGLM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A EI L+ ++ KR+T+ G+ LR R+   K  +   ++  +WP + +  + PVIH  
Sbjct: 241 GGANA-EIKLSSLLPKRLTVLGAALRPRSPENKAVVVAEVEKNVWPAIEAGKVKPVIHKY 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LPL + A AH +ME S+HIGKI+L
Sbjct: 300 LPLSQAAEAHSLMESSKHIGKILL 323


>gi|302535520|ref|ZP_07287862.1| quinone oxidoreductase [Streptomyces sp. C]
 gi|302444415|gb|EFL16231.1| quinone oxidoreductase [Streptomyces sp. C]
          Length = 325

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 141/324 (43%), Positives = 208/324 (64%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +  AE P P   + E+L++V A  VNR DV+QR+GLY PP +A+P 
Sbjct: 1   MHAITIEQPGGPEALVWAEVPDPVADEGEVLVEVAASAVNRADVLQRQGLYDPPPDASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G+IV LG   + W +GDEVCAL++GGGYA+      G  LP+P G + + AA+L
Sbjct: 61  PGLECSGRIVALGPGVSGWAVGDEVCALLSGGGYAQRVAVPAGQLLPVPTGVDLVTAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A LR G+T+L+HGGSSGIGT AIQL    GA V  TA  +EK   C
Sbjct: 121 PEVVATVWSNVFMVAGLRPGETLLVHGGSSGIGTMAIQLGKAVGAKVAVTAGGKEKLARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   I+Y ++DF+E L+  T G G D++LD++GA+YL ++L  L+  G+L +I   
Sbjct: 181 AELGADVLIDYREQDFVEELRSATGGAGADVVLDIMGAKYLARNLDALAMNGRLAVIGLQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E++L  +++KR  IT ++LR R    K +I  +++  +WPL+ +  + PV+H  
Sbjct: 241 GG-VKAELDLRTLLAKRAAITATSLRARPLEEKAAIVAAVREHVWPLIAAGRVRPVVHAA 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P+ + A AH I+E S H+GK++L
Sbjct: 300 YPIAEAAEAHRILEASTHVGKLLL 323


>gi|307294292|ref|ZP_07574136.1| NAD(P)H quinone oxidoreductase, PIG3 family [Sphingobium
           chlorophenolicum L-1]
 gi|306880443|gb|EFN11660.1| NAD(P)H quinone oxidoreductase, PIG3 family [Sphingobium
           chlorophenolicum L-1]
          Length = 334

 Score =  291 bits (745), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 201/306 (65%), Gaps = 2/306 (0%)

Query: 25  ESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTH 84
           + P+P P  +E+LIKV A GVNRPDVMQR+G YPPP  A+ I GLEV+G IV  G  +  
Sbjct: 29  QRPVPAPGPDEVLIKVAAAGVNRPDVMQRRGNYPPPPGASDIPGLEVSGVIVAAG-GSAE 87

Query: 85  WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLR 144
             +G  VCALV+GGGYAEY ++  G  LP+P  Y+ ++AA+LPE+ FTVW+NLF+ A + 
Sbjct: 88  LLVGQRVCALVSGGGYAEYAVAPAGQCLPVPDDYDLVEAAALPETLFTVWSNLFERAYVV 147

Query: 145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLE 204
            G TVL+HGG+SGIGT AI L   F  TV  T  S+EKC      GA HAINY  +DF+E
Sbjct: 148 EGDTVLVHGGTSGIGTMAISLCKLFDITVIVTCGSDEKCGQAKAWGADHAINYRSQDFVE 207

Query: 205 ILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRI 264
            +++ T G+G+  +LDMVG +Y+ +++  L+++G+ + I+ +GG  A E+ +  I+S+R+
Sbjct: 208 EVKRITGGQGVQAVLDMVGGDYVPRNIQCLAEDGRHVSIAVMGGAKA-EVFIPTIMSRRL 266

Query: 265 TITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEH 324
           T+TGSTLR R+   K  + D L   +W  +    + P + +  PL   A AH  M+  +H
Sbjct: 267 TLTGSTLRPRSVAFKSLVADELMRVVWTFVEQGKLRPAVDSRFPLADAAKAHARMDAGDH 326

Query: 325 IGKIIL 330
            GKI+L
Sbjct: 327 FGKIVL 332


>gi|254515704|ref|ZP_05127764.1| alcohol dehydrogenase, zinc-binding domain protein [gamma
           proteobacterium NOR5-3]
 gi|219675426|gb|EED31792.1| alcohol dehydrogenase, zinc-binding domain protein [gamma
           proteobacterium NOR5-3]
          Length = 328

 Score =  291 bits (745), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 147/327 (44%), Positives = 212/327 (64%), Gaps = 3/327 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           K R+V ++   +S  + + E   P P  EE+LI+V A G+NR DV+QRKGLYPPP +A+P
Sbjct: 5   KRRYVHINEADRS--LCVREDRAPVPGAEEVLIEVAAAGLNRADVLQRKGLYPPPADASP 62

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I+GLEV+G ++  GE    +  GDEVCAL +GGGYA + ++ Q  TLP+P GY+  +AA+
Sbjct: 63  IMGLEVSGTVLACGEAVHDFKPGDEVCALTHGGGYASHAIAPQTQTLPVPSGYSLSEAAA 122

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+  TVW N+FQ A L++G+ VLIHGG+SGIGT  + +    GATVY+TA S +KC  
Sbjct: 123 LPEALLTVWHNVFQRAGLKAGENVLIHGGASGIGTLGVGICKAMGATVYSTAGSADKCRR 182

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
              LGA  A NY +EDF+  L       GI +ILDMVG +Y+ ++  + + EG+++ I+F
Sbjct: 183 IEALGATKAFNYKEEDFVAGLDALGLKGGISVILDMVGGDYIGRNFEVAAPEGRIVNIAF 242

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           L G    E+N  P++ KR+T+TGSTLR +++  K  +   ++ +++P LN   I  VI  
Sbjct: 243 LRG-FNAEVNFLPMLMKRLTLTGSTLRAQSEAQKAQMVREIREQLFPHLNDGSIKVVIDK 301

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIILLP 332
             PL +   A D ME   H+GKI+L P
Sbjct: 302 EFPLEETQAAQDYMESGVHMGKILLHP 328


>gi|33591971|ref|NP_879615.1| zinc-binding dehydrogenase [Bordetella pertussis Tohama I]
 gi|33602852|ref|NP_890412.1| zinc-binding dehydrogenase [Bordetella bronchiseptica RB50]
 gi|33571615|emb|CAE41105.1| probable zinc-binding dehydrogenase [Bordetella pertussis Tohama I]
 gi|33577294|emb|CAE35851.1| probable zinc-binding dehydrogenase [Bordetella bronchiseptica
           RB50]
 gi|332381387|gb|AEE66234.1| zinc-binding dehydrogenase [Bordetella pertussis CS]
          Length = 325

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 215/324 (66%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++  G   V+   E  +P+P   E+LIKV A GVNRPDV+QRKG Y PP  A+ +
Sbjct: 1   MRAVEITRPGGPEVLVPTERSVPEPASGEVLIKVSAAGVNRPDVLQRKGNYAPPPGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG+IV        + IGD+VCALV GGGYAEY ++     LPIP+G   I+AA L
Sbjct: 61  PGLEVAGEIVGGDAAAGGFAIGDKVCALVAGGGYAEYVVAPAPQCLPIPRGLTEIEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVW+N+F    L +G+ +L+HGG+SGIGTTAIQLA   G  VY T  S+E+  A 
Sbjct: 121 PETYFTVWSNVFDRGRLAAGEALLVHGGASGIGTTAIQLARAMGNKVYATVGSDERARAV 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY  +D+++ +   T G G+D++LDMV  EY+ ++L  L+ +G+++II+ L
Sbjct: 181 EALGAALGINYKTQDYVKEVLDATGGAGVDVVLDMVAGEYIGRNLKCLADDGRIVIIALL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A  ++ N ++ +R+TITGSTLR R    K  I  +L+ ++WPLL +  + PV+H  
Sbjct: 241 GGAHAN-VDCNQVLRRRLTITGSTLRPRPVEFKGEIARALRERVWPLLENGTLKPVVHAT 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LPL + A AH +ME  E+IGKIIL
Sbjct: 300 LPLEQAAAAHAMMEAGENIGKIIL 323


>gi|184158258|ref|YP_001846597.1| NADPH:quinone reductase [Acinetobacter baumannii ACICU]
 gi|183209852|gb|ACC57250.1| NADPH:quinone reductase [Acinetobacter baumannii ACICU]
 gi|322508586|gb|ADX04040.1| Alcohol dehydrogenase, zinc-binding protein [Acinetobacter
           baumannii 1656-2]
 gi|323518195|gb|ADX92576.1| NADPH:quinone reductase [Acinetobacter baumannii TCDC-AB0715]
          Length = 328

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 217/326 (66%), Gaps = 2/326 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +   G G   V+ ++E P+P+   + ILI+V A G+N PDVMQRKGLY PP     I
Sbjct: 1   MKCITFKGAGGPEVITVSERPMPELTDDGILIEVVAAGINGPDVMQRKGLYAPPPGVTDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G +  +G+  T +  GDEVCALV GGGYAEY ++HQ + L IP+G   I+   L
Sbjct: 61  PGLEVSGIVKQVGKQVTKFKAGDEVCALVPGGGYAEYVVAHQDNVLFIPEGLTLIEGGIL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLA 185
            E+F TVW++LFQ A  R   ++LIHGG+SGIGTTA  L   FGAT ++TT  S+E   A
Sbjct: 121 LETFMTVWSHLFQHAKFRPNSSILIHGGTSGIGTTATMLTRAFGATKIFTTVSSKEHQEA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
            LK+GA  AINY ++DF+E+++K T G+G+D +LD++  +Y+ ++  + +  G ++ I  
Sbjct: 181 SLKIGADVAINYNEDDFVEVVKKHTDGKGVDFVLDIIAGDYIQRNYEVAAMNGTILQIGV 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           L G +A ++N+ P+++KR+T TG+TLR +T  AK  +  +LQ K+WPL++   I P+++ 
Sbjct: 241 LKG-LADKVNIFPMLAKRLTHTGATLRSQTAEAKAEVMAALQEKVWPLISKGQIKPLLYK 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIILL 331
              L +   AH+ +++ +H+GK+ L+
Sbjct: 300 TFDLEEARQAHEFLDQGQHVGKLALI 325


>gi|126642796|ref|YP_001085780.1| putative oxydoreductase protein zinc-containing [Acinetobacter
           baumannii ATCC 17978]
 gi|213157785|ref|YP_002320583.1| NADPH:quinone oxidoreductase [Acinetobacter baumannii AB0057]
 gi|215482436|ref|YP_002324620.1| NAD(P)H quinone oxidoreductase, PIG3 family protein [Acinetobacter
           baumannii AB307-0294]
 gi|301347743|ref|ZP_07228484.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter
           baumannii AB056]
 gi|301510559|ref|ZP_07235796.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter
           baumannii AB058]
 gi|301594380|ref|ZP_07239388.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter
           baumannii AB059]
 gi|332853428|ref|ZP_08434747.1| NAD(P)H quinone oxidoreductase, PIG3 family [Acinetobacter
           baumannii 6013150]
 gi|332870589|ref|ZP_08439331.1| NAD(P)H quinone oxidoreductase, PIG3 family [Acinetobacter
           baumannii 6013113]
 gi|126388680|gb|ABO13178.1| putative oxydoreductase protein zinc-containing [Acinetobacter
           baumannii ATCC 17978]
 gi|213056945|gb|ACJ41847.1| NADPH:quinone oxidoreductase [Acinetobacter baumannii AB0057]
 gi|213987276|gb|ACJ57575.1| NAD(P)H quinone oxidoreductase, PIG3 family protein [Acinetobacter
           baumannii AB307-0294]
 gi|332728634|gb|EGJ60002.1| NAD(P)H quinone oxidoreductase, PIG3 family [Acinetobacter
           baumannii 6013150]
 gi|332732149|gb|EGJ63418.1| NAD(P)H quinone oxidoreductase, PIG3 family [Acinetobacter
           baumannii 6013113]
          Length = 332

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 155/330 (46%), Positives = 207/330 (62%), Gaps = 2/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   M+ V ++  G   V+ L +S +P PQ +E+LI+V+A G+NRPDV+QR GLYP P
Sbjct: 1   MNLPTTMKIVEITVPGGPEVLKLQDSNVPVPQADEVLIEVKAAGINRPDVLQRMGLYPMP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K    I GLEVAG +V +GE    + +GD+VCAL NGGGYAEYC       LPIP+  + 
Sbjct: 61  KGVTQIPGLEVAGVVVAVGEQVQQFKVGDKVCALTNGGGYAEYCAVTATQVLPIPENLSF 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA++PE+FFTVWANLF    L+  +T LIHGG+SGIGTTA+ +    G   + T  SE
Sbjct: 121 TQAAAIPETFFTVWANLFDIGRLKKDETALIHGGASGIGTTALAICHALGIKTFATVGSE 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +K  A   L    AINY  +DF + +   TQ +G+D+ILD+VG  Y  ++L LL ++G+L
Sbjct: 181 DKVEALSDLTT--AINYKTQDFEQEILNHTQEQGVDVILDIVGGSYFQKNLNLLKRDGRL 238

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +II F+GG IA E +L  +I KR TITGST+R R    K  I  SL   +WPLL      
Sbjct: 239 VIIGFMGGRIAKEFDLQKLILKRATITGSTMRARNSQEKAQIAQSLHEHVWPLLEQGKCL 298

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I+       V  AH  ME+ +HIGKI+L
Sbjct: 299 PQIYKTYAFSDVQSAHACMEQGDHIGKIVL 328


>gi|293610965|ref|ZP_06693264.1| NAD(P)H quinone oxidoreductase [Acinetobacter sp. SH024]
 gi|292826617|gb|EFF84983.1| NAD(P)H quinone oxidoreductase [Acinetobacter sp. SH024]
          Length = 332

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 207/330 (62%), Gaps = 2/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   M+ + ++  G   V+ + ++ IP PQ +E+LI+V+A G+NRPDV+QR GLYP P
Sbjct: 1   MTLPTTMKIIEITAPGGPEVLKVQDANIPAPQADEVLIEVKAAGINRPDVLQRMGLYPMP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K    I GLEVAG +V +GE    + +GD+VCAL NGGGYAEYC       LPIP+  + 
Sbjct: 61  KGVTQIPGLEVAGVVVAVGEQVDQFKVGDKVCALTNGGGYAEYCAVTATQVLPIPENLSF 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA++PE+FFTVWANLF    L+  +T LIHGG+SGIGTTA+ +    G   + T  SE
Sbjct: 121 TQAAAIPETFFTVWANLFDIGRLKKHETALIHGGASGIGTTALAICQALGIKTFATVGSE 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +K  A        AINY  +DF + + K TQ +G+D+ILD+VG  Y  ++L LL ++G+L
Sbjct: 181 DKIKALSSFTT--AINYKTQDFEQEVLKHTQDQGVDVILDIVGGSYFTKNLNLLKRDGRL 238

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +II F+GG IA E +L  +I KR TITGST+R R    K  I  SL   +WPLL      
Sbjct: 239 VIIGFMGGRIAKEFDLQKLILKRATITGSTMRARNSQEKAQIAQSLNEHVWPLLAQGKCL 298

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I+       V  AH  ME+ +HIGKI+L
Sbjct: 299 PQIYKSYAFSDVQSAHACMEQGDHIGKIVL 328


>gi|218191768|gb|EEC74195.1| hypothetical protein OsI_09347 [Oryza sativa Indica Group]
          Length = 328

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 148/329 (44%), Positives = 212/329 (64%), Gaps = 4/329 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAE--SPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           MR V ++  G   V+   +    +P P + E+L+ V A GVNR D +QR+G YP P  A+
Sbjct: 1   MRAVVIARAGGPEVLEERDVGEGLPPPGEGEVLVGVSAAGVNRADTVQRQGRYPAPPGAS 60

Query: 65  PILGLEVAGKIVDLGENT-THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           P  GLE +G I+ LG N  + W +GD+VCAL++GGGYAE  +   G  LP+P+G +   A
Sbjct: 61  PYPGLECSGTILALGPNVPSRWAVGDQVCALLSGGGYAEKVVVPAGQLLPVPEGVSLTDA 120

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A LPE   TVW+ +F T++L   ++ LIHGGSSGIGT AIQ+A + G  V+ TA SEEK 
Sbjct: 121 AGLPEVACTVWSTVFVTSHLSPSESFLIHGGSSGIGTFAIQIAKHLGIKVFVTAGSEEKL 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
            AC  LGA   INY  EDF+  +++ET G+G+D+ILD +G  YL ++L  L+ +G+L II
Sbjct: 181 AACKGLGADVCINYKTEDFVARVKEETNGKGVDVILDNIGGLYLQRNLNSLAVDGRLFII 240

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
            F GG + TE+NL P++++R+TI  + LR R+   K  I   ++  +WP +    + PVI
Sbjct: 241 GFQGGAV-TEVNLQPMLARRLTIQAAGLRNRSLDNKALIVSEVEKNVWPAVVQGKVKPVI 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
           +   PL + A AH +ME+S HIGKI+L+P
Sbjct: 300 YKTFPLSEAAEAHKLMEESSHIGKILLIP 328


>gi|256824292|ref|YP_003148252.1| NAD(P)H quinone oxidoreductase, PIG3 family [Kytococcus sedentarius
           DSM 20547]
 gi|256687685|gb|ACV05487.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Kytococcus
           sedentarius DSM 20547]
          Length = 326

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 143/325 (44%), Positives = 211/325 (64%), Gaps = 3/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +   G+  V+ L+E   P P + E+L++V A GVNR D++Q  G YPPP   + +
Sbjct: 1   MRAIVIDNSGEKPVLTLSEVEDPTPGEGEVLVEVAAAGVNRADLVQASGKYPPPPGESEL 60

Query: 67  LGLEVAGKIVDLGE-NTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           +GLEV+G+I  LG  +T  W +GDEVCAL+ GGGYAE      G  LP+P G +   AAS
Sbjct: 61  IGLEVSGRIAALGAGDTGDWQVGDEVCALLAGGGYAEKVAVSAGQLLPVPAGVDLQTAAS 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE   TVW+NL    +L +G+TVL+HGGSSGIGT  IQ+A   GA V  TA S+EK   
Sbjct: 121 LPEVACTVWSNLVDAGHLAAGETVLLHGGSSGIGTMGIQVAKALGARVIVTAGSQEKLQR 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C +LGA   +NY + DFLE + + T+  G+D+ILD++GA+YL+++L  L+K+G+L+II  
Sbjct: 181 CAELGADVLVNYQETDFLEAVGENTE-DGVDVILDLIGADYLDRNLQALAKDGRLVIIGL 239

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           +GG    EINL  ++ +R+++  + LR R    K  I  +++  +WP + S  I PV+  
Sbjct: 240 MGGR-EGEINLGLMLQRRLSVQATALRGRDRADKARIVAAVRENVWPRVESGEIRPVVQE 298

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
           VLP  K   AH ++++S+H+GK++L
Sbjct: 299 VLPWEKAQEAHQLLKESQHVGKVVL 323


>gi|169794889|ref|YP_001712682.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter
           baumannii AYE]
 gi|169147816|emb|CAM85679.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter
           baumannii AYE]
          Length = 370

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 155/330 (46%), Positives = 207/330 (62%), Gaps = 2/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   M+ V ++  G   V+ L +S +P PQ +E+LI+V+A G+NRPDV+QR GLYP P
Sbjct: 39  MNLPTTMKIVEITVPGGPEVLKLQDSNVPVPQADEVLIEVKAAGINRPDVLQRMGLYPMP 98

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K    I GLEVAG +V +GE    + +GD+VCAL NGGGYAEYC       LPIP+  + 
Sbjct: 99  KGVTQIPGLEVAGVVVAVGEQVQQFKVGDKVCALTNGGGYAEYCAVTATQVLPIPENLSF 158

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA++PE+FFTVWANLF    L+  +T LIHGG+SGIGTTA+ +    G   + T  SE
Sbjct: 159 TQAAAIPETFFTVWANLFDIGRLKKDETALIHGGASGIGTTALAICHALGIKTFATVGSE 218

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +K  A   L    AINY  +DF + +   TQ +G+D+ILD+VG  Y  ++L LL ++G+L
Sbjct: 219 DKVEALSDLTT--AINYKTQDFEQEILNHTQEQGVDVILDIVGGSYFQKNLNLLKRDGRL 276

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +II F+GG IA E +L  +I KR TITGST+R R    K  I  SL   +WPLL      
Sbjct: 277 VIIGFMGGRIAKEFDLQKLILKRATITGSTMRARNSQEKAQIAQSLHEHVWPLLEQGKCL 336

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I+       V  AH  ME+ +HIGKI+L
Sbjct: 337 PQIYKTYAFSDVQSAHACMEQGDHIGKIVL 366


>gi|167590366|ref|ZP_02382754.1| Alcohol dehydrogenase, zinc-binding protein [Burkholderia ubonensis
           Bu]
          Length = 332

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 138/325 (42%), Positives = 207/325 (63%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G  +V+   + P+P P   E+LI+V A GVN PD++QRKGLY PP  A+ I
Sbjct: 1   MTAIEITQPGAPDVLAPVQRPVPAPAAGEVLIRVHAAGVNGPDLLQRKGLYDPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG+IV +G + T   +G+ VCAL+ GGGYAEY ++H+ + L IP G + ++AA++
Sbjct: 61  PGLEIAGEIVAVGRDVTRLAVGERVCALITGGGYAEYAVAHESNALAIPDGLSMVEAAAM 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLA 185
           PE+F TVW NLFQ     +G +VLIHGG+SGIGTTA  LA  FGA T+ TT  S+ +  A
Sbjct: 121 PETFLTVWLNLFQRGRFAAGDSVLIHGGASGIGTTATMLAKAFGASTIITTVSSDVQRDA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
              LGA   +NY  EDF+E   + T GRG+D+++D+V  +Y+ ++    +  G+++ I  
Sbjct: 181 SRALGADVVVNYRNEDFVEAAMRATNGRGVDVVVDIVAGDYVARNYAAAAMNGRIVQIGV 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           + G  A  ++L P+++KR+T  GSTLR RT   K ++ + L+  +WP +    + P+I  
Sbjct: 241 IKGP-AQALDLFPMLTKRLTHLGSTLRSRTPAEKAALIEDLERAVWPHIRRGTVKPLIDR 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
              L     AH +ME S HIGK++L
Sbjct: 300 TFDLDDARAAHALMEASAHIGKVVL 324


>gi|147766549|emb|CAN76421.1| hypothetical protein VITISV_002784 [Vitis vinifera]
          Length = 325

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 140/326 (42%), Positives = 208/326 (63%), Gaps = 1/326 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G   V+ + E   P+    E+LI+VEA  +NR D +QRKGLYP PK ++P 
Sbjct: 1   MKAVVITTPGDPQVLQVQEVENPEIGDNEVLIRVEATALNRADTLQRKGLYPSPKGSSPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G I  +G+    W +GD+VCAL+ GGGYAE      G  LP+P G +   AA +
Sbjct: 61  PGLECSGIIEAVGKAVVRWKVGDQVCALLAGGGYAEKVSVPAGQVLPVPSGVSLKDAAGI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +   + L +G+T LIHGGSSGIGT AIQ+A Y GA V+ TA +EEK   C
Sbjct: 121 PEVACTVWSTVLMMSRLTAGETFLIHGGSSGIGTFAIQIAKYIGARVFVTAGNEEKLAVC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY  EDF+  +++ET G+G+D+ILD +G  Y  +++  L+ +G+L II F 
Sbjct: 181 KDLGADVCINYKTEDFVARVKEETGGKGVDVILDNIGGAYFQRNIDSLNVDGRLFIIGFQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +A E+NL+ ++++R+T+  + LR R+   K +I   ++  +WP + +  + PV++  
Sbjct: 241 GGTVA-EVNLSGLLARRLTVQAAGLRNRSLENKAAIVSEVEKNVWPAIVAGKVKPVVYKY 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILLP 332
            PL + A AH +ME S H+GKI+L+P
Sbjct: 300 FPLTEAAEAHQLMESSNHVGKILLIP 325


>gi|284988910|ref|YP_003407464.1| NAD(P)H quinone oxidoreductase, PIG3 family [Geodermatophilus
           obscurus DSM 43160]
 gi|284062155|gb|ADB73093.1| NAD(P)H quinone oxidoreductase, PIG3 family [Geodermatophilus
           obscurus DSM 43160]
          Length = 329

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 144/328 (43%), Positives = 208/328 (63%), Gaps = 4/328 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V +SG G   V+   E P P  +  E+L+ V A  VNR D++QR G YPPP  A+ +
Sbjct: 1   MRAVTVSGPGGPEVLGWGEVPDPVLRPGEVLVDVVATAVNRADLLQRAGAYPPPPGASDV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G + ++GE    W++GDEVCAL++GGGYAE      G  LP P G     AA+L
Sbjct: 61  LGLECSGVVSEVGEGVAGWSVGDEVCALLSGGGYAERVAVPAGQLLPRPAGVELATAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A LR G T L+HGGSSGIGT AIQLA+  GA V TTA ++ K   C
Sbjct: 121 PEVVCTVWSNVFMLAGLRRGDTFLVHGGSSGIGTMAIQLAARAGARVLTTAGTQAKLDVC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+  INY  EDF+E +++ET G G D++LD +GA+YL +++ +L+  G+L+ I   
Sbjct: 181 RELGAEVGINYRAEDFVERVREETDGAGADVVLDNMGAKYLARNVDVLATGGRLVCIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDI---AKQSIRDSLQLKIWPLLNSHVIAPVI 303
           GG  A E++L  ++ KR ++  +TLR R       K  I  +++  +WP +   V+ P++
Sbjct: 241 GGTRA-ELDLGKLMRKRASVHATTLRARPATGPGGKAEIVAAVRHDVWPDVERGVVRPIV 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIILL 331
              LP+ + A AH +++ SEH+GK++LL
Sbjct: 300 DRRLPMSRAAEAHRVVDASEHVGKVLLL 327


>gi|260557255|ref|ZP_05829471.1| NADPH:quinone oxidoreductase [Acinetobacter baumannii ATCC 19606]
 gi|260409361|gb|EEX02663.1| NADPH:quinone oxidoreductase [Acinetobacter baumannii ATCC 19606]
          Length = 370

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 155/330 (46%), Positives = 207/330 (62%), Gaps = 2/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   M+ V ++  G   V+ L +S +P PQ +E+LI+V+A G+NRPDV+QR GLYP P
Sbjct: 39  MNLPTTMKIVEITVPGGPEVLKLQDSNVPVPQADEVLIEVKAAGINRPDVLQRMGLYPMP 98

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K    I GLEVAG +V +GE    + +GD+VCAL NGGGYAEYC       LPIP+  + 
Sbjct: 99  KGVTQIPGLEVAGVVVAVGEQVQQFKVGDKVCALTNGGGYAEYCAVTATQVLPIPENLSF 158

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA++PE+FFTVWANLF    L+  +T LIHGG+SGIGTTA+ +    G   + T  SE
Sbjct: 159 TQAAAIPETFFTVWANLFDIGRLKKDETALIHGGASGIGTTALAICHALGIKTFATVGSE 218

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +K  A   L    AINY  +DF + +   TQ +G+D+ILD+VG  Y  ++L LL ++G+L
Sbjct: 219 DKVEALSNLTT--AINYKTQDFEQEILNHTQEQGVDVILDIVGGSYFQKNLNLLKRDGRL 276

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +II F+GG IA E +L  +I KR TITGST+R R    K  I  SL   +WPLL      
Sbjct: 277 VIIGFMGGRIAKEFDLQKLILKRATITGSTMRARNSQEKAQIAQSLHEHVWPLLEQGKCL 336

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I+       V  AH  ME+ +HIGKI+L
Sbjct: 337 PQIYKTYAFSDVQSAHACMEQGDHIGKIVL 366


>gi|290958949|ref|YP_003490131.1| quinone oxidoreductase [Streptomyces scabiei 87.22]
 gi|260648475|emb|CBG71586.1| putative quinone oxidoreductase [Streptomyces scabiei 87.22]
          Length = 326

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 139/325 (42%), Positives = 210/325 (64%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +   E P P P + E+LI+V A  VNR D++QR+G Y PP  A+P 
Sbjct: 1   MHAITIPEPGGPEALVWDEVPDPVPGEGEVLIEVAASAVNRADLLQRQGFYDPPPGASPH 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G++ ++G     WN+GDEVCAL++GGGYAE  ++     LP+P G     AA+L
Sbjct: 61  PGLECSGRVAEIGPGVAGWNVGDEVCALLSGGGYAEKVVAPAAQLLPVPAGVGLTAAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A+LR G+T+L+HGGSSGIGT A+QLA   GA V  TA +EEK   C
Sbjct: 121 PEVTCTVWSNVFMIAHLRPGETLLVHGGSSGIGTMAVQLAKAVGAKVAVTAGTEEKLARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY ++DF+E ++K T G+G D++LD +GA+YL++++ +L+  G+L II   
Sbjct: 181 AALGADILINYREQDFVEEVRKATDGKGADVVLDNMGAKYLDRNVRVLAVNGRLAIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E+N+  +++KR  I+ ++LR R    K +I  +++  +WPLL+   + PV+   
Sbjct: 241 GG-VKGELNIGALLAKRAAISATSLRARPREEKAAIVAAVREHVWPLLDGGHVRPVVDRE 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           +P+   A AH ++E S HIGK++L+
Sbjct: 300 IPMDNAATAHRVLEDSGHIGKVLLV 324


>gi|33597945|ref|NP_885588.1| zinc-binding dehydrogenase [Bordetella parapertussis 12822]
 gi|33574374|emb|CAE38712.1| probable zinc-binding dehydrogenase [Bordetella parapertussis]
          Length = 325

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 214/324 (66%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++  G   V+   E  +P+P   E+LIKV   GVNRPDV+QRKG Y PP  A+ +
Sbjct: 1   MRAVEITRPGGPEVLVPTERSVPEPASGEVLIKVSVAGVNRPDVLQRKGNYAPPPGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG+IV        + IGD+VCALV GGGYAEY ++     LPIP+G   I+AA L
Sbjct: 61  PGLEVAGEIVGGDAAAGGFAIGDKVCALVAGGGYAEYVVAPAPQCLPIPRGLTEIEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++FTVW+N+F    L +G+ +L+HGG+SGIGTTAIQLA   G  VY T  S+E+  A 
Sbjct: 121 PETYFTVWSNVFDRGRLAAGEALLVHGGASGIGTTAIQLARAMGNKVYATVGSDERARAV 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY  +D+++ +   T G G+D++LDMV  EY+ ++L  L+ +G+++II+ L
Sbjct: 181 EALGAALGINYKTQDYVKEVLDATGGAGVDVVLDMVAGEYIGRNLKCLADDGRIVIIALL 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A  ++ N ++ +R+TITGSTLR R    K  I  +L+ ++WPLL +  + PV+H  
Sbjct: 241 GGAHAN-VDCNQVLRRRLTITGSTLRPRPVEFKGEIARALRERVWPLLENGTLKPVVHAT 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LPL + A AH +ME  E+IGKIIL
Sbjct: 300 LPLEQAAAAHAMMEAGENIGKIIL 323


>gi|254383338|ref|ZP_04998690.1| quinone oxidoreductase [Streptomyces sp. Mg1]
 gi|194342235|gb|EDX23201.1| quinone oxidoreductase [Streptomyces sp. Mg1]
          Length = 325

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 142/324 (43%), Positives = 205/324 (63%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +  AE P P   + E+L++V A  VNR D++QR+G Y PP  ++  
Sbjct: 1   MHAITIEQPGGPEALVWAEVPDPVAGEGEVLVEVAASAVNRADILQRQGFYDPPPGSSRH 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G+IV +G   + W +GDEVCAL+ GGGYAE      G  LP+P+G + + AA+L
Sbjct: 61  PGLECSGRIVAIGPGVSGWAVGDEVCALLAGGGYAERVAVPAGQLLPVPEGVDLVTAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A LR G+TVL+HGGSSGIGT AIQLA   GA V  TA   EK   C
Sbjct: 121 PEVVCTVWSNIFMIAQLRPGETVLVHGGSSGIGTMAIQLAKAIGAKVAVTAGGPEKLARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   I+Y ++DF+  L+  T G G D+ILD+VGA+YL ++L  L+  G+L +I   
Sbjct: 181 RELGADVLIDYREQDFVAELRAATDGAGADVILDIVGAKYLGRNLDALAVNGRLAVIGLQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E+NL  +++KR  IT ++LR R    K +I  +++  +WPL+++  +APV+H  
Sbjct: 241 GG-VKAELNLGALLAKRAAITATSLRARPLGEKAAIVAAVREHVWPLVSTGRVAPVVHAA 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P+   A AH +ME S H+GK++L
Sbjct: 300 FPMRDAAEAHRVMESSAHVGKLLL 323


>gi|332969504|gb|EGK08523.1| NADPH:quinone reductase [Desmospora sp. 8437]
          Length = 327

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 143/325 (44%), Positives = 207/325 (63%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++  G    + L E+P+P+P  +E+L++V+A  +NR D+MQR+G YPPP  A+PI
Sbjct: 1   MRAVIVNQPGGPEQLELGEAPLPRPAADELLVRVQATALNRADIMQRQGKYPPPPGASPI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE+AG + ++GE    W +GD V  L+ GGGYAEY +      LP+PKG N ++AA++
Sbjct: 61  LGLEMAGVVEEVGEKCRDWKVGDRVFGLLPGGGYAEYAVIPGQMALPVPKGLNTVEAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
            E F T +  LF   +L+ G  VLIH G+SG+GT AIQLA   GATV+TTA S EK  AC
Sbjct: 121 AEVFLTAYQALFWLGDLQKGDRVLIHAGASGVGTAAIQLAKSHGATVFTTAGSREKLKAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA  A+NY +  F   +QK     G+ +ILD VGA Y  Q++  L  +GKL++IS +
Sbjct: 181 LSLGADLALNYKEGPFAPAVQKAAGTEGVQVILDFVGAPYWEQNVDSLGMDGKLVLISTM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           GG      +L P ++KR+ +TG+TLR R+ D  K+  RD  ++ + P  +   + P+I  
Sbjct: 241 GGTRPENFSLGPFLAKRLQLTGTTLRSRSLDYKKRLTRDFAEMAL-PRFDDGRLRPIIDR 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
           + P  +V  AH  ME++ +IGKI+L
Sbjct: 300 IFPWDEVREAHRYMEENRNIGKIVL 324


>gi|254249379|ref|ZP_04942699.1| NADPH:quinone reductase and related Zn-dependent oxidoreductase
           [Burkholderia cenocepacia PC184]
 gi|124875880|gb|EAY65870.1| NADPH:quinone reductase and related Zn-dependent oxidoreductase
           [Burkholderia cenocepacia PC184]
          Length = 379

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 213/331 (64%), Gaps = 2/331 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           P+   M  + +   G  +V+  A   +P P   ++LI++ A GVN PDV QRKGLY PP 
Sbjct: 30  PLPTHMTAIEIVRPGGPDVLVPATRAVPVPGPGDVLIRIHAAGVNGPDVFQRKGLYDPPP 89

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A+ I GLE+AG++V +G + T + +GD VCAL+ GGGYAEY ++++ +TL IP G    
Sbjct: 90  GASDIPGLEIAGEVVAIGRDVTRFVVGDRVCALIPGGGYAEYAVANESNTLAIPDGLGMA 149

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSE 180
           +AA+LPE+F TVW NLFQ     +G++VLIHGG+SGIGTTA  LA  FG AT+ TT  S+
Sbjct: 150 EAAALPETFMTVWLNLFQRGRFAAGESVLIHGGASGIGTTATMLAKAFGAATIITTVGSD 209

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
            +  A ++LGA  AI+Y  EDF+E + + T G+G+D+I+D++  +Y+ ++    +  G++
Sbjct: 210 AQRDASMRLGADLAIDYRSEDFVEAVARFTGGKGVDVIVDIIAGDYVARNFAAAAMNGRI 269

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I  + G  A E++L P+++KR+T  GSTLR RT   K  I   L+  +WPL+    + 
Sbjct: 270 VQIGVINGP-AKELDLFPMLTKRLTHIGSTLRSRTYGEKAQIIRELEEAVWPLIRQGTVK 328

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
           P ++ +  L     AH++M+   HIGKI+L+
Sbjct: 329 PQVYRLFDLRDARAAHELMDSGRHIGKIVLV 359


>gi|116695284|ref|YP_840860.1| NADPH:quinone reductase or related Zn-dependent oxidoreductase
           [Ralstonia eutropha H16]
 gi|113529783|emb|CAJ96130.1| NADPH:quinone reductase or related Zn-dependent oxidoreductase
           [Ralstonia eutropha H16]
          Length = 339

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 210/329 (63%), Gaps = 2/329 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I   M  + +   G   V+     P+P P   E+LI+  A GVN PDV QRKGLY PP  
Sbjct: 8   IPDTMTAIEIKHPGGPEVLVPTRRPVPAPGPGELLIRHHAAGVNGPDVFQRKGLYDPPPG 67

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ I GLEVAG++  LG+  T + +GD VCAL+ GGGYAEY ++ + +TL +P G   ++
Sbjct: 68  ASDIPGLEVAGEVAALGQGVTGFRVGDLVCALIPGGGYAEYSVASEHNTLHLPDGLRLVE 127

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEE 181
           AA++PE+F TVW NLFQ      G T+LIHGG+SGIGTTA  L+  FGA  + TT  S+ 
Sbjct: 128 AAAMPETFMTVWLNLFQRGKFTKGDTILIHGGASGIGTTATMLSKAFGAAKIITTVASDA 187

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           +  A L LGA +A+NYL+EDF+E + + T+G+G D+I+D++  +Y+ ++       G+++
Sbjct: 188 QRDASLALGADYAVNYLEEDFVEAVMRVTEGKGADVIVDIIAGDYVPRNYAAAGINGRIV 247

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I  + G +A E++L P+++KR+T  GSTLR RT   K  I   L+ ++WPL+ S  + P
Sbjct: 248 QIGVIKG-VAKEVDLFPMLTKRLTHMGSTLRSRTPEEKAEIIRELEAQVWPLMASGAVKP 306

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +I+    L +   AH++M+   HIGKI+L
Sbjct: 307 LIYQTFALEQARAAHELMDSGTHIGKIVL 335


>gi|149185297|ref|ZP_01863614.1| NADPH quinone oxidoreductase [Erythrobacter sp. SD-21]
 gi|148831408|gb|EDL49842.1| NADPH quinone oxidoreductase [Erythrobacter sp. SD-21]
          Length = 326

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 152/311 (48%), Positives = 209/311 (67%), Gaps = 2/311 (0%)

Query: 21  MFLAES-PIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLG 79
           +F AE   +PQP  +++LI+V   GVNRPDV+QR+G YPPP  A+PI GLEV+GK+V +G
Sbjct: 11  VFRAEKLDLPQPGPDQLLIEVSHAGVNRPDVIQRQGFYPPPPGASPIPGLEVSGKVVAIG 70

Query: 80  ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQ 139
                  +   VCALV+GGGYAEYCL+H  H L +P   +  +AA++PE+ FTVW N+F+
Sbjct: 71  PGVAPEMLNRRVCALVSGGGYAEYCLAHAAHCLSVPPHMDMAEAAAIPETLFTVWHNVFE 130

Query: 140 TANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLK 199
                 G+T+L+HGG+SGIGT AIQLA  F   V TTA SEEKC A  +LGA  AINY  
Sbjct: 131 RGFAVDGETLLVHGGTSGIGTMAIQLAKAFELDVVTTAGSEEKCNAARELGADLAINYKT 190

Query: 200 EDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPI 259
           EDF+E + + T G+G ++ILDMV  +Y+ ++L  L+ +G+ + I+ LGG + +EIN+  +
Sbjct: 191 EDFVEKVNEFTGGKGANVILDMVSGDYVQRNLDCLAVDGRHVTIAVLGG-LKSEINMAKL 249

Query: 260 ISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIM 319
           +SKR  +TGSTLR R+D  K  + D +    WPL     IAPV+    PL +V+ AH  M
Sbjct: 250 MSKRQVMTGSTLRPRSDEFKALLADEIYTHAWPLFEDRTIAPVMDKTFPLTEVSAAHARM 309

Query: 320 EKSEHIGKIIL 330
           E  +HIGKI+L
Sbjct: 310 EAGDHIGKIVL 320


>gi|115449339|ref|NP_001048442.1| Os02g0805600 [Oryza sativa Japonica Group]
 gi|47497339|dbj|BAD19379.1| putative quinone oxidoreductase [Oryza sativa Japonica Group]
 gi|47497389|dbj|BAD19427.1| putative quinone oxidoreductase [Oryza sativa Japonica Group]
 gi|113537973|dbj|BAF10356.1| Os02g0805600 [Oryza sativa Japonica Group]
 gi|215737682|dbj|BAG96812.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215765452|dbj|BAG87149.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222623875|gb|EEE58007.1| hypothetical protein OsJ_08782 [Oryza sativa Japonica Group]
          Length = 328

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 147/329 (44%), Positives = 211/329 (64%), Gaps = 4/329 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAE--SPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           MR V ++  G   V+   +    +P P + E+L+ V A GVNR D +QR+G YP P  A+
Sbjct: 1   MRAVVIARAGGPEVLEERDVGEGLPPPGEGEVLVGVSAAGVNRADTVQRQGRYPAPPGAS 60

Query: 65  PILGLEVAGKIVDLGENT-THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           P  GLE +G I+ LG N  + W +GD+VCAL++ GGYAE  +   G  LP+P+G +   A
Sbjct: 61  PYPGLECSGTILALGPNVPSRWAVGDQVCALLSSGGYAEKVVVPAGQLLPVPEGVSLTDA 120

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A LPE   TVW+ +F T++L   ++ LIHGGSSGIGT AIQ+A + G  V+ TA SEEK 
Sbjct: 121 AGLPEVACTVWSTVFVTSHLSPSESFLIHGGSSGIGTFAIQIAKHLGIKVFVTAGSEEKL 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
            AC  LGA   INY  EDF+  +++ET G+G+D+ILD +G  YL ++L  L+ +G+L II
Sbjct: 181 AACKGLGADVCINYKTEDFVARVKEETNGKGVDVILDNIGGLYLQRNLNSLAVDGRLFII 240

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
            F GG + TE+NL P++++R+TI  + LR R+   K  I   ++  +WP +    + PVI
Sbjct: 241 GFQGGAV-TEVNLQPMLARRLTIQAAGLRNRSLDNKALIVSEVEKNVWPAVVQGKVKPVI 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
           +   PL + A AH +ME+S HIGKI+L+P
Sbjct: 300 YKTFPLSEAAEAHKLMEESSHIGKILLIP 328


>gi|294142487|ref|YP_003558465.1| zinc-containing alcohol dehydrogenase [Shewanella violacea DSS12]
 gi|293328956|dbj|BAJ03687.1| alcohol dehydrogenase, zinc-containing [Shewanella violacea DSS12]
          Length = 347

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 155/336 (46%), Positives = 217/336 (64%), Gaps = 10/336 (2%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           + K   HV     G ++VM L  SP+P   KE++LIKV   GVN PDV QR+G YPPPK+
Sbjct: 6   LAKNYLHVDFEHPGDADVMLLKRSPLPNLTKEQVLIKVAYAGVNGPDVAQRRGAYPPPKD 65

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+PILGLEVAG+I  LG+  T W +GD+V ALV GGGY EY  ++  H LPIP+G+   Q
Sbjct: 66  ASPILGLEVAGEICALGDGVTQWQLGDKVTALVPGGGYGEYVATYASHCLPIPQGWTLEQ 125

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA++PE+FFTVW NLF  A L+ G+TVLIHGGS GIG+ AI LA  FGA V  T+ S++K
Sbjct: 126 AAAIPETFFTVWGNLFMRAGLKPGETVLIHGGSGGIGSAAIALAKAFGARVIATSGSDDK 185

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C  CL LGA  A+NY ++DF++ + + T   G+ ++ D+ G +++NQ+L  L+ +G+++ 
Sbjct: 186 CDYCLSLGADLALNY-QDDFVKPVMEYTSNMGVQLVFDIAGGDFINQNLKALAVDGRMVS 244

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNS------ 296
           ++   G  A ++++  I++KRI  TGSTLR ++  AK  I   L+ K+WPLLN       
Sbjct: 245 VAMQRGAQA-QVDIFRIMAKRIIWTGSTLRPQSVEAKAKIAAELRQKVWPLLNMSQQDQA 303

Query: 297 --HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             + + P I     L     AH +ME   H GKI+L
Sbjct: 304 NINKLVPNISARFTLADTIAAHRLMESGRHRGKIVL 339


>gi|299134148|ref|ZP_07027341.1| NAD(P)H quinone oxidoreductase, PIG3 family [Afipia sp. 1NLS2]
 gi|298590895|gb|EFI51097.1| NAD(P)H quinone oxidoreductase, PIG3 family [Afipia sp. 1NLS2]
          Length = 332

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 145/324 (44%), Positives = 209/324 (64%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  +A+S  G   V+   +  +P+P+  EIL+KVEA GVNRPDV+QR G YP P  A+ +
Sbjct: 8   MTAIAISSPGGPEVLVPEQRELPKPRAGEILVKVEAAGVNRPDVLQRMGKYPVPPGASDL 67

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG +V LGE  +   IGD V +L  GGGYAEYC++   H + IP G +  QAA+L
Sbjct: 68  PGLEIAGTVVALGEGASKHKIGDRVMSLTAGGGYAEYCVAPDAHAITIPDGLSMKQAATL 127

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+  TVW N+F+   L+  +T+L+HGGSSGIGTTAIQ+A  +GA V  T   ++K  AC
Sbjct: 128 PETVMTVWHNVFERGALKPHETLLVHGGSSGIGTTAIQMAKAYGAKVIVTVGGQDKADAC 187

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           LKLGA  A+NY  +DF+   +  T  +G+++ILDMVG EY++++    + EG+++ I+FL
Sbjct: 188 LKLGADVAVNYKTQDFVAEAKAATGDKGVNVILDMVGGEYVDRNYDAAAVEGRIVQIAFL 247

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  AT  N   ++ KR+  TGSTLR R+D  K ++  +++  + P +    + P+I + 
Sbjct: 248 GGPKATA-NFGKLMMKRLWHTGSTLRPRSDKDKAAMVKAIEATVLPWILKGQLKPLIDSE 306

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   A AH  ME  +HIGKI+L
Sbjct: 307 FSLKDAAKAHARMESGQHIGKIVL 330


>gi|254482250|ref|ZP_05095491.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [marine gamma
           proteobacterium HTCC2148]
 gi|214037575|gb|EEB78241.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [marine gamma
           proteobacterium HTCC2148]
          Length = 327

 Score =  288 bits (737), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 143/302 (47%), Positives = 200/302 (66%), Gaps = 1/302 (0%)

Query: 29  PQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIG 88
           P P   EILIKV A G+NR D++QR GLYPPP++A+PI+GLEVAG ++ LG   T W +G
Sbjct: 25  PTPAPGEILIKVAAAGLNRADLLQRAGLYPPPEDASPIMGLEVAGTVLALGHEVTGWQVG 84

Query: 89  DEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQT 148
           D VCAL +GGGYA++ L+ QG  LPIP G N  +AA+LPE+  TVW N+FQ A +++G  
Sbjct: 85  DSVCALTHGGGYADHALAPQGQCLPIPAGMNMEEAAALPEALLTVWHNVFQRAAMQAGDN 144

Query: 149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQK 208
           VLIHGG+SGIGT  IQ+ +  G  VYTTA +E+KC A   LGA  A NY  +DF   L +
Sbjct: 145 VLIHGGASGIGTLGIQMVNALGGKVYTTAGNEQKCTALETLGAVKAFNYQTQDFEVALTE 204

Query: 209 ETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITG 268
                 I++ILD+ G +++ +++ + + EG+++ I+F+ G    E+N  P++ KRIT TG
Sbjct: 205 AGLKDRINVILDLAGGDFIQKNINVAAPEGRIVNIAFIRG-FQAEVNFAPLLIKRITFTG 263

Query: 269 STLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKI 328
           STLR ++   K  +   +   I+P L +  I P+I  V  L +VA AHD M+   H+GKI
Sbjct: 264 STLRSQSFEQKTIMCREIIEHIYPHLQNGSIKPIIDRVFELDEVASAHDHMQSGAHMGKI 323

Query: 329 IL 330
           IL
Sbjct: 324 IL 325


>gi|170736719|ref|YP_001777979.1| PIG3 family NAD(P)H quinone oxidoreductase [Burkholderia
           cenocepacia MC0-3]
 gi|169818907|gb|ACA93489.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia
           cenocepacia MC0-3]
          Length = 356

 Score =  288 bits (737), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 213/331 (64%), Gaps = 2/331 (0%)

Query: 2   PICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           P+   M  + +   G  +V+  A   +P P   ++LI++ A GVN PDV QRKGLY PP 
Sbjct: 7   PLPTHMTAIEIVRPGGPDVLVPATRAVPVPGPGDVLIRIHAAGVNGPDVFQRKGLYDPPP 66

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A+ I GLE+AG++V +G + T + +GD VCAL+ GGGYAEY ++++ +TL IP G    
Sbjct: 67  GASDIPGLEIAGEVVAVGHDVTRFVVGDRVCALIPGGGYAEYAVANESNTLAIPDGLGMA 126

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSE 180
           +AA+LPE+F TVW NLFQ     +G++VLIHGG+SGIGTTA  LA  FG AT+ TT  S+
Sbjct: 127 EAAALPETFMTVWLNLFQRGRFAAGESVLIHGGASGIGTTATMLAKAFGAATIITTVGSD 186

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
            +  A ++LGA  AI+Y  EDF+E + + T G+G+D+I+D++  +Y+ ++    +  G++
Sbjct: 187 AQRDASMRLGADLAIDYRSEDFVEAVARFTGGKGVDVIVDIIAGDYVARNFAAAAMNGRI 246

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I  + G  A E++L P+++KR+T  GSTLR RT   K  I   L+  +WPL+    + 
Sbjct: 247 VQIGVINGP-AKELDLFPMLTKRLTHIGSTLRSRTYGEKAQIIRELEEAVWPLIRQGTVK 305

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
           P ++ +  L     AH++M+   HIGKI+L+
Sbjct: 306 PQVYRLFDLRDARAAHELMDSGRHIGKIVLV 336


>gi|239502346|ref|ZP_04661656.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter
           baumannii AB900]
          Length = 332

 Score =  288 bits (737), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 154/330 (46%), Positives = 206/330 (62%), Gaps = 2/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   M+ V ++  G   V+ L +S +P PQ +E+LI+V+A G+NRPDV+QR GLYP P
Sbjct: 1   MNLPTTMKIVEITVPGGPEVLKLQDSNVPVPQADEVLIEVKAAGINRPDVLQRMGLYPMP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K    I GLEVAG +V +GE    + +GD+VCAL NGGGYAEYC       LPIP+  + 
Sbjct: 61  KGVTQIPGLEVAGVVVAVGEQVQQFKVGDKVCALTNGGGYAEYCAVTATQVLPIPENLSF 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA++PE+FFTVWANLF    L+  +  LIHGG+SGIGTTA+ +    G   + T  SE
Sbjct: 121 TQAAAIPETFFTVWANLFDIGRLKKDEIALIHGGASGIGTTALAICHALGIKTFATVGSE 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +K  A   L    AINY  +DF + +   TQ +G+D+ILD+VG  Y  ++L LL ++G+L
Sbjct: 181 DKVEALSDLTT--AINYKTQDFEQEILNHTQEQGVDVILDIVGGSYFQKNLNLLKRDGRL 238

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +II F+GG IA E +L  +I KR TITGST+R R    K  I  SL   +WPLL      
Sbjct: 239 VIIGFMGGRIAKEFDLQKLILKRATITGSTMRARNSQEKAQIAQSLHEHVWPLLAQGKCL 298

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I+       V  AH  ME+ +HIGKI+L
Sbjct: 299 PQIYKTYAFSDVQSAHACMEQGDHIGKIVL 328


>gi|15234529|ref|NP_193889.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Arabidopsis thaliana]
 gi|15724164|gb|AAL06474.1|AF411784_1 AT4g21580/F18E5_200 [Arabidopsis thaliana]
 gi|3080402|emb|CAA18722.1| putative NADPH quinone oxidoreductase [Arabidopsis thaliana]
 gi|4455266|emb|CAB36802.1| putative NADPH quinone oxidoreductase [Arabidopsis thaliana]
 gi|7268955|emb|CAB81265.1| putative NADPH quinone oxidoreductase [Arabidopsis thaliana]
 gi|21593811|gb|AAM65778.1| putative NADPH quinone oxidoreductase [Arabidopsis thaliana]
 gi|21700799|gb|AAM70523.1| AT4g21580/F18E5_200 [Arabidopsis thaliana]
 gi|332659073|gb|AEE84473.1| putative NADPH quinone oxidoreductase [Arabidopsis thaliana]
          Length = 325

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 142/324 (43%), Positives = 206/324 (63%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +S  GK  V+ L +   P+ + +E+LI+V A  +NR D +QR GLY PP  ++P 
Sbjct: 1   MKAIVISEPGKPEVLQLRDVADPEVKDDEVLIRVLATALNRADTLQRLGLYNPPPGSSPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I  +G+  + W +GD+VCAL++GGGYAE      G   PIP G +   AA+ 
Sbjct: 61  LGLECSGTIESVGKGVSRWKVGDQVCALLSGGGYAEKVSVPAGQIFPIPAGISLKDAAAF 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F    L  G++ LIHGGSSGIGT AIQ+A + G  V+ TA S+EK  AC
Sbjct: 121 PEVACTVWSTVFMMGRLSVGESFLIHGGSSGIGTFAIQIAKHLGVRVFVTAGSDEKLAAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY  EDF+  ++ ET G+G+D+ILD +GA YL ++L  L+ +G+L II  +
Sbjct: 181 KELGADVCINYKTEDFVAKVKAETDGKGVDVILDCIGAPYLQKNLDSLNFDGRLCIIGLM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A EI L+ ++ KR+T+ G+ LR R+   K  +   ++  +WP + +  + PVI+  
Sbjct: 241 GGANA-EIKLSSLLPKRLTVLGAALRPRSPENKAVVVREVEKNVWPAIEAGKVKPVIYKY 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LPL + A  H +ME S HIGKI+L
Sbjct: 300 LPLSQAAEGHSLMESSNHIGKILL 323


>gi|107027362|ref|YP_624873.1| zinc-binding alcohol dehydrogenase [Burkholderia cenocepacia AU
           1054]
 gi|116693928|ref|YP_839461.1| alcohol dehydrogenase [Burkholderia cenocepacia HI2424]
 gi|105896736|gb|ABF79900.1| Alcohol dehydrogenase, zinc-binding protein [Burkholderia
           cenocepacia AU 1054]
 gi|116651928|gb|ABK12568.1| Alcohol dehydrogenase, zinc-binding domain protein [Burkholderia
           cenocepacia HI2424]
          Length = 345

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 138/316 (43%), Positives = 206/316 (65%), Gaps = 2/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  +V+  A   +P P   ++LI++ A GVN PDV QRKGLY PP  A+ I GLE+AG++
Sbjct: 10  GGPDVLVPATRAVPVPGPGDVLIRIHAAGVNGPDVFQRKGLYDPPPGASDIPGLEIAGEV 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V +G + T + +GD VCAL+ GGGYAEY ++++ +TL IP G    +AA+LPE+F TVW 
Sbjct: 70  VAVGRDVTRFVVGDRVCALIPGGGYAEYAVANESNTLAIPDGLGMAEAAALPETFMTVWL 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKCLACLKLGAKHA 194
           NLFQ      G++VLIHGG+SGIGTTA  LA  FG AT+ TT  S+ +  A ++LGA  A
Sbjct: 130 NLFQRGRFSPGESVLIHGGASGIGTTATMLAKAFGAATIITTVGSDAQRDASMRLGADLA 189

Query: 195 INYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEI 254
           I+Y  EDF+E + + T G+G+D+I+D++  +Y+ ++    +  G+++ I  + G  A E+
Sbjct: 190 IDYRSEDFVEAVARFTGGKGVDVIVDIIAGDYVARNFAAAAMNGRIVQIGVINGP-AKEL 248

Query: 255 NLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAM 314
           +L P+++KR+T  GSTLR RT   K  I   L+  +WPL+    + P ++ +  L     
Sbjct: 249 DLFPMLTKRLTHIGSTLRSRTYAEKAQIIRELEEAVWPLIRQGTVRPQVYRLFDLRDARA 308

Query: 315 AHDIMEKSEHIGKIIL 330
           AH++M+   HIGKI+L
Sbjct: 309 AHELMDSGRHIGKIVL 324


>gi|284007944|emb|CBA73914.1| probable zinc-binding dehydrogenase [Arsenophonus nasoniae]
          Length = 302

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 203/303 (66%), Gaps = 2/303 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + + G G    +  ++ P+ +P K  +L+KV A GVNRPDV QR G+YPPP +A+PI
Sbjct: 1   MLAIEIVGPGGPEKLKPSQLPLIKPPKSHLLVKVAAAGVNRPDVFQRMGVYPPPADASPI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE++G++V +GE    W  GD+VCALV GGGYAEYCL H+   LPI    + I+AA+L
Sbjct: 61  PGLEISGQVVSVGEGCQRWKNGDKVCALVAGGGYAEYCLVHEAIALPI-GDLSYIEAAAL 119

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVWAN+FQ   L+  +TVLIHGG+SGIG+ AI LA  FGA V+TT  S EK    
Sbjct: 120 PENFFTVWANVFQIGQLKKNETVLIHGGTSGIGSIAIMLAKIFGAKVFTTVGSVEKMKVA 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY+ EDF E + + TQ +G+++++D++G +Y+N++  + +K G++I +  +
Sbjct: 180 SSLGADKVINYMTEDFAEKIAEYTQNKGVNMVVDLIGGDYVNKNYQIAAKYGRIIQVGMM 239

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    ++NL P++ K++  TGST+R RT + K +I   L+ K+WPL+ S  I P+I   
Sbjct: 240 RGA-PQQVNLMPLMVKQLIHTGSTMRARTLVEKIAIAKELENKVWPLIYSGKIKPIIAKT 298

Query: 307 LPL 309
            PL
Sbjct: 299 YPL 301


>gi|254390334|ref|ZP_05005551.1| quinone oxidoreductase [Streptomyces clavuligerus ATCC 27064]
 gi|294813814|ref|ZP_06772457.1| Putative quinone oxidoreductase [Streptomyces clavuligerus ATCC
           27064]
 gi|326442233|ref|ZP_08216967.1| putative quinone oxidoreductase [Streptomyces clavuligerus ATCC
           27064]
 gi|197704038|gb|EDY49850.1| quinone oxidoreductase [Streptomyces clavuligerus ATCC 27064]
 gi|294326413|gb|EFG08056.1| Putative quinone oxidoreductase [Streptomyces clavuligerus ATCC
           27064]
          Length = 326

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 140/325 (43%), Positives = 206/325 (63%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +  AE P P P + E+L++V A  VNR D++QR+G Y PP  A+P 
Sbjct: 1   MHAITIPEPGGPEALLWAEVPDPVPGEGEVLVEVAASAVNRADLLQRQGFYDPPPGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G+IVDLG   + W +GDEVCAL+ GGGYA+      G  LP+P G + + AA+L
Sbjct: 61  PGLECSGRIVDLGPGVSGWAVGDEVCALLAGGGYAQRVAVPTGQLLPVPTGLDLVTAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A+LR G+TVLIHGG+SGIGT AIQLA   GA V  TA   EK   C
Sbjct: 121 PEVTATVWSNVFMIAHLRPGETVLIHGGASGIGTMAIQLAKAVGARVAVTAGGPEKLARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   I+Y ++DF+  L+  T G G D++LD++GA+YL +++  L+  G+L +I   
Sbjct: 181 AELGADILIDYREQDFVAELRAATDGAGADVVLDIIGAKYLERNIRALALNGRLAVIGLQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E+NL  +++KR  IT ++LR R    K +I  +++  +WPL+ +  + PV+   
Sbjct: 241 GG-VKGEVNLGALLAKRAAITATSLRSRPLGEKAAIVAAVREHVWPLIENGRVRPVVDRS 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           LPL + A AH ++E    +GK++L+
Sbjct: 300 LPLRQAAEAHRVLESGAQVGKVLLI 324


>gi|209886436|ref|YP_002290293.1| NAD [Oligotropha carboxidovorans OM5]
 gi|209874632|gb|ACI94428.1| NAD [Oligotropha carboxidovorans OM5]
          Length = 332

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 210/324 (64%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  +A+S  G  +V+   +  +P+P   EIL+KVEA GVNRPDV+QR G YP P  A+ +
Sbjct: 8   MTVIAISQPGGPDVLVPEQREVPKPAAGEILVKVEAAGVNRPDVLQRMGKYPVPPGASDL 67

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG +V LGE      IGD+V +L  GGGYAEYC++   H + IP G +  +AA+L
Sbjct: 68  PGLEIAGTVVALGEGARKHKIGDKVMSLTAGGGYAEYCVAPDAHAITIPAGLSMKEAATL 127

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+  TVW N+F+   L+ G+T ++HGGSSGIGTTAIQ+A   GA V  T  S+EK  AC
Sbjct: 128 PETVMTVWHNVFERCALKPGETFMVHGGSSGIGTTAIQMAKAHGAKVIVTVGSQEKADAC 187

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           + LGA  A+NY  +DF+   +  T G+G+++ILDMVG EY++++    + EG+++ I+FL
Sbjct: 188 VTLGADVAVNYKTQDFVAEAKAATGGKGVNVILDMVGGEYVDRNYDACATEGRIVQIAFL 247

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  AT  N   ++ KR+  TGSTLR R++  K ++  +++  + P + +  + P+I + 
Sbjct: 248 GGPKATA-NFGKLMMKRLWHTGSTLRPRSNEDKAAMVKAIEATVLPWIVAGRLKPLIDSE 306

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L   A AH  ME  +HIGKI+L
Sbjct: 307 FSLKDAAKAHARMESGQHIGKIVL 330


>gi|114705056|ref|ZP_01437964.1| alcohol dehydrogenase, zinc-containing [Fulvimarina pelagi
           HTCC2506]
 gi|114539841|gb|EAU42961.1| alcohol dehydrogenase, zinc-containing [Fulvimarina pelagi
           HTCC2506]
          Length = 339

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 211/324 (65%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + ++G G   V+     P P+P K EI I + A GVNRPDVMQR G+YPPP  A   
Sbjct: 12  MRIIGLNGPGGPEVLVPEMRPTPEPGKGEIRIAIAAAGVNRPDVMQRMGVYPPPPGAPDW 71

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG +  LGE  + + IGD V ALV GGGYAE    H+ + + +P G    +AA++
Sbjct: 72  PGLEVAGFVDRLGEGASRFEIGDRVMALVPGGGYAEAVTVHETNAIQVPDGMRLDEAAAI 131

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F  A L+ G+  L+HGG+SGIGTTAIQLA  FGA V+ TA S EKC A 
Sbjct: 132 PETFFTVWSNVFMRAGLKKGEVFLVHGGTSGIGTTAIQLARQFGARVFATAGSAEKCAAA 191

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            KLGA+   NY + DF E +++ T GRG D+ILDMVG +Y +++L   + EG+++ I+FL
Sbjct: 192 EKLGAEICFNYRQADFAEGVKEATGGRGADVILDMVGGDYADRNLKCAAVEGRIVQIAFL 251

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  A EI+L+ I+ KR+  TGSTLR R+   K  I   ++  + PLL +  + PV+   
Sbjct: 252 NGPKA-EIDLSRIMLKRLVFTGSTLRARSVEFKADIARDIERLVIPLLANGKVRPVMEKS 310

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH  +++ +HIGKI+L
Sbjct: 311 YPLEQAAEAHRHLDQ-DHIGKIVL 333


>gi|333025671|ref|ZP_08453735.1| putative quinone oxidoreductase [Streptomyces sp. Tu6071]
 gi|332745523|gb|EGJ75964.1| putative quinone oxidoreductase [Streptomyces sp. Tu6071]
          Length = 326

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 140/324 (43%), Positives = 211/324 (65%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +S  G  +V+  +E   P+P   E+L++V A  VNR D++QR+G Y PP  A+P 
Sbjct: 1   MHAITISEPGGPDVLLWSEVDDPRPAPGEVLVEVVASAVNRADLLQRQGFYDPPPGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G+I  LG   + W +GDEVCAL+ GGGYAE      G  LP+P G + ++AA+L
Sbjct: 61  PGLEVSGRIAALGAGVSGWAVGDEVCALLGGGGYAEKVAVPAGQLLPVPSGVDLVEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A LR G+T+L+HGGSSGIGT AIQLA    A V  TA +  K  +C
Sbjct: 121 PEVVCTVWSNVFMVAGLRPGETLLVHGGSSGIGTMAIQLARAVDARVAVTAGTAAKLESC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY ++DF+  L K T+G G D+ILD +GA+YL++++  L+  G+L II   
Sbjct: 181 RELGADILINYREQDFVAELGKATEGHGADVILDNMGAKYLDRNIQALATSGRLAIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E+NL+ +++KR  +T ++LR R    K ++  +++  +WPLL+S  + PV+   
Sbjct: 241 GG-VKGELNLSALMNKRAAVTATSLRARPAAEKAAVVAAVREHVWPLLSSGAVKPVVDRR 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           +P+ + A  H ++++S HIGK++L
Sbjct: 300 IPMSEAATGHRVLDESTHIGKVLL 323


>gi|42521928|ref|NP_967308.1| quinone oxidoreductase [Bdellovibrio bacteriovorus HD100]
 gi|39574458|emb|CAE77962.1| quinone oxidoreductase [Bdellovibrio bacteriovorus HD100]
          Length = 326

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 220/324 (67%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++  G   V+ + E   P+P   E+LI++ A GVNRPD  QR+G YPPP  A+ I
Sbjct: 1   MRAVEITQPGGPEVLKITERTKPEPAIGEVLIEIHASGVNRPDCAQRQGTYPPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AGKIV +G   + W +GD VCALV+GGGYAEY  + +G  LP+P G + ++AA+L
Sbjct: 61  PGLEIAGKIVAVGAGVSKWKVGDMVCALVSGGGYAEYVAAPEGQCLPVPTGMSVVEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW NLF++  L+ G++VLIHGG+ GIGTTAIQ+AS  G  V+TT   +E    C
Sbjct: 121 PETFFTVWTNLFESGRLQKGESVLIHGGAGGIGTTAIQMASAMGVRVFTTVGKKESVSIC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+  I Y +EDF+ +++  T  +G+D+ILDMVG +Y  +++  L+ +G+L+ I+ +
Sbjct: 181 QELGAERVILYKEEDFVSVVKSLTADKGVDVILDMVGGDYFARNIEALAVQGRLVQIATM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    E++L  ++ KR+T+TGSTLR R    K  I  +L   IWPLLN + + PVI+ V
Sbjct: 241 QGA-KVELDLRKVMFKRLTLTGSTLRARPVAEKSRIATALLQNIWPLLNKNQMRPVIYKV 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           L L + A AH +ME S+H GKI+L
Sbjct: 300 LKLEQAAEAHAMMEASQHTGKIVL 323


>gi|302552763|ref|ZP_07305105.1| quinone oxidoreductase [Streptomyces viridochromogenes DSM 40736]
 gi|302470381|gb|EFL33474.1| quinone oxidoreductase [Streptomyces viridochromogenes DSM 40736]
          Length = 329

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 141/325 (43%), Positives = 209/325 (64%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +   E P P P + E+L++V A  VNR D++QR+G Y PP  A+P 
Sbjct: 1   MHAITIPEPGGPEALVWDEVPDPVPGEGEVLVEVTASAVNRADILQRQGFYDPPPGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G+IV+ G   + WN+GDEVCAL++GGGYAE  +   G  LP+P+G    +AA+L
Sbjct: 61  PGLECSGRIVETGSGVSGWNVGDEVCALLSGGGYAEKVVVPAGQLLPVPQGVGLKEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A+LR G+T+L+HGGSSGIGT AIQLA   GA V  TA ++EK   C
Sbjct: 121 PEVTCTVWSNVFMIAHLRPGETLLVHGGSSGIGTMAIQLAKAVGARVAVTAGTKEKLERC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY ++DF+E ++  T G G D+ILD +GA+YL +++  L+  G+L II   
Sbjct: 181 AELGADILINYREQDFVEEVRNATDGAGADVILDNMGAKYLERNVKALAVNGRLAIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E+N+  +++KR  I+ ++LR R    K +I  +++  +WPL     + PV+   
Sbjct: 241 GG-VKGELNIGALLAKRAAISATSLRARPPEEKAAIVAAVREHVWPLFAGGRLRPVVDRE 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           LP+   + AH I+E+S HIGK++L+
Sbjct: 300 LPMPDASAAHRIVEESGHIGKVLLI 324


>gi|21222233|ref|NP_628012.1| quinone oxidoreductase [Streptomyces coelicolor A3(2)]
 gi|256786669|ref|ZP_05525100.1| quinone oxidoreductase [Streptomyces lividans TK24]
 gi|289770564|ref|ZP_06529942.1| quinone oxidoreductase [Streptomyces lividans TK24]
 gi|5457258|emb|CAB46946.1| putative quinone oxidoreductase [Streptomyces coelicolor A3(2)]
 gi|289700763|gb|EFD68192.1| quinone oxidoreductase [Streptomyces lividans TK24]
          Length = 326

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 208/316 (65%), Gaps = 1/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G    +  AE P PQP + E+L++V A  VNR D+MQR+G Y PP  A+P  GLE +G++
Sbjct: 10  GGPEALVWAEVPDPQPGEGEVLVEVAASAVNRADIMQRQGFYDPPPGASPYPGLECSGRV 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
            ++G   + W++GDEVCAL+ GGGYAE  +   G  LP+P+G +  +AA+LPE   TVW+
Sbjct: 70  AEVGPGVSGWSVGDEVCALLAGGGYAEKVVVPAGQLLPVPQGLDVKRAAALPEVVCTVWS 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  A+LR G+T+L+HGGSSGIGT AIQLA   GA V  TA ++EK   C +LGA   I
Sbjct: 130 NVFMVAHLRPGETLLVHGGSSGIGTMAIQLAKAVGAKVAVTAGTKEKLERCAELGADILI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY ++DF+  ++  T G G D+ILD +GA+YL++++  L+  G+L II   GG    E+N
Sbjct: 190 NYREQDFVAEVKDATGGAGADVILDNMGAKYLDRNVQALAVNGRLAIIGMQGGR-KGELN 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           +  +++KR  ++ ++LR R    K +I  +++  +WPLL    + PV+   +P+ + A  
Sbjct: 249 IGTLLAKRAAVSATSLRARPLEEKAAIVAAVKEHVWPLLAGGHVRPVVDREMPMSEAAEG 308

Query: 316 HDIMEKSEHIGKIILL 331
           H ++E+S HIGK++L+
Sbjct: 309 HRVVEESGHIGKVLLV 324


>gi|24372231|ref|NP_716273.1| alcohol dehydrogenase, zinc-containing [Shewanella oneidensis MR-1]
 gi|24346152|gb|AAN53718.1|AE015511_1 alcohol dehydrogenase, zinc-containing [Shewanella oneidensis MR-1]
          Length = 332

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 213/322 (66%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           H+ +   G   VM L+ S +P     ++LI+V A GVN PD+ QR G YPPP  A+ ILG
Sbjct: 10  HIHIEQPGAPEVMQLSRSSLPVVGAGQVLIRVSAAGVNGPDLKQRAGAYPPPPGASLILG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG+I  LGE  T W +GD+VCALV GGGY EY L++  H LPIPKG++ +QAA+LPE
Sbjct: 70  LEVAGEICALGEGVTQWQLGDKVCALVPGGGYGEYTLTYAAHCLPIPKGFSMVQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW NLF  A L++G+TVLIHGGS GIG+TAI LA+  GA V  T   +EK   CL 
Sbjct: 130 TFFTVWGNLFMRAGLKAGETVLIHGGSGGIGSTAIALANRLGAKVIATTGQDEKRDYCLG 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA   +NY  ++F+E +   TQG+G++++ D+ G +++N +L  L+ +G+++ +S    
Sbjct: 190 LGADLVVNYNSQNFVEEVMSFTQGKGVNVVFDIAGGDFINLNLQSLALDGRMVSVSTQRS 249

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+N+  +++KRI  TGSTLR +T  AK  I   L+ ++WPLL+S  I P I    P
Sbjct: 250 PKA-EVNILQLMAKRIVWTGSTLRPQTVEAKAEIARQLRERVWPLLDSQQIVPHIFATYP 308

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           L     AH +M+  EH GK++L
Sbjct: 309 LIDAPKAHRLMQSGEHRGKVVL 330


>gi|76160992|gb|ABA40459.1| NADPH quinone oxidoreductase-like protein [Solanum tuberosum]
          Length = 325

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 140/324 (43%), Positives = 205/324 (63%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G   V+ L E   PQ + +EILIK+ A  +NR D +QR+G +PP K  +  
Sbjct: 1   MKAVVITRPGGPEVLKLQEVEDPQIKDDEILIKIAATAINRADTLQRQGEHPPHKGESEY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G +  +G++   W IGD+VCAL+ GGGYAE         LPIP G +   AAS 
Sbjct: 61  PGLECSGTVEAVGKDVIRWKIGDQVCALIGGGGYAEKVAVPTEQVLPIPSGVSLQDAASF 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F T+ L SG+T LIHGGSSGIGT AIQ+A   G  V+ TA SEEK  AC
Sbjct: 121 PEVACTVWSTIFMTSKLSSGETFLIHGGSSGIGTFAIQMAKCIGVKVFITAGSEEKLAAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY  EDF+  +++ET G+G+D+ILD +G  Y  Q+L  L+ +G+L II F+
Sbjct: 181 KELGADVCINYKTEDFVTRIKEETGGKGVDVILDNIGGPYFQQNLGSLNVDGRLFIIGFM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG + T++NL  ++++R+T+  + +R R+   K  I   ++  +WP + +  + P+++  
Sbjct: 241 GGTV-TQVNLGCLLARRLTVQAAGMRGRSAKNKAQIVREVEKNVWPAIAAGKVKPLVYKY 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH +ME  +HIGKI+L
Sbjct: 300 FPLAEAAEAHQLMESGKHIGKILL 323


>gi|85709771|ref|ZP_01040836.1| alcohol dehydrogenase, zinc-containing [Erythrobacter sp. NAP1]
 gi|85688481|gb|EAQ28485.1| alcohol dehydrogenase, zinc-containing [Erythrobacter sp. NAP1]
          Length = 378

 Score =  285 bits (728), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 146/328 (44%), Positives = 208/328 (63%), Gaps = 1/328 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I   MR V     G   V+ L ++  P P+++++LIKV   GVNRPD  QR G+YPPP  
Sbjct: 47  IPDTMRAVGFDSPGGPEVLRLEQTATPSPKQDDVLIKVAFAGVNRPDCAQRAGMYPPPPG 106

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+P+ GLEVAG++V +G       +G  V AL  GGGYAE+C +   H L +P G +   
Sbjct: 107 ASPLPGLEVAGEVVAIGSGVPAEMLGQRVAALTPGGGYAEFCTAPWQHCLSLPDGMDLKT 166

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA+LPE+ FTVW N+F+    R G+ +L+HGG+SGIGT AI LA  F   V  T   E K
Sbjct: 167 AAALPETLFTVWHNVFERGMARDGERLLVHGGTSGIGTMAIMLAKAFDIEVIVTCGDEAK 226

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C A   LGA  AINY ++DF+E++++ T G G++++LDMV  +Y+ ++L  L+++G+ + 
Sbjct: 227 CQAARDLGADLAINYREQDFVEVIKEHTGGEGVNVVLDMVSGDYVPRNLQCLAEDGRHVT 286

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+ LGG  A E+ +  ++ KR+T+TGSTLR R+D  K ++ D +    WPL  S  +APV
Sbjct: 287 IAMLGGAKA-ELFMPMVMMKRLTLTGSTLRPRSDAFKSALADEIAANAWPLFTSGELAPV 345

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +    PLG+ A AH  ME  EHIGKI+L
Sbjct: 346 MDQTFPLGEAAAAHTRMEAGEHIGKIVL 373


>gi|170725014|ref|YP_001759040.1| PIG3 family NAD(P)H quinone oxidoreductase [Shewanella woodyi ATCC
           51908]
 gi|169810361|gb|ACA84945.1| NAD(P)H quinone oxidoreductase, PIG3 family [Shewanella woodyi ATCC
           51908]
          Length = 339

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 148/327 (45%), Positives = 215/327 (65%), Gaps = 7/327 (2%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           HV     G  +V+ L  S +P+ +++++LI+V   GVN PD+ QRKG+YP P  A+ ILG
Sbjct: 12  HVTFDEPGAPDVLHLIRSQLPKIEEDQVLIRVHVAGVNGPDLAQRKGVYPAPTGASSILG 71

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEVAG++V LG   T W +G+ VCALV GGGY EY  ++  H LPIP G+    AA++ E
Sbjct: 72  LEVAGEVVALGSKVTRWQLGERVCALVPGGGYGEYVATYADHCLPIPHGWRDSDAAAIVE 131

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW NLF  A L+ G+TVLIHGGS G+G+ A+ LA  FGA V TT+ S EKC  C+ 
Sbjct: 132 TFFTVWGNLFMRAGLKVGETVLIHGGSGGVGSAAVVLAKAFGAKVITTSGSNEKCEHCVT 191

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA+ A+NY + DF+  + + TQGRG+D++ DM G +++NQ+L  L+ +G+++ ++   G
Sbjct: 192 LGAELALNY-RSDFVTPVMEHTQGRGVDVVFDMAGGDFINQNLKALAMDGRMVSVAMQRG 250

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHV-----IAPVI 303
             A E+++  I++KRI  TGSTLR ++  AK  I   L  ++WPLL+  +     + P +
Sbjct: 251 ATA-EVDIFRIMAKRIRWTGSTLRPQSVGAKAEITTQLLERVWPLLDCELESSTQLKPHV 309

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
               PL + A AH +ME  EH GK++L
Sbjct: 310 FAEFPLYECAKAHTLMEAGEHRGKLVL 336


>gi|103485859|ref|YP_615420.1| zinc-binding alcohol dehydrogenase [Sphingopyxis alaskensis RB2256]
 gi|98975936|gb|ABF52087.1| Alcohol dehydrogenase, zinc-binding [Sphingopyxis alaskensis
           RB2256]
          Length = 332

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 204/325 (62%), Gaps = 1/325 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
            M  VA+   G   ++     P+PQP  EE+LI+V A GVNRPDV+QR GLYPPP  A+ 
Sbjct: 7   DMTAVAIGAPGGPEMLQSVTRPVPQPGAEEVLIRVAAAGVNRPDVLQRMGLYPPPPGASD 66

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           + GLEVAG +V +G       +G EVCALV GGGYAEYC +  G  LP+PKG++  +AA+
Sbjct: 67  LPGLEVAGTVVAVGPGGDPEMLGQEVCALVAGGGYAEYCTAPVGSCLPVPKGFSMAEAAA 126

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+ FTVW NLF+   ++ G+TVL+HGG+SGIGTTAI L   FG  V  T  S +KC A
Sbjct: 127 LPETVFTVWHNLFERGYVQEGETVLVHGGTSGIGTTAIGLCKLFGIRVIVTCGSADKCDA 186

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
              LGA  A++Y  ED++  ++  T G G+ ++LDMVG +Y+ ++L  L+ +G+ + I+F
Sbjct: 187 ARALGADLAVDYSNEDYVAAVKDFTGGAGVHVVLDMVGGDYVPRNLDCLADDGRHVSIAF 246

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
             G    EI+++ ++ +R+T+TGSTLR R+   K  + D +   +WP L      P +  
Sbjct: 247 QRGA-KVEIDVSQVMRRRLTLTGSTLRARSAAFKALLADEIHRTLWPRLAEGAWKPAMDQ 305

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
              L   A AH  M+   H+GKI+L
Sbjct: 306 AFALTDAAAAHARMQAGAHVGKIVL 330


>gi|149202196|ref|ZP_01879169.1| NADPH:quinone reductase and related Zn-dependent oxidoreductase
           [Roseovarius sp. TM1035]
 gi|149144294|gb|EDM32325.1| NADPH:quinone reductase and related Zn-dependent oxidoreductase
           [Roseovarius sp. TM1035]
          Length = 329

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 139/326 (42%), Positives = 204/326 (62%), Gaps = 4/326 (1%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           + MR + M+  G   V+      +P     E+LI+V A GVN PD++QR+G YPPPK A+
Sbjct: 6   ETMRVIEMAAPGGPEVLIPGTRALPDCGTGEVLIRVTAAGVNGPDLVQRRGHYPPPKGAS 65

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            +LGLEV+G++V  GE  T W+ GD +CAL NGGGYAE+      H LPIP G + ++AA
Sbjct: 66  DLLGLEVSGEVVACGEGVTKWHPGDRICALTNGGGYAEFVAVDASHCLPIPNGVDEVEAA 125

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
            LPE+FFTVW+N+F   NL      L+HGG+ GIG+TA+QL    G TV TT   +    
Sbjct: 126 GLPETFFTVWSNVFLGHNLPKDGVFLVHGGAGGIGSTAVQLGKAMGLTVLTTIGDDAAAQ 185

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
              +LGA  AIN+  EDF+ + +   +  G DIILD++G +Y+ +++     + ++I ++
Sbjct: 186 FVTELGADRAINFRTEDFVALTR---EAGGADIILDIIGGDYVARNIKAARHDARIIQLA 242

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           F  G+   EI+L P++ KR++ TGSTLR R +  K  + ++L   +WPL  +  + PV H
Sbjct: 243 FNMGS-KVEIDLMPVMLKRLSYTGSTLRSRPEGFKTQVAEALHETVWPLFTAQKLRPVTH 301

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
            VLP+ + A AH +ME +EH GKI+L
Sbjct: 302 RVLPMAEAAEAHRLMEAAEHHGKILL 327


>gi|326491693|dbj|BAJ94324.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 327

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 209/328 (63%), Gaps = 3/328 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAE-SPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           MR VA++  G   V+   E   +P P   E+L++V A GVNR D +QR+G YP P  A+P
Sbjct: 1   MRAVAIASPGGPEVLEEREVEDLPAPGDGEVLLRVAAAGVNRTDTVQRQGGYPLPPGASP 60

Query: 66  ILGLEVAGKIVDLGENT-THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
             G+E +G I+ LG N    W +GD+VCAL+ GGGYAE  +      LP+P+  +   AA
Sbjct: 61  YPGVECSGTILALGANVHPRWVVGDQVCALLPGGGYAEKVVVPAALLLPVPEEVSLTDAA 120

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
            LPE   TVW+ +F T++L  G++ LIHGGSSGIGT AIQ+A + G  V  TA SEEK  
Sbjct: 121 GLPEVACTVWSTVFMTSHLSPGESFLIHGGSSGIGTFAIQMAKHLGIKVIVTAGSEEKLA 180

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC  LGA   INY  EDF+  +++ET G G+D+ILD VG  YL ++L  L+ +G+L II 
Sbjct: 181 ACAGLGADVCINYKTEDFVARIKEETNGNGVDVILDNVGGPYLQRNLESLAVDGRLFIIG 240

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           F+GG + TE+NL  ++++R+TI  + LR R+   K  I  +++  +WP + S  + PV++
Sbjct: 241 FMGGTV-TELNLQAMLARRLTIQVAGLRSRSLANKAQIVSAVEKNVWPAVASGKVRPVVY 299

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIILLP 332
             L L + A AH +ME S HIGKI+L+P
Sbjct: 300 KTLSLSEAAEAHKLMESSSHIGKILLIP 327


>gi|326491337|dbj|BAK05768.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 327

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 209/328 (63%), Gaps = 3/328 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAE-SPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           MR VA++  G   V+   E   +P P   E+L++V A GVNR D +QR+G YP P  A+P
Sbjct: 1   MRAVAIASPGGPEVLEEREVEDLPAPGDGEVLLRVAAAGVNRTDTVQRQGGYPLPPGASP 60

Query: 66  ILGLEVAGKIVDLGENT-THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
             G+E +G I+ LG N    W +GD+VCAL+ GGGYAE  +      LP+P+  +   AA
Sbjct: 61  YPGVECSGTILALGANVHPRWVVGDQVCALLPGGGYAEKVVVPAALLLPVPEEVSLTDAA 120

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
            LPE   TVW+ +F T++L  G++ LIHGGSSGIGT AIQ+A + G  V  TA SEEK  
Sbjct: 121 GLPEVACTVWSTVFMTSHLSPGESFLIHGGSSGIGTFAIQMAKHLGIKVIVTAGSEEKLA 180

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC  LGA   INY  EDF+  +++ET G G+D+ILD VG  YL ++L  L+ +G+L II 
Sbjct: 181 ACAGLGADVCINYKTEDFVARIKEETNGNGVDVILDNVGGPYLQRNLESLAVDGRLFIIG 240

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           F+GG + TE+NL  ++++R+TI  + LR R+   K  I  +++  +WP + S  + PV++
Sbjct: 241 FMGGTV-TELNLQAMLARRLTIQVAGLRSRSLANKAQIISAVEKNVWPAVASGKVRPVVY 299

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIILLP 332
             L L + A AH +ME S HIGKI+L+P
Sbjct: 300 KTLSLSEAAEAHKLMESSSHIGKILLIP 327


>gi|94498368|ref|ZP_01304926.1| alcohol dehydrogenase superfamily, zinc-containing [Sphingomonas
           sp. SKA58]
 gi|94422123|gb|EAT07166.1| alcohol dehydrogenase superfamily, zinc-containing [Sphingomonas
           sp. SKA58]
          Length = 424

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 140/328 (42%), Positives = 202/328 (61%), Gaps = 2/328 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I  +M  + ++  G    +     P+P P + E+LI+V A GVNRPDV+QR+G YPPP  
Sbjct: 97  IPAEMTAIGIAAPGGPEALVAQRRPVPAPGEGEVLIRVAAAGVNRPDVLQRQGKYPPPPG 156

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ I GLEV+G IV  G       IG +VCAL+ GGGYAEY ++  G  LPIP GY+ ++
Sbjct: 157 ASDIPGLEVSGTIVAAGGGADQL-IGQQVCALLAGGGYAEYAVAPAGQCLPIPPGYDLVE 215

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA+LPE+ FTVW NLF+ A    G TVL+HGG+SGIGT AI L   F  T+  T  +++K
Sbjct: 216 AAALPETLFTVWTNLFERAYAAPGDTVLVHGGTSGIGTMAISLCRLFDVTIIVTCGNDDK 275

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C   L+ GA HA+NY  +DF+  +++ T G+G   +LDMVG +Y+ ++L  L+++G+ + 
Sbjct: 276 CAQALEWGAAHAVNYKTQDFVAEVKRITDGKGCQAVLDMVGGDYVARNLDCLAEDGRHVS 335

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I+ LGG  A EI +  I+ +R+T+T STLR R+   K  + D L   +WP +    + P 
Sbjct: 336 IAVLGGAKA-EIFIPQIMQRRLTLTASTLRARSVGFKSLVADELVRTVWPFVAEGRLRPA 394

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +     +   A AH  M+   H GKI+L
Sbjct: 395 MDQRFDMADAAKAHARMDSGAHFGKIVL 422


>gi|85706363|ref|ZP_01037457.1| quinone oxidoreductase [Roseovarius sp. 217]
 gi|85669136|gb|EAQ24003.1| quinone oxidoreductase [Roseovarius sp. 217]
          Length = 322

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 140/326 (42%), Positives = 200/326 (61%), Gaps = 4/326 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  V M+  G   V+     P+P     E+LI+V A GVN PD++QR+G YPPPK A+ +
Sbjct: 1   MSVVEMTAPGGPEVLIPGTRPLPACGAGEVLIRVTATGVNGPDMVQRRGHYPPPKGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEV+G++V  G+  T W  GD +CAL NGGGYAE+      H LPIP+G + + AA L
Sbjct: 61  LGLEVSGEVVACGDGVTQWTPGDRICALTNGGGYAEFVAVDASHCLPIPQGVDEVAAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFTVW+N+F    L      L+HGG+ GIG+TAIQL    G TV TT    E     
Sbjct: 121 PETFFTVWSNVFLDHALPKDGVFLVHGGAGGIGSTAIQLGKVMGLTVLTTVGDAEAAEFV 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA  AIN+  EDF+ + +   +  G DIILD++G +Y+ +++     + +LI ++F 
Sbjct: 181 TSLGADRAINFRSEDFVALTR---EAGGADIILDIIGGDYVARNIKAARHDARLIQLAFN 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G+   EI+L P++ KR++ TGSTLR R +  K  + ++L+  +WP   +  + PV H V
Sbjct: 238 MGS-KVEIDLMPVMLKRLSYTGSTLRSRPESFKTQVAEALRETVWPFFANGKLRPVTHRV 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILLP 332
           LP+ + A AH +ME  +H GKI+L P
Sbjct: 297 LPMAEAAEAHRLMEAGDHHGKILLRP 322


>gi|296080972|emb|CBI18604.3| unnamed protein product [Vitis vinifera]
          Length = 319

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 207/326 (63%), Gaps = 7/326 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G   V+ + E   P+    E+LI+VEA  +NR D +QRKGL+PPPK ++P 
Sbjct: 1   MKAVVITTPGDPQVLQVQEVENPEIGDNEVLIRVEASALNRADTLQRKGLHPPPKGSSPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G I  +G+    W +GD+VCAL+ GGGYAE      G  LP+P G +   AA++
Sbjct: 61  PGLECSGIIEAVGKAVVRWKVGDQVCALLAGGGYAEKVSVPAGQVLPVPSGVSLKDAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F  + L +G+T LIHGGSSGIGT AIQ+A Y GA V+ TA        C
Sbjct: 121 PEVACTVWSTVFMMSRLTAGETFLIHGGSSGIGTFAIQIAKYIGARVFVTAS------VC 174

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY  EDF+  +++ET G+G+D+ILD +G  Y  +++  L+ +G+L II F 
Sbjct: 175 KDLGADVCINYKTEDFVARVKEETGGKGVDVILDNIGGAYFQRNIDSLNVDGRLFIIGFQ 234

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +A E+NL+ ++++R+T+  + LR R+   K +I   ++  +WP + +  + PV++  
Sbjct: 235 GGTVA-EVNLSGLLARRLTVQAAGLRNRSLENKAAIVSEVEKNVWPAIAAGKVKPVVYKY 293

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILLP 332
            PL + A AH +ME S H+GKI+L+P
Sbjct: 294 FPLTEAAEAHQLMESSNHVGKILLIP 319


>gi|169632564|ref|YP_001706300.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter
           baumannii SDF]
 gi|169151356|emb|CAP00074.1| putative oxydoreductase protein, zinc-containing (quinone
           oxidoreductase, NADPH dependent) [Acinetobacter
           baumannii]
          Length = 370

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 204/330 (61%), Gaps = 2/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +   M+ V ++  G   V+ L +S +P PQ +E LI+V+A G+NRPDV+QR GLYP P
Sbjct: 39  MNLPTTMKIVEITVPGGPEVLKLQDSNVPVPQADEALIEVKAAGINRPDVLQRMGLYPMP 98

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K    I GLEVAG +V +GE    + +GD+VCAL NGGGYAEYC       LPIP+  + 
Sbjct: 99  KGVTQIPGLEVAGVVVAVGEQVQQFKVGDKVCALTNGGGYAEYCAVTATQVLPIPENLSF 158

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
            QAA++PE+FFTVWANLF    L+  +T LIHGG+SGIGTTA+ +    G   + T  SE
Sbjct: 159 TQAAAIPETFFTVWANLFDIGRLKKDETALIHGGASGIGTTALAICHALGIKTFATVGSE 218

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +K  A   L    AINY  +DF + +   TQ +G+D+ILD+VG  Y  ++L LL ++G+L
Sbjct: 219 DKVEALSDLTT--AINYKTQDFEQEILNHTQEQGVDVILDIVGGSYFQKNLNLLKRDGRL 276

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           +II F+GG I  E +L  +I K  TITGST+R R    K  I  SL   +WPLL      
Sbjct: 277 VIIGFMGGRIGKEFDLQKLILKCATITGSTMRARNSQEKAQIAQSLHEHVWPLLAQGKCL 336

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           P I+       V  AH  ME+ +HIGKI+L
Sbjct: 337 PQIYKTYAFSDVQSAHACMEQGDHIGKIVL 366


>gi|29830911|ref|NP_825545.1| quinone oxidoreductase [Streptomyces avermitilis MA-4680]
 gi|29608024|dbj|BAC72080.1| putative quinone oxidoreductase [Streptomyces avermitilis MA-4680]
          Length = 326

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 139/316 (43%), Positives = 203/316 (64%), Gaps = 1/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G    +   E P P+P + E+L++V A  VNR D++QR+G Y PP  A+P  GLE +G+I
Sbjct: 10  GGPEALVWTEVPDPEPGEGEVLVEVVASAVNRADLLQRQGFYAPPPGASPYPGLECSGRI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
             LG   + W +GDEVCAL+ GGGYAE      G  LP+P+G    QAA+LPE   TVW+
Sbjct: 70  AALGPGVSGWAVGDEVCALLAGGGYAEKVAVPAGQLLPVPEGIGLRQAAALPEVTCTVWS 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  A+LR G+T+L+HGGSSGIGT AIQLA   GA V  TA ++EK   C +LGA   +
Sbjct: 130 NVFMVAHLRPGETLLVHGGSSGIGTMAIQLAKAVGAKVAVTAGTKEKLDFCAELGADVLV 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY ++DF+E +++ T G G D+ILD +GA+YL +++  L+  G+L II   GG    E+N
Sbjct: 190 NYREQDFVEEVRRATDGAGADVILDNMGAKYLGRNVDALAVNGRLAIIGMQGGA-KGELN 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           +  ++ KR  +T ++LR R    K +I  + +  +WPL+ S  + P++   LP+   A A
Sbjct: 249 IGALLHKRGAVTATSLRARPLGEKAAIVAAAREHVWPLIASGRVRPIVDRELPMSDAATA 308

Query: 316 HDIMEKSEHIGKIILL 331
           H ++E+S HIGK++L+
Sbjct: 309 HRVLEESGHIGKVLLV 324


>gi|326386215|ref|ZP_08207839.1| alcohol dehydrogenase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209440|gb|EGD60233.1| alcohol dehydrogenase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 341

 Score =  281 bits (720), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 134/324 (41%), Positives = 204/324 (62%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G   V+     P+PQP   ++L++V   GVNRPDV+QR+G YP P   +PI
Sbjct: 16  MTAIGIATPGGPEVLQPETLPLPQPGPGQVLVRVRFAGVNRPDVVQRQGFYPAPPGHSPI 75

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG++V LGE  +   IG  + ALV+GGGYA+YC++     LP+P+G    +AA+L
Sbjct: 76  PGLEIAGEVVALGEGVSEPAIGTAIAALVSGGGYAQYCIAEADQCLPVPEGLPLEEAAAL 135

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVW N+FQ A    G+T+L+HGG+SGIGT AI L   FG     T  S +KC   
Sbjct: 136 PETVFTVWHNVFQRAFACEGETLLVHGGTSGIGTMAISLGRLFGVRTIVTCGSPDKCARA 195

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L+LGA HAI+Y   DF+  ++  T G+G+ ++LDMV   Y+ +++  L+ +G+ + I+  
Sbjct: 196 LELGADHAIDYKASDFVAEVKTITGGKGVQVVLDMVAGTYVQRNIKCLADDGRHVTIAVQ 255

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  EIN+  ++ +RI +TGST+R R +  K  +   ++  +WPL+ S  + PV+   
Sbjct: 256 GG-VRAEINMAEVMRRRIMLTGSTMRSRDNTFKALLAQEIREMVWPLVASGELRPVMDRT 314

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + + AH+ ME   H+GKI+L
Sbjct: 315 FPLIEASAAHERMEAGGHVGKIVL 338


>gi|332666727|ref|YP_004449515.1| NAD(P)H quinone oxidoreductase, PIG3 family [Haliscomenobacter
           hydrossis DSM 1100]
 gi|332335541|gb|AEE52642.1| NAD(P)H quinone oxidoreductase, PIG3 family [Haliscomenobacter
           hydrossis DSM 1100]
          Length = 326

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 203/324 (62%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +  +G    ++LAE P P+PQ  EI +KV+A  +NR D++QR+G YPPP   +PI
Sbjct: 1   MRAIQLHQFGSVKELYLAEFPTPEPQDYEIRVKVKATALNRADLLQREGKYPPPPGESPI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           +GLE+AG++  LG     W IGD VC L+ GG YA+Y + H+   + IP   + + AA++
Sbjct: 61  MGLEMAGEVEKLGAKVNKWKIGDRVCGLLAGGAYAQYVVIHEDMAMAIPPNLDFLAAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+F T +  L   A L+  +T+LIH G+SG+GT A+QL+   GAT Y TA +E+  L C
Sbjct: 121 PEAFLTAFQALVWIAKLQPAETLLIHAGASGVGTAALQLSRLIGATTYVTASAEKHAL-C 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA+  I+Y  EDF + +   T+GRG+D++LD +GA YL ++L  L  +G++++++ +
Sbjct: 180 LSLGAERCIDYKSEDFADCIHTWTEGRGVDVVLDFLGASYLERNLKALGMDGRMVLLALM 239

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A  INL  I+ KR+++ GSTLR RT   K ++        W    S  + PV+  V
Sbjct: 240 GGAQAPGINLGLILMKRLSLHGSTLRARTLQYKTALTHDFMELTWAHFASGNLFPVLDKV 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P  +VA AH  ME + + GKI+L
Sbjct: 300 FPWEEVAQAHLYMEGNRNQGKIVL 323


>gi|302559603|ref|ZP_07311945.1| NADPH:quinone reductase [Streptomyces griseoflavus Tu4000]
 gi|302477221|gb|EFL40314.1| NADPH:quinone reductase [Streptomyces griseoflavus Tu4000]
          Length = 327

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 203/316 (64%), Gaps = 1/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G    +   E P P     E+L++V A  VNR D++QR+G Y PP  A+P  GLE +G+I
Sbjct: 10  GGPEALVWDEVPDPVAGPGEVLVEVVAGAVNRADILQRQGFYDPPPGASPYPGLECSGRI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
             LG+  + W +GDEVCAL++GGGYAE      G  LP+P+G    QAA+LPE   TVW+
Sbjct: 70  AALGDGVSGWAVGDEVCALLSGGGYAEKVAVPAGQLLPVPQGLTVDQAAALPEVVCTVWS 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  A+LR G+T+L+HGGSSGIGT AIQLA   GA V  TA + EK   C +LGA   +
Sbjct: 130 NVFMVAHLRPGETLLVHGGSSGIGTMAIQLAKAVGARVAVTAGTREKLERCAELGADILV 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY ++DF+  L++ T G G D++LD +GA+YL++++  L+  G+L II   GG +  E+N
Sbjct: 190 NYREQDFVAELKQATDGHGADVVLDNMGAKYLDRNVQALAVNGRLAIIGMQGG-VKGELN 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           +  +++KR  I+ ++LR R    K +I  +++  +WPL+    + PVI   +P+   A A
Sbjct: 249 IGALLAKRAAISATSLRARPPEEKAAIVAAVREHVWPLVGGGHVRPVIDREIPMSDAAAA 308

Query: 316 HDIMEKSEHIGKIILL 331
           H ++E+S HIGK++L+
Sbjct: 309 HRVVEESGHIGKVLLV 324


>gi|297201039|ref|ZP_06918436.1| quinone oxidoreductase [Streptomyces sviceus ATCC 29083]
 gi|197712177|gb|EDY56211.1| quinone oxidoreductase [Streptomyces sviceus ATCC 29083]
          Length = 326

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 140/325 (43%), Positives = 209/325 (64%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +  +E P     + E+L++V A  VNR D++QR+G Y PP  A+P 
Sbjct: 1   MHAITIPEPGGPEALVWSEVPDAVAGEGEVLVEVLAGAVNRADILQRQGFYNPPPGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G+IV++G   + W +GDEVCAL+ GGGYAE      G  LP+PK  +  +AA+L
Sbjct: 61  PGLECSGRIVEIGPGVSGWAVGDEVCALLAGGGYAEKVAVPAGQLLPVPKDLDVKRAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A+LR G+T+L+HGGSSGIGT AIQLA   GA V  TA + +K   C
Sbjct: 121 PEVVCTVWSNVFMVAHLRPGETLLVHGGSSGIGTMAIQLAKAVGAKVAVTAGTPQKLERC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY ++DF+E ++K T G G D+ILD +GA+YL++++  L+  G+L II   
Sbjct: 181 AELGADILINYREQDFVEEVRKATDGAGADVILDNMGAKYLDRNVNALAVNGRLAIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E+N+  ++ KR  I+ ++LR R    K +I  +++  +WPLL++  I PV+   
Sbjct: 241 GG-VKGELNIATLLGKRAAISATSLRARPPAEKTAIVAAVREHVWPLLDAGHIRPVVDRE 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           LP+   A AH ++E+S HIGK++L+
Sbjct: 300 LPMSDAAAAHRVVEESGHIGKVLLV 324


>gi|15451578|gb|AAK98702.1|AC069158_14 Putative quinone oxidoreductase [Oryza sativa Japonica Group]
          Length = 338

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 147/339 (43%), Positives = 211/339 (62%), Gaps = 14/339 (4%)

Query: 7   MRHVAMSGYGKSNVMFLAE--SPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           MR V ++  G   V+   +    +P P + E+L+ V A GVNR D +QR+G YP P  A+
Sbjct: 1   MRAVVIARAGGPEVLEERDVGEGLPPPGEGEVLVGVSAAGVNRADTVQRQGRYPAPPGAS 60

Query: 65  PILGLEVAGKIVDLGENT-THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           P  GLE +G I+ LG N  + W +GD+VCAL++ GGYAE  +   G  LP+P+G +   A
Sbjct: 61  PYPGLECSGTILALGPNVPSRWAVGDQVCALLSSGGYAEKVVVPAGQLLPVPEGVSLTDA 120

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A LPE   TVW+ +F T++L   ++ LIHGGSSGIGT AIQ+A + G  V+ TA SEEK 
Sbjct: 121 AGLPEVACTVWSTVFVTSHLSPSESFLIHGGSSGIGTFAIQIAKHLGIKVFVTAGSEEKL 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGR----------GIDIILDMVGAEYLNQHLTL 233
            AC  LGA   INY  EDF+  +++ET G+          G+D+ILD +G  YL ++L  
Sbjct: 181 AACKGLGADVCINYKTEDFVARVKEETNGKVTLDMEVYLPGVDVILDNIGGLYLQRNLNS 240

Query: 234 LSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPL 293
           L+ +G+L II F GG + TE+NL P++++R+TI  + LR R+   K  I   ++  +WP 
Sbjct: 241 LAVDGRLFIIGFQGGAV-TEVNLQPMLARRLTIQAAGLRNRSLDNKALIVSEVEKNVWPA 299

Query: 294 LNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
           +    + PVI+   PL + A AH +ME+S HIGKI+L+P
Sbjct: 300 VVQGKVKPVIYKTFPLSEAAEAHKLMEESSHIGKILLIP 338


>gi|296268073|ref|YP_003650705.1| NAD(P)H quinone oxidoreductase [Thermobispora bispora DSM 43833]
 gi|296090860|gb|ADG86812.1| NAD(P)H quinone oxidoreductase, PIG3 family [Thermobispora bispora
           DSM 43833]
          Length = 320

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 143/325 (44%), Positives = 200/325 (61%), Gaps = 6/325 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +  +G   V+   E P P P   E++I+V A  VNR DV+QR+GLYPPP  A+ I
Sbjct: 1   MRAIVIPEHGGPEVLTWQEMPDPHPAPGEVVIEVAASAVNRADVLQRQGLYPPPPGASEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G I ++GEN   +++GD VCAL+ GGGYAE         +PIP G +  +AA+ 
Sbjct: 61  PGLECSGVIAEIGENVEGFSVGDRVCALLAGGGYAERVAVPYQQVMPIPDGVSLTEAAAF 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F TA LR G+T+L+HGG SGIGT AIQLA   GA V  TA S EK   C
Sbjct: 121 PEVACTVWSNVFMTAGLREGETLLVHGGGSGIGTFAIQLAKARGARVLVTAGSAEKLQRC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   +NY  EDF E    +      D+ILD++GA YL +++  L+  G+L++I   
Sbjct: 181 FELGADDGVNYRVEDFAERFAGQA-----DVILDIIGAAYLPRNIAALATGGRLVVIGLQ 235

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG    E+NL  +++KR ++  S LR R    K  I   +   +WPL+ +  I PV+H  
Sbjct: 236 GGT-RGELNLGTLLAKRASVHASGLRARPVAEKAVICREVVEHVWPLIGAGRIRPVVHAE 294

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           +PL + A AH ++E SEH+GKI+L+
Sbjct: 295 VPLQEAARAHRMLEASEHVGKILLV 319


>gi|183985300|ref|YP_001853591.1| oxidoreductase [Mycobacterium marinum M]
 gi|183178626|gb|ACC43736.1| oxidoreductase [Mycobacterium marinum M]
          Length = 330

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 140/299 (46%), Positives = 196/299 (65%), Gaps = 4/299 (1%)

Query: 35  EILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCAL 94
           E++IKV A GVNR DV+Q  G YPPP  A+ I+G+EV+G I D+G+  T W+ G EVCAL
Sbjct: 29  EVVIKVAAAGVNRADVLQAAGKYPPPPGASEIIGMEVSGTITDIGDGVTEWSAGQEVCAL 88

Query: 95  VNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGG 154
           + GGGYAEY     G  LP+P G + I AA+LPE   TVW+NL  TA+L  GQ VLIHGG
Sbjct: 89  LAGGGYAEYVAVPAGQVLPMPPGVSLIDAAALPEVACTVWSNLVMTAHLGPGQLVLIHGG 148

Query: 155 SSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRG 214
           +SGIG+ AIQ+ +  GA V  TA S EK   C  LGA+  INY  EDF+  L++ET G G
Sbjct: 149 ASGIGSHAIQVCTALGARVAVTAGSSEKLQLCRDLGAQITINYRDEDFVARLKQETDGSG 208

Query: 215 IDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR 274
            D+ILD++GA YL++++  L+ +G+L+II   GG I  E+NL  +++KR  + G+TLR R
Sbjct: 209 ADVILDIMGAAYLDRNVDALAVDGQLVIIGMQGG-IKAELNLGKLLTKRARVIGTTLRAR 267

Query: 275 ---TDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                  K  I  ++   +WP++ S+ + P+I + LP+G+ A AH ++   +  GK +L
Sbjct: 268 PLQGPNGKAVIAQAVTASVWPMIASNRVRPIIGSRLPIGQAAQAHQLLLSGQSYGKTLL 326


>gi|294676035|ref|YP_003576650.1| alcohol dehydrogenase [Rhodobacter capsulatus SB 1003]
 gi|294474855|gb|ADE84243.1| alcohol dehydrogenase, zinc-binding domain protein [Rhodobacter
           capsulatus SB 1003]
          Length = 329

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 204/324 (62%), Gaps = 5/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + ++  G   V+ LA   +P P   EILI++   GVNRPD +QR G Y  P  A+ +
Sbjct: 8   MRCIEIAAPGGPEVLKLASRAVPVPGPGEILIEIAFAGVNRPDALQRAGAYKAPPGASDL 67

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G +  LG   T W +GD VCAL+ GGGYA+Y      H LP+P G +   AA L
Sbjct: 68  PGLECSGHVAALGPGVTGWAVGDPVCALLPGGGYADYATCPAAHALPVPAGLSLRDAACL 127

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTVW+ +     L +G+  L+HGGSSGIGTTAIQ+A   GA V+ TA S EKC+AC
Sbjct: 128 PETCFTVWSTVVMRGGLTAGERFLVHGGSSGIGTTAIQIARALGARVWATAGSAEKCVAC 187

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA  AINY + DF EIL+ E    G ++ILDMVG  Y+ +++  L+ +G+L+ I+FL
Sbjct: 188 AALGAT-AINYREADFAEILRAEG---GANLILDMVGGSYIARNIKALADDGRLVFIAFL 243

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  A EIN   ++ +R+T+TG+TLR ++DIAK  I   L+ ++WP++ +  +  +  + 
Sbjct: 244 EGAKA-EINFAQVMLRRLTLTGATLRPQSDIAKAEIARQLRARVWPMIEAGQVKVIHDSS 302

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L + A AH  ME S HIGKI+L
Sbjct: 303 FALEEAAAAHARMETSAHIGKIVL 326


>gi|124005214|ref|ZP_01690056.1| hypothetical protein M23134_00181 [Microscilla marina ATCC 23134]
 gi|123989466|gb|EAY29027.1| hypothetical protein M23134_00181 [Microscilla marina ATCC 23134]
          Length = 339

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 138/325 (42%), Positives = 206/325 (63%), Gaps = 1/325 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           KM+ V +  +G    + L E   P P K E+L+KV A  +NR D +QRKG+YPPP  A+P
Sbjct: 13  KMKAVVIKEFGGPEQLRLGEWDKPTPAKNEVLVKVHASALNRADTLQRKGVYPPPAGASP 72

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           ILGLE+AG++V++G   + W  GD+V  LV GGGYAEY + H+   +P+P+G+   QA +
Sbjct: 73  ILGLELAGEVVEVGSAISRWQTGDQVFGLVQGGGYAEYAVIHEYMAMPLPQGFTFEQAVA 132

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           +PE F T +  L   A ++  +TVL+H G+SG+GT AIQLA   GA V  TA S  K   
Sbjct: 133 IPEVFLTAFQALRWLARVQPNETVLVHAGASGVGTAAIQLAKAMGARVVVTA-SVGKHQT 191

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           CL LGA+ AI+Y  EDF +     TQG+G+D+++D + A Y +Q++  L+ +G+++I++ 
Sbjct: 192 CLDLGAELAIDYKTEDFQQRTLDFTQGKGVDVVIDFIAAPYFHQNIEALAVDGRMVILAL 251

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           +GG   +E NL  ++ KR+++ GSTLR R+   +  +   L     PL+    IAPVI +
Sbjct: 252 MGGTKVSEFNLAKMLRKRLSVMGSTLRARSQDYQIKLTQDLAEFAIPLITQGKIAPVIDS 311

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
           V    +VA AH  ME ++++GKIIL
Sbjct: 312 VFDWTEVAEAHRYMEANKNVGKIIL 336


>gi|313106106|ref|ZP_07792363.1| putative oxidoreductase [Pseudomonas aeruginosa 39016]
 gi|310878865|gb|EFQ37459.1| putative oxidoreductase [Pseudomonas aeruginosa 39016]
          Length = 338

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 211/327 (64%), Gaps = 2/327 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           ++M  + ++  G   V+     P+P P   E+L++V A GVN PDV+QRKG+Y PP  A+
Sbjct: 9   ERMTAIEIARPGGPEVLVATSRPLPTPGPREVLVEVRAAGVNGPDVLQRKGVYDPPPGAS 68

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            I GLE+AG +  +G   + + +G+ V AL+ GGGYA++ ++ +  TL +P G    +AA
Sbjct: 69  DIPGLEIAGTVRAVGSEVSRFAVGEAVMALIPGGGYAQFAVADERTTLHLPDGLGMEEAA 128

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKC 183
           +LPE+F TVW NLFQ    ++G+T+L+HGG+SGIGTTA  L   FGA  ++TT  SE + 
Sbjct: 129 ALPETFMTVWVNLFQRGGFKAGETLLVHGGASGIGTTATMLGKAFGAAKIFTTISSEAQR 188

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
            A L+LGA  AI+Y ++DF+E + + T+GRG+D+I+D+V  +Y+ ++    +  G+++ I
Sbjct: 189 EASLRLGADLAIDYTEQDFVEEVLRGTEGRGVDVIVDIVAGDYVTRNYQAAAMNGRIVQI 248

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             + G  A E++L P++SKR+   GSTLR R+   K +I   L+ ++WP + +  + P +
Sbjct: 249 GVIKGK-AAEVDLFPMLSKRLVHLGSTLRSRSHDEKGAIIAELERQVWPHVRAGAVRPQV 307

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
               PL +   AH++M+  +HIGKI+L
Sbjct: 308 FRTFPLEQARQAHELMDSGQHIGKIVL 334


>gi|284041379|ref|YP_003391309.1| NAD(P)H quinone oxidoreductase, PIG3 family [Spirosoma linguale DSM
           74]
 gi|283820672|gb|ADB42510.1| NAD(P)H quinone oxidoreductase, PIG3 family [Spirosoma linguale DSM
           74]
          Length = 320

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 206/327 (62%), Gaps = 12/327 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP- 65
           M+ + ++  G S+V+ L E   P P   ++LI+V A GVNR D+ QR G Y     A+P 
Sbjct: 1   MKAIIITQPGNSSVLALEEQATPTPVSGQVLIRVRAAGVNRSDIHQRTGGY----GADPS 56

Query: 66  --ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
             I GLEVAG +   G +   W +GD VCAL+ GGGYAEY    + H LP+P   + ++A
Sbjct: 57  GQIPGLEVAGIVESCGPDANRWRVGDAVCALIGGGGYAEYIAVDERHCLPVPANLSFVEA 116

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           ASLPE+  TVW+ +FQ  +L  G+  L+HGGSSGIG TAIQLA  FGA  Y TA S++KC
Sbjct: 117 ASLPETILTVWSTVFQWGHLSKGENFLVHGGSSGIGVTAIQLAKAFGANTYATAGSDDKC 176

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             C +LGA   +NY KEDF    +K   G  I++ILDMVG +Y  ++L LL+ +G+L+ I
Sbjct: 177 AFCEQLGAIKCVNYNKEDF----EKALTGAEINMILDMVGGDYTPKNLRLLAPDGRLMFI 232

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           + + G   ++I++  ++ KRITI+GS L+ R    K ++   ++  +WPLL +  + PV+
Sbjct: 233 NAMQG-ADSQIHIPTLMQKRITISGSMLKPRDANFKAALTAEVEKHVWPLLTTGQLKPVV 291

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +   PL + A A D+M  SEHIGKIIL
Sbjct: 292 YRSFPLAEAAKAQDLMVSSEHIGKIIL 318


>gi|168036360|ref|XP_001770675.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162678036|gb|EDQ64499.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 328

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 143/325 (44%), Positives = 201/325 (61%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + + G G   V+ L E   P   + E+LIKV A  +NR DVMQR G YPPP  A+ I
Sbjct: 1   MKAIIIEGGGGPEVLKLKEVDDPIAGEGEVLIKVAAAALNRADVMQRSGHYPPPPGASLI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G I  +G   T W +GDEVCAL+ GGGYAE          P+PKG +   AA++
Sbjct: 61  PGLECSGTIEAVGHGVTQWKVGDEVCALLGGGGYAEKINVPAVQVFPVPKGISLQHAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F T +L+ G+T+LIHGG SGIGT AIQ+A   G  V+ T  SEEK    
Sbjct: 121 PEVACTVWSTIFMTCHLKKGETLLIHGGGSGIGTFAIQIAKAKGVKVFVTGGSEEKLKKS 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY  EDF+E  + ET G+G+D+ILD++GA YL +++  L+ +G+L  I+  
Sbjct: 181 RELGADIGINYKTEDFMERCKAETDGKGVDVILDIMGASYLPRNIKALAMDGRLFHIATQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  EI+LN +I +R+T+ G+ LR R+   K  I   +   +WP + S  +  VI+  
Sbjct: 241 GGEVG-EIDLNAVIYRRLTVAGAGLRGRSTEKKGEIVQDVLKNVWPEIESGKVKVVIYNA 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           LPL + + AH+I+E   H GK++LL
Sbjct: 300 LPLAEASKAHEILESGSHFGKVLLL 324


>gi|317126441|ref|YP_004100553.1| NAD(P)H quinone oxidoreductase, PIG3 family [Intrasporangium calvum
           DSM 43043]
 gi|315590529|gb|ADU49826.1| NAD(P)H quinone oxidoreductase, PIG3 family [Intrasporangium calvum
           DSM 43043]
          Length = 326

 Score =  278 bits (711), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 145/325 (44%), Positives = 203/325 (62%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +   G  + +   + P P   + E+LI+V A GVNR DVMQR+GLY PP  A+  
Sbjct: 1   MRAITIPDSGGPDALVPTDVPTPAAGRGEVLIEVVAAGVNRADVMQRRGLYDPPPGASSY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G++  LGE    + +GDEVCAL+ GGGYAE      G  LP P   + + AA L
Sbjct: 61  PGLEVSGRVAALGEGVDSFAVGDEVCALLEGGGYAEEVAVPVGQVLPKPADVDLVDAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F TAN++ GQ +L+HGGSSGIGT AIQLA   GA V  TA + EK   C
Sbjct: 121 PEVVCTVWSNVFMTANIQPGQWLLVHGGSSGIGTMAIQLAKAVGAHVAVTAGTAEKLDFC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   +NY  EDF+E L++     G D+ILD +GA+YL++++  L+  G+L+ I   
Sbjct: 181 RDLGADILVNYRDEDFVEKLREGNHDHGADVILDNIGAKYLSRNVDALAINGRLVTIGLQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E++L  +++KR  +  +TLR R    K +I  +++  +WPL+ + V+ PVIH+ 
Sbjct: 241 GGRRA-ELDLGTLLAKRAAVIATTLRSRPAAEKAAIVAAVREHVWPLIEAGVVRPVIHSR 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
             L + A AH  ME S H+GKI+LL
Sbjct: 300 HALDRAADAHREMEASTHMGKILLL 324


>gi|302767866|ref|XP_002967353.1| hypothetical protein SELMODRAFT_86904 [Selaginella moellendorffii]
 gi|300165344|gb|EFJ31952.1| hypothetical protein SELMODRAFT_86904 [Selaginella moellendorffii]
          Length = 325

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 149/326 (45%), Positives = 204/326 (62%), Gaps = 1/326 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V   G G   V+ L E P P    +E+LIKV A GVNR D++Q KG +PPP  A P 
Sbjct: 1   MRAVVAKGLGGPEVLELREVPDPDIGDDEVLIKVAAAGVNRADLLQLKGQHPPPPGAPPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I  LG     W +GDEVCAL+ GGGYAE         LPIP+G +   AASL
Sbjct: 61  LGLECSGVIERLGARVDGWKVGDEVCALLGGGGYAEKVAVAASQLLPIPRGVSLRDAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F   +L +G++VLIHGGSSGIGT AIQ+A   GA V+ TA SE+K   C
Sbjct: 121 PEVACTVWSTVFMACHLSAGESVLIHGGSSGIGTFAIQMAKSIGAQVFATAGSEKKLDLC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+ AINY ++DF+  +++ T G G+D++LDMVGA Y  ++L  L  +G+L II F 
Sbjct: 181 KQLGAEVAINYKEDDFVARVKEATHGEGVDVVLDMVGASYFERNLEALGMDGRLFIIGFQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  + +++L PI+ KR+ ++ + LR R   +K  I   +   +WP +    + PVI+ V
Sbjct: 241 GGA-SGQLSLLPILKKRLIVSAAGLRTRAPESKAQIVAEVWQNVWPAVEERKVKPVIYRV 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILLP 332
            PL + A A  +M  ++H GKI+L P
Sbjct: 300 FPLEEAAQALQLMVANQHFGKILLTP 325


>gi|218892897|ref|YP_002441766.1| putative oxidoreductase [Pseudomonas aeruginosa LESB58]
 gi|218773125|emb|CAW28937.1| probable oxidoreductase [Pseudomonas aeruginosa LESB58]
          Length = 328

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 131/325 (40%), Positives = 209/325 (64%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G   V+     P+P P   E+L++V A GVN PDV+QRKG+Y PP  A+ I
Sbjct: 1   MTAIEIARPGGPEVLVATSRPLPTPGPREVLVEVRAAGVNGPDVLQRKGVYDPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG +  +G   + + +G+ V AL+ GGGYA++ ++ +  TL +P G    +AA+L
Sbjct: 61  PGLEIAGTVRAVGSEVSRFAVGEAVMALIPGGGYAQFAVADERTTLHLPDGLGMEEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLA 185
           PE+F TVW NLFQ    ++G+T+L+HGG+SGIGTTA  L   FGA  ++TT  SE +  A
Sbjct: 121 PETFMTVWVNLFQRGGFKAGETLLVHGGASGIGTTATMLGKAFGAAKIFTTISSEAQREA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
            L+LGA  AI+Y ++DF+E + + T+GRG+D+I+D+V  +Y+ ++    +  G+++ I  
Sbjct: 181 SLRLGADVAIDYTEQDFVEEVLRGTEGRGVDVIVDIVAGDYVTRNYQAAAMNGRIVQIGV 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           + G  A E++L P++SKR+   GSTLR R+   K +I   L+ ++WP + +  + P +  
Sbjct: 241 IKGK-AAEVDLFPMLSKRLVHLGSTLRSRSHDEKGAIIAELERQVWPHVRAGTVRPQVFR 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL +   AH++M+  +HIGKI+L
Sbjct: 300 TFPLEQARQAHELMDSGQHIGKIVL 324


>gi|107100590|ref|ZP_01364508.1| hypothetical protein PaerPA_01001615 [Pseudomonas aeruginosa PACS2]
 gi|116049069|ref|YP_792129.1| oxidoreductase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254234271|ref|ZP_04927594.1| hypothetical protein PACG_00109 [Pseudomonas aeruginosa C3719]
 gi|254239507|ref|ZP_04932829.1| hypothetical protein PA2G_00121 [Pseudomonas aeruginosa 2192]
 gi|115584290|gb|ABJ10305.1| probable oxidoreductase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126166202|gb|EAZ51713.1| hypothetical protein PACG_00109 [Pseudomonas aeruginosa C3719]
 gi|126192885|gb|EAZ56948.1| hypothetical protein PA2G_00121 [Pseudomonas aeruginosa 2192]
          Length = 328

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 131/325 (40%), Positives = 208/325 (64%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G   V+     P+P P   E+L++V A GVN PDV+QRKG+Y PP  A+ I
Sbjct: 1   MTAIEIARPGGPEVLVATSRPLPTPGPREVLVEVRAAGVNGPDVLQRKGVYDPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG +  +G   + + +G+ V AL+ GGGYA++ ++ +  TL +P G    +AA+L
Sbjct: 61  PGLEIAGTVRAVGSEVSRFAVGEAVMALIPGGGYAQFAVADERTTLHLPDGLGMEEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLA 185
           PE+F TVW NLFQ    ++G+T+L+HGG+SGIGT A  L   FGA  ++TT  SE +  A
Sbjct: 121 PETFMTVWVNLFQRGGFKAGETLLVHGGASGIGTAATMLGKAFGAAKIFTTISSEAQREA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
            L+LGA  AINY ++DF+E + + T+GRG+D+I+D+V  +Y+ ++    +  G+++ I  
Sbjct: 181 SLRLGADLAINYTEQDFVEEVLRGTEGRGVDVIVDIVAGDYVTRNYQAAAMNGRIVQIGV 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           + G  A E++L P++SKR+   GSTLR R+   K +I   L+ ++WP + +  + P +  
Sbjct: 241 IKGK-AAEVDLFPMLSKRLVHLGSTLRSRSHDEKGAIIAELERQVWPHVRAGTVRPQVFR 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL +   AH++M+  +HIGKI+L
Sbjct: 300 TFPLEQARQAHELMDSGQHIGKIVL 324


>gi|256389308|ref|YP_003110872.1| NAD(P)H quinone oxidoreductase, PIG3 family [Catenulispora
           acidiphila DSM 44928]
 gi|256355534|gb|ACU69031.1| NAD(P)H quinone oxidoreductase, PIG3 family [Catenulispora
           acidiphila DSM 44928]
          Length = 333

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 139/324 (42%), Positives = 202/324 (62%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + ++  G    +   E P P     E+LI+V A  VNR D++QR+G Y PP  A+  
Sbjct: 1   MRAITIAEPGGPEQLVWTEVPDPVVAAGEVLIQVAATAVNRADILQRRGFYTPPPGASSY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G++V++G   + +  GDEV AL+ GGGYAE      G   P+PKG +A+ A  L
Sbjct: 61  PGLECSGRVVEVGAGVSGFVPGDEVVALLTGGGYAELVAVPAGQVAPLPKGLSALAAGGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
            E+  TVW+N+F  A L++GQT+L+HGGSSGIGTTAIQLA   GA V  TA +  K  AC
Sbjct: 121 METVCTVWSNVFMLAGLQAGQTLLVHGGSSGIGTTAIQLAHQLGARVIVTAGTAAKLRAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   +NY  EDF+E + + T G+G+D+ILD +GA YL++++  L+ +G+L+II   
Sbjct: 181 RDLGADVGVNYRDEDFVERVAEVTDGQGVDVILDNMGAVYLDRNVQALAVDGRLVIIGLQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E+NLN ++ KR  I+ +TLR R    K  I  + +  +WPL+       V+  V
Sbjct: 241 GG-VTGEVNLNTLLRKRAGISATTLRARPSEEKARIVAAARDAVWPLIEQGRFRVVVDRV 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LP+ + A AH ++E S H+GK++L
Sbjct: 300 LPVDRAAEAHRVVEDSGHVGKVVL 323


>gi|242063434|ref|XP_002453006.1| hypothetical protein SORBIDRAFT_04g036490 [Sorghum bicolor]
 gi|241932837|gb|EES05982.1| hypothetical protein SORBIDRAFT_04g036490 [Sorghum bicolor]
          Length = 328

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 212/329 (64%), Gaps = 4/329 (1%)

Query: 7   MRHVAMS-GYGKSNVMFLAESPIPQPQKE-EILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64
           MR V ++ G G   V+   E   P P  + E+L++V A GVNR D +QR G +PPP  A 
Sbjct: 1   MRAVVITRGGGGPEVLEAQEVEEPAPLGDGEVLLQVAAAGVNRADTLQRHGRHPPPPGAP 60

Query: 65  PILGLEVAGKIVDLGENTT-HWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           P  GLE +G I+ LG N    W++GD+VCAL++GGGYAE  +   G  LP+P+G +   A
Sbjct: 61  PYPGLECSGTILALGPNVPPRWSVGDKVCALLSGGGYAEKVVVPAGQLLPVPEGVSLTDA 120

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A LPE   TVW+ +F T++L  G++ LIHGGSSGIGT AIQ+A + G  V+ TA SEEK 
Sbjct: 121 AGLPEVACTVWSTVFMTSHLSPGESFLIHGGSSGIGTFAIQIAKHLGIKVFITAGSEEKL 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
            AC  LGA   INY  EDF+E +++ET G+G+D+ILD +G  YL ++L  L  +G+L II
Sbjct: 181 AACKDLGADVCINYKTEDFVERVKQETDGKGVDVILDNIGGPYLQRNLNSLGVDGRLFII 240

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
            F GG + TE+NL  ++++R+TI  + LR R+   K  I   ++  +WP + +  + PVI
Sbjct: 241 GFQGGAV-TEVNLQAVLARRLTIQAAGLRNRSLANKAEIVGEVEKNVWPAVAAGKVKPVI 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
           +   PL + A AH +ME S HIGKI+LLP
Sbjct: 300 YKTFPLSEAAEAHRLMEASTHIGKILLLP 328


>gi|239980732|ref|ZP_04703256.1| quinone oxidoreductase [Streptomyces albus J1074]
 gi|291452591|ref|ZP_06591981.1| quinone oxidoreductase [Streptomyces albus J1074]
 gi|291355540|gb|EFE82442.1| quinone oxidoreductase [Streptomyces albus J1074]
          Length = 327

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 135/325 (41%), Positives = 206/325 (63%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +  A  P P P + E+L++V A  VNR D++QR+G Y PP  A+P 
Sbjct: 1   MHAITIPEPGGPEALVWAPVPDPVPGEGEVLVEVVAGAVNRADLLQRQGFYDPPPGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G+I  +G   + W +GDEVCAL++GGGYAE      G  LP+P G     AA+L
Sbjct: 61  PGLECSGRIAAIGPGVSGWAVGDEVCALLSGGGYAEKVAVPAGQLLPVPAGVGLKTAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  + LR G+T+L+HGG+SGIGT AIQLA   GA V  TA S EK   C
Sbjct: 121 PEVVCTVWSNVFMVSQLRPGETLLVHGGASGIGTMAIQLAKAVGARVAVTAGSPEKLQYC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY ++DF+E +++ T G G D+ILD++GA+YL++++  L+  G+L II   
Sbjct: 181 GELGADFLINYREQDFVEEIREVTAGAGADVILDIMGAKYLDRNVKALATNGRLAIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E+++  ++ KR  +T ++LR R    K +I  +++  +WPL+++  + P++   
Sbjct: 241 GGTKA-ELDIATLLRKRGAVTATSLRGRPASEKAAIVAAVREHVWPLIDTGRVRPIVDRE 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           +P+   A  H ++E+S HIGK++L+
Sbjct: 300 VPMRDAAAGHRVLEESSHIGKVLLV 324


>gi|145333616|ref|NP_001078419.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Arabidopsis thaliana]
 gi|332659075|gb|AEE84475.1| putative NADPH quinone oxidoreductase [Arabidopsis thaliana]
          Length = 319

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 139/324 (42%), Positives = 202/324 (62%), Gaps = 7/324 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +S  GK  V+ L +   P+ + +E+LI+V A  +NR D +QR GLY PP  ++P 
Sbjct: 1   MKAIVISEPGKPEVLQLRDVADPEVKDDEVLIRVLATALNRADTLQRLGLYNPPPGSSPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I  +G+  + W +GD+VCAL++GGGYAE      G   PIP G +   AA+ 
Sbjct: 61  LGLECSGTIESVGKGVSRWKVGDQVCALLSGGGYAEKVSVPAGQIFPIPAGISLKDAAAF 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F    L  G++ LIHGGSSGIGT AIQ+A + G  V+ TA       AC
Sbjct: 121 PEVACTVWSTVFMMGRLSVGESFLIHGGSSGIGTFAIQIAKHLGVRVFVTAA------AC 174

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY  EDF+  ++ ET G+G+D+ILD +GA YL ++L  L+ +G+L II  +
Sbjct: 175 KELGADVCINYKTEDFVAKVKAETDGKGVDVILDCIGAPYLQKNLDSLNFDGRLCIIGLM 234

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A EI L+ ++ KR+T+ G+ LR R+   K  +   ++  +WP + +  + PVI+  
Sbjct: 235 GGANA-EIKLSSLLPKRLTVLGAALRPRSPENKAVVVREVEKNVWPAIEAGKVKPVIYKY 293

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LPL + A  H +ME S HIGKI+L
Sbjct: 294 LPLSQAAEGHSLMESSNHIGKILL 317


>gi|294630395|ref|ZP_06708955.1| NADPH:quinone reductase [Streptomyces sp. e14]
 gi|292833728|gb|EFF92077.1| NADPH:quinone reductase [Streptomyces sp. e14]
          Length = 326

 Score =  276 bits (705), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 139/325 (42%), Positives = 206/325 (63%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +   E P P P + E+L++V A  VNR D++QR+G Y PP  A+P 
Sbjct: 1   MHAITIPEPGGPEALVWDEVPDPVPGEGEVLVEVVASAVNRADILQRQGNYQPPPGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G+I  LG   + W +GDEVCAL+ GGGYAE      G  LP+P+G +  QAA+L
Sbjct: 61  PGLECSGRIAALGPGVSGWAVGDEVCALLAGGGYAEKVAVPSGQLLPVPEGVDLRQAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A+LR  +T+L+HGGSSGIGT AIQLA   GA V  TA ++EK   C
Sbjct: 121 PEVVCTVWSNVFMVAHLRPAETLLVHGGSSGIGTMAIQLAKAAGARVAVTAGTKEKLDQC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY ++DF+E +++ T G G D+ILD +GA+YL++++  L+  G+L II   
Sbjct: 181 AELGADILINYREQDFVEEIRRATDGAGADVILDNMGAKYLDRNVRALAVNGRLAIIGLQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG    E+N+  ++ KR  I+ ++LR R    K +I  +++  +WPL+    + PV+   
Sbjct: 241 GGA-KGELNIGALLGKRAAISATSLRGRPLGEKAAIVAAVREHVWPLIADGHVRPVVDRE 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           +PL + A A  ++E+S HIGK++L+
Sbjct: 300 VPLSEAAAAQRVVEESGHIGKVLLV 324


>gi|119962331|ref|YP_946641.1| quinone oxidoreductase [Arthrobacter aurescens TC1]
 gi|119949190|gb|ABM08101.1| putative quinone oxidoreductase [Arthrobacter aurescens TC1]
          Length = 327

 Score =  276 bits (705), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 149/327 (45%), Positives = 205/327 (62%), Gaps = 3/327 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +S  G   V+ + E P P P + E+LI V A G+NR DV QR+G YPPP  A+ +
Sbjct: 1   MKAVYISEPGGPEVLEIREVPSPVPGEGEVLIDVVAAGLNRADVQQRRGFYPPPPGASEV 60

Query: 67  LGLEVAGKIVDLGENTTH-WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
            GLEV+G+I   G   T  +++GD+V AL++GGGYA+         L IP G + I AAS
Sbjct: 61  PGLEVSGRIAAFGPGVTKAFSVGDKVVALLSGGGYAQQVAVPAEQVLRIPDGVDLITAAS 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC-L 184
           LPE   TV++NL  TA L+ G+TVLIHG + GIGT AIQLA  +GA V TTA ++EK   
Sbjct: 121 LPEVAATVYSNLIMTAQLQPGETVLIHGATGGIGTMAIQLAKAYGAKVATTAGTDEKVGT 180

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           A   LGA  AINY +EDF E L+    G+G D+ILD+VGA+YL Q++  L+  G+LI+I 
Sbjct: 181 AKAFLGADIAINYTEEDFAESLKAHNGGKGADVILDVVGAKYLQQNIEALADYGRLIVIG 240

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
             GG  A EINL  ++SKR  + G+ LR R    K  I  +++  +WP+L    I P++ 
Sbjct: 241 LQGGTKA-EINLGQLLSKRAAVIGTALRPRPVTEKGIIMSAVRESVWPMLTDGRIKPLVA 299

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIILL 331
              PL +V  AH+  +  EH+GK++LL
Sbjct: 300 KSFPLDQVREAHEYFDSGEHVGKVLLL 326


>gi|297624339|ref|YP_003705773.1| NAD(P)H quinone oxidoreductase, PIG3 family [Truepera radiovictrix
           DSM 17093]
 gi|297165519|gb|ADI15230.1| NAD(P)H quinone oxidoreductase, PIG3 family [Truepera radiovictrix
           DSM 17093]
          Length = 319

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 199/306 (65%), Gaps = 4/306 (1%)

Query: 25  ESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTH 84
           + P P+P   E+L++V A GVNR D+ QR G YPPP  A+ ILGLEVAG+I +LG   + 
Sbjct: 15  DVPDPRPAAGEVLVRVRAAGVNRADLAQRAGHYPPPPGASEILGLEVAGEIAELGPGVSG 74

Query: 85  WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLR 144
           W +GD VCAL+ GGGYAE         +P+P+G+   +AA+LPE FFT + NLF   NL+
Sbjct: 75  WRVGDRVCALLAGGGYAELVNVPAALLMPVPEGWRFEEAAALPEVFFTAFLNLFLEWNLK 134

Query: 145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLE 204
            G+ VLIHGG+SG+GT AIQLA   G TV+ TA + EK  AC  LGA  A NY +EDF E
Sbjct: 135 EGEAVLIHGGASGVGTAAIQLAVAAGCTVFATAGTPEKVAACEALGAT-AFNYREEDFAE 193

Query: 205 ILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRI 264
            L       G+D++LDMVG +YL ++L +L   G+LI+I+ L GN A EI+L  ++ KR+
Sbjct: 194 ALTPHVA--GVDVVLDMVGKDYLARNLRVLKTGGRLIVIATLSGNRA-EIDLRLLMQKRL 250

Query: 265 TITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEH 324
           T+ GSTLR R    K +++++   + W  + +  + P+I +   + +V  AH+ M  +++
Sbjct: 251 TLRGSTLRSRPLGEKVALKEAFMARFWERIEARRLRPLIDSTFDIREVESAHERMRGNQN 310

Query: 325 IGKIIL 330
           IGK++L
Sbjct: 311 IGKLVL 316


>gi|15596334|ref|NP_249828.1| oxidoreductase [Pseudomonas aeruginosa PAO1]
 gi|9947057|gb|AAG04526.1|AE004543_10 probable oxidoreductase [Pseudomonas aeruginosa PAO1]
          Length = 328

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 208/325 (64%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + ++  G   V+     P+P P   E+L++V A GVN PDV+QRKG+Y PP  A+ I
Sbjct: 1   MTAIEIARPGGPEVLVATSRPLPTPGPREVLVEVRAAGVNGPDVLQRKGVYDPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG +  +G   + + +G+ V AL+ GGGYA++ ++ +  TL +P G    +AA+L
Sbjct: 61  PGLEIAGTVRAVGSEVSRFAVGEAVMALIPGGGYAQFAVADERTTLHLPDGLGMEEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLA 185
           PE+F TVW NLFQ    ++G+T+L+HGG+SGIGT A  L   FGA  ++TT  SE +  A
Sbjct: 121 PETFMTVWVNLFQRGGFKAGETLLVHGGASGIGTAATMLGKAFGAAKIFTTISSEAQREA 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
            L+LGA  AI+Y ++DF+E + + T+GRG+D+I+D+V  +Y+ ++    +  G+++ I  
Sbjct: 181 SLRLGADVAIDYTEQDFVEEVLRGTEGRGVDVIVDIVAGDYVTRNYQAAAMNGRIVQIGV 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           + G  A E++L P++SKR+   GSTLR R+   K +I   L+ ++WP + +  + P +  
Sbjct: 241 IKGK-AAEVDLFPMLSKRLVHLGSTLRSRSHDEKGAIIAELERQVWPHVRAGTVRPQVFR 299

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL +   AH++M+  +HIGKI+L
Sbjct: 300 TFPLEQARQAHELMDSGQHIGKIVL 324


>gi|254706098|ref|ZP_05167926.1| quinone oxidoreductase, PIG3 family protein [Brucella pinnipedialis
           M163/99/10]
 gi|254711604|ref|ZP_05173415.1| quinone oxidoreductase, PIG3 family protein [Brucella pinnipedialis
           B2/94]
 gi|254712218|ref|ZP_05174029.1| quinone oxidoreductase, PIG3 family protein [Brucella ceti
           M644/93/1]
 gi|254715289|ref|ZP_05177100.1| quinone oxidoreductase, PIG3 family protein [Brucella ceti
           M13/05/1]
 gi|256015175|ref|YP_003105184.1| alcohol dehydrogenase, zinc-containing [Brucella microti CCM 4915]
 gi|256029762|ref|ZP_05443376.1| quinone oxidoreductase, PIG3 family protein [Brucella pinnipedialis
           M292/94/1]
 gi|260167150|ref|ZP_05753961.1| alcohol dehydrogenase, zinc-containing [Brucella sp. F5/99]
 gi|261756552|ref|ZP_06000261.1| zinc-containing alcohol dehydrogenase superfamily [Brucella sp.
           F5/99]
 gi|265986773|ref|ZP_06099330.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           pinnipedialis M292/94/1]
 gi|255997835|gb|ACU49522.1| alcohol dehydrogenase, zinc-containing [Brucella microti CCM 4915]
 gi|261736536|gb|EEY24532.1| zinc-containing alcohol dehydrogenase superfamily [Brucella sp.
           F5/99]
 gi|264658970|gb|EEZ29231.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           pinnipedialis M292/94/1]
          Length = 335

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 206/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+ L    +P  ++ E+ ++V A GVNRPD MQR G YPPP     +LGLE++G +
Sbjct: 14  GGPEVLELVPRELPALKRGEMRVRVHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVV 73

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +++ E+ T +  GD + ALV GG Y+E  +      +P+P G + ++AA +PE++FTVW+
Sbjct: 74  LEIAEDVTRFGPGDRIMALVAGGAYSEEAIVQADVCIPVPAGLSMVEAAGIPETYFTVWS 133

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ A L+ G+TVL+HGG+SGIG TA  LA   GA + TT  S++KC A   LGA  +I
Sbjct: 134 NLFQRAGLQPGETVLLHGGTSGIGVTATLLAKAIGARMITTCGSDDKCRASEALGAIASI 193

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF+E  +  T+GRG ++++DMVG  Y+ ++L L++++G++  I+F  G+ A +++
Sbjct: 194 NYRTTDFVEAGRALTEGRGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMD 252

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+T+TGSTLR R  + K ++  S++ ++ PL+ +    PVI +V  L  V  A
Sbjct: 253 MGPLLFKRLTLTGSTLRARPLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAA 312

Query: 316 HDIMEKSEHIGKIIL 330
           H  +E S H GKIIL
Sbjct: 313 HAHLEASAHTGKIIL 327


>gi|118616002|ref|YP_904334.1| oxidoreductase [Mycobacterium ulcerans Agy99]
 gi|118568112|gb|ABL02863.1| oxidoreductase [Mycobacterium ulcerans Agy99]
          Length = 330

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 195/299 (65%), Gaps = 4/299 (1%)

Query: 35  EILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCAL 94
           E++IKV A GVNR DV+Q  G YPPP  A+ I+G+EV+G I D+G+  T W+ G EVCAL
Sbjct: 29  EVVIKVAAAGVNRADVLQAAGKYPPPPGASEIIGMEVSGTITDIGDGVTEWSAGQEVCAL 88

Query: 95  VNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGG 154
           + GGGYAEY     G  LP+P G + I AA+LPE   TVW+NL  TA+L  GQ VLIHGG
Sbjct: 89  LAGGGYAEYVAVPAGQVLPMPPGVSLIDAAALPEVACTVWSNLVMTAHLGPGQLVLIHGG 148

Query: 155 SSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRG 214
           + GIG+ AIQ+ +  GA V  TA S EK      LGA+  INY  EDF+  L++ET G G
Sbjct: 149 ACGIGSHAIQVCTALGARVAVTAGSSEKLQLSRDLGAQITINYRDEDFVARLKQETDGSG 208

Query: 215 IDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR 274
            D+ILD++GA YL++++  L+ +G+L+II   GG I  E+NL  +++KR  + G+TLR R
Sbjct: 209 ADVILDIMGAAYLDRNVDALAVDGQLVIIGMQGG-IKAELNLGKLLTKRARVIGTTLRAR 267

Query: 275 ---TDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                  K  I  ++   +WP++ S+ + P+I + LP+G+ A AH ++   +  GKI+L
Sbjct: 268 PLQGPNGKAVIAQAVTASVWPMIASNRVRPIIGSRLPIGQAAQAHQLLLSGQSYGKILL 326


>gi|304394101|ref|ZP_07376024.1| quinone oxidoreductase [Ahrensia sp. R2A130]
 gi|303293541|gb|EFL87918.1| quinone oxidoreductase [Ahrensia sp. R2A130]
          Length = 336

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 134/330 (40%), Positives = 204/330 (61%), Gaps = 5/330 (1%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           MP+   M+ + +  +G   ++   E  +P P   E+L+KV A GVN PD++QR+G YPPP
Sbjct: 10  MPLPDTMKTIEIREHGGPEMLEAGERQLPTPAAGEVLVKVIAAGVNGPDIVQRRGHYPPP 69

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K A+ +LGLEV+G++V LG+    W +GD++CAL NGGGYAEY        LPIP+G + 
Sbjct: 70  KGASDLLGLEVSGEVVALGDGVERWKVGDKICALTNGGGYAEYVTIAADQCLPIPQGVDP 129

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           + AA L E+ FTVW+N F       G   L+HGG+ GIG+TAIQL +  G  ++TT  + 
Sbjct: 130 VDAAGLCETLFTVWSNFFTNHAADKGLLFLVHGGAGGIGSTAIQLGAAVGMRIFTTCSAA 189

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
           +K   C  LGA  AI+YL+EDF+EI++ +    G ++ILD+ G  Y+ +++   + +G++
Sbjct: 190 DKAF-CESLGATRAIDYLEEDFVEIVKADG---GANLILDIRGGGYVARNIAASAPDGRI 245

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + ++F  G+   E+NL P++ KR+TITGSTLR R    K  +   L+  +WP     ++ 
Sbjct: 246 VQLAFNAGS-KVEVNLMPVMLKRLTITGSTLRPRPPEFKAKMASELERFVWPWFAKDMMK 304

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                 +P+ +   AH++ME  EH GKIIL
Sbjct: 305 TNTFATVPMRQAQRAHEMMEAGEHRGKIIL 334


>gi|297158843|gb|ADI08555.1| quinone oxidoreductase [Streptomyces bingchenggensis BCW-1]
          Length = 325

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 141/315 (44%), Positives = 205/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  + +  AE P P P + E+L+ + A GVNR D++QR+G YPPP  A    GLE +G+I
Sbjct: 10  GGPDALVWAEVPDPVPGEGEVLVDIAAAGVNRADLLQRQGHYPPPPGAPDHPGLECSGRI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
             LG   + W +GDEVCAL+ GGGYAE      G  LP+P G + + AA LPE   TVW+
Sbjct: 70  AALGPGVSGWAVGDEVCALLAGGGYAEKVAVPAGQVLPVPPGLDLVTAAGLPEVAATVWS 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  ++LR G+T+L+HGGSSGIGT AIQLA   GA V  TA S EK  AC +LGA   I
Sbjct: 130 NVFMLSHLRPGETLLVHGGSSGIGTMAIQLAKAVGARVAVTAGSAEKLAACRELGADIPI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           +Y ++DF+E ++  T+G G D+ILD+VGA+YL +++  L+  G+L II   GG  A E+N
Sbjct: 190 DYHEQDFVEEVRTATEGAGADVILDIVGAKYLARNVAALATNGRLAIIGLQGGAKA-ELN 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L  +++KR  +  ++LR R    K +I  +++  +WPL+ S  + P++   +P+ + A A
Sbjct: 249 LGALLAKRGAVMVTSLRARPLAEKAAIVAAVREHVWPLVESGRVRPIVDRTIPMREAAEA 308

Query: 316 HDIMEKSEHIGKIIL 330
           H ++E+S HIGK++L
Sbjct: 309 HRVLEQSGHIGKVLL 323


>gi|225628837|ref|ZP_03786871.1| alcohol dehydrogenase, zinc-containing protein [Brucella ceti str.
           Cudo]
 gi|261217017|ref|ZP_05931298.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           ceti M13/05/1]
 gi|261313535|ref|ZP_05952732.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           pinnipedialis M163/99/10]
 gi|261319227|ref|ZP_05958424.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           pinnipedialis B2/94]
 gi|261319887|ref|ZP_05959084.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           ceti M644/93/1]
 gi|225616683|gb|EEH13731.1| alcohol dehydrogenase, zinc-containing protein [Brucella ceti str.
           Cudo]
 gi|260922106|gb|EEX88674.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           ceti M13/05/1]
 gi|261292577|gb|EEX96073.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           ceti M644/93/1]
 gi|261298450|gb|EEY01947.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           pinnipedialis B2/94]
 gi|261302561|gb|EEY06058.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           pinnipedialis M163/99/10]
          Length = 347

 Score =  275 bits (703), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 206/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+ L    +P  ++ E+ ++V A GVNRPD MQR G YPPP     +LGLE++G +
Sbjct: 26  GGPEVLELVPRELPALKRGEMRVRVHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVV 85

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +++ E+ T +  GD + ALV GG Y+E  +      +P+P G + ++AA +PE++FTVW+
Sbjct: 86  LEIAEDVTRFGPGDRIMALVAGGAYSEEAIVQADVCIPVPAGLSMVEAAGIPETYFTVWS 145

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ A L+ G+TVL+HGG+SGIG TA  LA   GA + TT  S++KC A   LGA  +I
Sbjct: 146 NLFQRAGLQPGETVLLHGGTSGIGVTATLLAKAIGARMITTCGSDDKCRASEALGAIASI 205

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF+E  +  T+GRG ++++DMVG  Y+ ++L L++++G++  I+F  G+ A +++
Sbjct: 206 NYRTTDFVEAGRALTEGRGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMD 264

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+T+TGSTLR R  + K ++  S++ ++ PL+ +    PVI +V  L  V  A
Sbjct: 265 MGPLLFKRLTLTGSTLRARPLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAA 324

Query: 316 HDIMEKSEHIGKIIL 330
           H  +E S H GKIIL
Sbjct: 325 HAHLEASAHTGKIIL 339


>gi|302753876|ref|XP_002960362.1| hypothetical protein SELMODRAFT_73697 [Selaginella moellendorffii]
 gi|300171301|gb|EFJ37901.1| hypothetical protein SELMODRAFT_73697 [Selaginella moellendorffii]
          Length = 325

 Score =  275 bits (703), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 202/326 (61%), Gaps = 1/326 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V   G G   V+ L E P P    +E+LIKV A GVNR D++Q KG +PPP  A P 
Sbjct: 1   MRAVVAKGLGGPEVLELREVPDPDIGDDEVLIKVAAAGVNRADLLQLKGQHPPPPGAPPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I  LG     W +GDEVCAL+ GGGYAE         LPIP+G +   AASL
Sbjct: 61  LGLECSGVIERLGARVDGWKVGDEVCALLGGGGYAEKVAVAASQLLPIPRGVSLRDAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F   +L +G++VLIHGGSSGIGT AIQ+A   GA V  TA SE+K   C
Sbjct: 121 PEVACTVWSTVFMACHLSAGESVLIHGGSSGIGTFAIQMAKSIGAQVLATAGSEKKLDLC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+ AINY  +DF+  +++ T G G+D+ILDMVGA Y  ++L  L  +G+L II F 
Sbjct: 181 KQLGAEVAINYKDDDFVARVKEATHGEGVDVILDMVGASYFERNLEALGMDGRLFIIGFQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  + +++L PI+ KR+ ++ + LR R   +K  I   +   +WP +    + PVI+ V
Sbjct: 241 GGA-SGQLSLLPILKKRLIVSAAGLRTRAPESKAQIVAEVWQNVWPAVEEGKVKPVIYRV 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILLP 332
            PL + A A  +M  ++H GKI+L P
Sbjct: 300 FPLEEAAQALQLMVANQHFGKILLTP 325


>gi|116669245|ref|YP_830178.1| alcohol dehydrogenase [Arthrobacter sp. FB24]
 gi|116609354|gb|ABK02078.1| Alcohol dehydrogenase, zinc-binding domain protein [Arthrobacter
           sp. FB24]
          Length = 327

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 148/327 (45%), Positives = 204/327 (62%), Gaps = 3/327 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +S  G   V+ + E P P P   E+LI V A G+NR DV QR+G YPPP  A+ I
Sbjct: 1   MKAVYVSEAGGPEVLEVREVPAPVPGPGEVLIDVVAAGLNRADVQQRRGFYPPPPGASEI 60

Query: 67  LGLEVAGKIVDLGENTTH-WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           LGLEV+G+I   G + +  +++GD V AL+ GGGYA+         L IP G + + AAS
Sbjct: 61  LGLEVSGRIAGFGPDVSKPFSVGDRVVALLAGGGYAQQVAVPAEQVLRIPDGVDLVTAAS 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC-L 184
           LPE   TV++NL  TA L+ G+TVLIHG + GIGT AIQLA  FGA V TTA + EK   
Sbjct: 121 LPEVAATVYSNLIMTAQLQPGETVLIHGATGGIGTMAIQLAKAFGAIVATTAGTAEKVGT 180

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           A   LGA  AINY +EDF E L+ +  G G D+ILD+VGA+YL Q++  L+  G+LI+I 
Sbjct: 181 AKAFLGADIAINYTEEDFPEALRAQNGGHGADVILDVVGAKYLRQNVDALADYGRLIVIG 240

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
             GG  A E++L  ++SKR  I G+ LR R    K  I ++++  +WPLL    I P++ 
Sbjct: 241 LQGGTKA-ELDLGKLLSKRAAIIGTALRPRPVAEKGVIMNAVREAVWPLLADGRIRPLVA 299

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIILL 331
              PL +V  AH+  +  +H+GK++L+
Sbjct: 300 RTFPLDQVRAAHEYFDSGDHVGKVLLV 326


>gi|239930121|ref|ZP_04687074.1| quinone oxidoreductase [Streptomyces ghanaensis ATCC 14672]
 gi|291438460|ref|ZP_06577850.1| quinone oxidoreductase [Streptomyces ghanaensis ATCC 14672]
 gi|291341355|gb|EFE68311.1| quinone oxidoreductase [Streptomyces ghanaensis ATCC 14672]
          Length = 327

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 201/316 (63%), Gaps = 1/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G    +   E P P P + E+L++V A  VNR D++QR+G Y PP  A+P  GLE +G+I
Sbjct: 10  GGPEALVWDEVPDPVPGEGEVLVEVVAGAVNRADILQRQGFYDPPPGASPYPGLECSGRI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
             +G     W +GDEVCAL+ GGGYAE      G  LP+P G +  +AA+LPE   TVW+
Sbjct: 70  AAVGPGVGGWAVGDEVCALLAGGGYAEKVAVPAGQLLPVPAGLDLKRAAALPEVVCTVWS 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  A+LR G+T+L+HGGSSGIGT AIQLA   GA V  TA ++EK   C +LGA   I
Sbjct: 130 NVFMVAHLRPGETLLVHGGSSGIGTMAIQLAKAVGARVAVTAGTKEKLGRCAELGADILI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY ++DF+  L++ T G G D+ILD +GA+YL++++  L+  G+L II   GG +  E++
Sbjct: 190 NYREQDFVAELERATDGAGADVILDNMGAKYLDRNVRALAVNGRLAIIGMQGG-VKGELD 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           +  ++ KR  I+ ++LR R    K +I  +++  +WPL+    + PV+   +P+   A A
Sbjct: 249 IGALLRKRAAISATSLRARPLEEKAAIVAAVREHVWPLVADGHVRPVVDREIPMPDAAAA 308

Query: 316 HDIMEKSEHIGKIILL 331
           H ++E S HIGK++L+
Sbjct: 309 HRVVEDSGHIGKVLLV 324


>gi|23500144|ref|NP_699584.1| alcohol dehydrogenase [Brucella suis 1330]
 gi|161620463|ref|YP_001594349.1| PIG3 family NAD(P)H quinone oxidoreductase [Brucella canis ATCC
           23365]
 gi|163844566|ref|YP_001622221.1| zinc-binding alcohol dehydrogenase [Brucella suis ATCC 23445]
 gi|254702786|ref|ZP_05164614.1| zinc-binding alcohol dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|260568305|ref|ZP_05838774.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           suis bv. 4 str. 40]
 gi|23463741|gb|AAN33589.1| alcohol dehydrogenase, zinc-containing [Brucella suis 1330]
 gi|161337274|gb|ABX63578.1| NAD(P)H quinone oxidoreductase, PIG3 family [Brucella canis ATCC
           23365]
 gi|163675289|gb|ABY39399.1| Alcohol dehydrogenase, zinc-binding [Brucella suis ATCC 23445]
 gi|260154970|gb|EEW90051.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           suis bv. 4 str. 40]
          Length = 335

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 206/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+ L    +P  ++ E+ ++V A GVNRPD MQR G YPPP     +LGLE++G +
Sbjct: 14  GGPEVLELVPRELPALKRGEMRVRVHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVV 73

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +++ E+ T +  GD + ALV GG Y+E  +      +P+P G + ++AA +PE++FTVW+
Sbjct: 74  LEIAEDVTRFGPGDRIMALVAGGAYSEEAIVQADVCIPVPAGLSMVEAAGIPETYFTVWS 133

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ A L+ G+TVL+HGG+SGIG TA  LA   GA + TT  S++KC A   LGA  +I
Sbjct: 134 NLFQHAGLQPGETVLLHGGTSGIGVTATLLAKAIGARMITTCGSDDKCRASEALGAIASI 193

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF+E  +  T+GRG ++++DMVG  Y+ ++L L++++G++  I+F  G+ A +++
Sbjct: 194 NYRTTDFVEAGRALTEGRGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMD 252

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+T+TGSTLR R  + K ++  S++ ++ PL+ +    PVI +V  L  V  A
Sbjct: 253 MGPLLFKRLTLTGSTLRARPLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAA 312

Query: 316 HDIMEKSEHIGKIIL 330
           H  +E S H GKIIL
Sbjct: 313 HAHLEASAHTGKIIL 327


>gi|256157914|ref|ZP_05455832.1| quinone oxidoreductase [Brucella ceti M490/95/1]
 gi|256253125|ref|ZP_05458661.1| quinone oxidoreductase [Brucella ceti B1/94]
 gi|261220230|ref|ZP_05934511.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           ceti B1/94]
 gi|265996424|ref|ZP_06108981.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           ceti M490/95/1]
 gi|260918814|gb|EEX85467.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           ceti B1/94]
 gi|262550721|gb|EEZ06882.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           ceti M490/95/1]
          Length = 335

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 206/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+ L    +P  ++ E+ ++V A GVNRPD MQR G YPPP     +LGLE++G +
Sbjct: 14  GGPEVLELVPRELPALKRGEMRVRVHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVV 73

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +++ E+ T +  GD + ALV GG Y+E  +      +P+P G + ++AA +PE++FTVW+
Sbjct: 74  LEIAEDVTRFGPGDRIMALVAGGAYSEEAIVQADVCIPVPAGLSMVEAAGIPETYFTVWS 133

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ A L+ G+TVL+HGG+SGIG TA  LA   GA + TT  S++KC A   LGA  +I
Sbjct: 134 NLFQRAGLQPGETVLLHGGTSGIGVTATLLAKAIGARMITTCGSDDKCRASEALGAIVSI 193

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF+E  +  T+GRG ++++DMVG  Y+ ++L L++++G++  I+F  G+ A +++
Sbjct: 194 NYRTTDFVEAGRALTEGRGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMD 252

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+T+TGSTLR R  + K ++  S++ ++ PL+ +    PVI +V  L  V  A
Sbjct: 253 MGPLLFKRLTLTGSTLRARPLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAA 312

Query: 316 HDIMEKSEHIGKIIL 330
           H  +E S H GKIIL
Sbjct: 313 HAHLEASAHTGKIIL 327


>gi|17989221|ref|NP_541854.1| quinone oxidoreductase [Brucella melitensis bv. 1 str. 16M]
 gi|17985079|gb|AAL54118.1| quinone oxidoreductase [Brucella melitensis bv. 1 str. 16M]
          Length = 346

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 206/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+ L    +P  ++ E+ +++ A GVNRPD MQR G YPPP     +LGLE++G +
Sbjct: 25  GGPEVLELVPRELPALKRGEMRVRIHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVV 84

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +++ E+ T +  GD + ALV GG Y+E  +      +P+P G + ++AA +PE++FTVW+
Sbjct: 85  LEIAEDVTRFGPGDRIMALVAGGAYSEEAIVQADVCIPVPAGLSMVEAAGIPETYFTVWS 144

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ A L+ G+TVL+HGG+SGIG TA  LA   GA + TT  S++KC A   LGA  +I
Sbjct: 145 NLFQRAGLQPGETVLLHGGTSGIGVTATLLAKAIGARMITTCGSDDKCRASEALGAIASI 204

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF+E  +  T+GRG ++++DMVG  Y+ ++L L++++G++  I+F  G+ A +++
Sbjct: 205 NYRTTDFVEAGRALTEGRGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMD 263

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+T+TGSTLR R  + K ++  S++ ++ PL+ +    PVI +V  L  V  A
Sbjct: 264 MGPLLFKRLTLTGSTLRARPLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAA 323

Query: 316 HDIMEKSEHIGKIIL 330
           H  +E S H GKIIL
Sbjct: 324 HAHLEASAHTGKIIL 338


>gi|62317711|ref|YP_223564.1| alcohol dehydrogenase [Brucella abortus bv. 1 str. 9-941]
 gi|83269694|ref|YP_418985.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           melitensis biovar Abortus 2308]
 gi|189022968|ref|YP_001932709.1| Zinc-containing alcohol dehydrogenase superfamily [Brucella abortus
           S19]
 gi|225686206|ref|YP_002734178.1| quinone oxidoreductase, PIG3 family protein [Brucella melitensis
           ATCC 23457]
 gi|254691215|ref|ZP_05154469.1| quinone oxidoreductase, PIG3 family protein [Brucella abortus bv. 6
           str. 870]
 gi|254695481|ref|ZP_05157309.1| quinone oxidoreductase, PIG3 family protein [Brucella abortus bv. 3
           str. Tulya]
 gi|254699001|ref|ZP_05160829.1| quinone oxidoreductase, PIG3 family protein [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254732448|ref|ZP_05191026.1| quinone oxidoreductase, PIG3 family protein [Brucella abortus bv. 4
           str. 292]
 gi|256043287|ref|ZP_05446222.1| quinone oxidoreductase, PIG3 family protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256256402|ref|ZP_05461938.1| quinone oxidoreductase, PIG3 family protein [Brucella abortus bv. 9
           str. C68]
 gi|256262668|ref|ZP_05465200.1| zinc-containing alcohol dehydrogenase [Brucella melitensis bv. 2
           str. 63/9]
 gi|260544953|ref|ZP_05820774.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           abortus NCTC 8038]
 gi|260564495|ref|ZP_05834980.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           melitensis bv. 1 str. 16M]
 gi|260882634|ref|ZP_05894248.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           abortus bv. 9 str. C68]
 gi|265989711|ref|ZP_06102268.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|62197904|gb|AAX76203.1| alcohol dehydrogenase, zinc-containing [Brucella abortus bv. 1 str.
           9-941]
 gi|82939968|emb|CAJ12997.1| Zinc-containing alcohol dehydrogenase superfamily [Brucella
           melitensis biovar Abortus 2308]
 gi|189021542|gb|ACD74263.1| Zinc-containing alcohol dehydrogenase superfamily [Brucella abortus
           S19]
 gi|225642311|gb|ACO02224.1| quinone oxidoreductase, PIG3 family protein [Brucella melitensis
           ATCC 23457]
 gi|260098224|gb|EEW82098.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           abortus NCTC 8038]
 gi|260152138|gb|EEW87231.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           melitensis bv. 1 str. 16M]
 gi|260872162|gb|EEX79231.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           abortus bv. 9 str. C68]
 gi|263000380|gb|EEZ13070.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263092454|gb|EEZ16707.1| zinc-containing alcohol dehydrogenase [Brucella melitensis bv. 2
           str. 63/9]
          Length = 335

 Score =  275 bits (702), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 206/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+ L    +P  ++ E+ +++ A GVNRPD MQR G YPPP     +LGLE++G +
Sbjct: 14  GGPEVLELVPRELPALKRGEMRVRIHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVV 73

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +++ E+ T +  GD + ALV GG Y+E  +      +P+P G + ++AA +PE++FTVW+
Sbjct: 74  LEIAEDVTRFGPGDRIMALVAGGAYSEEAIVQADVCIPVPAGLSMVEAAGIPETYFTVWS 133

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ A L+ G+TVL+HGG+SGIG TA  LA   GA + TT  S++KC A   LGA  +I
Sbjct: 134 NLFQRAGLQPGETVLLHGGTSGIGVTATLLAKAIGARMITTCGSDDKCRASEALGAIASI 193

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF+E  +  T+GRG ++++DMVG  Y+ ++L L++++G++  I+F  G+ A +++
Sbjct: 194 NYRTTDFVEAGRALTEGRGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMD 252

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+T+TGSTLR R  + K ++  S++ ++ PL+ +    PVI +V  L  V  A
Sbjct: 253 MGPLLFKRLTLTGSTLRARPLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAA 312

Query: 316 HDIMEKSEHIGKIIL 330
           H  +E S H GKIIL
Sbjct: 313 HAHLEASAHTGKIIL 327


>gi|237817256|ref|ZP_04596248.1| NAD(P)H quinone oxidoreductase, PIG3 family [Brucella abortus str.
           2308 A]
 gi|260756817|ref|ZP_05869165.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           abortus bv. 6 str. 870]
 gi|260760248|ref|ZP_05872596.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           abortus bv. 4 str. 292]
 gi|260763486|ref|ZP_05875818.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|261215869|ref|ZP_05930150.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           abortus bv. 3 str. Tulya]
 gi|297249760|ref|ZP_06933461.1| NADPH2:quinone reductase [Brucella abortus bv. 5 str. B3196]
 gi|237788069|gb|EEP62285.1| NAD(P)H quinone oxidoreductase, PIG3 family [Brucella abortus str.
           2308 A]
 gi|260670566|gb|EEX57506.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           abortus bv. 4 str. 292]
 gi|260673907|gb|EEX60728.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|260676925|gb|EEX63746.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           abortus bv. 6 str. 870]
 gi|260917476|gb|EEX84337.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           abortus bv. 3 str. Tulya]
 gi|297173629|gb|EFH32993.1| NADPH2:quinone reductase [Brucella abortus bv. 5 str. B3196]
          Length = 347

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 206/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+ L    +P  ++ E+ +++ A GVNRPD MQR G YPPP     +LGLE++G +
Sbjct: 26  GGPEVLELVPRELPALKRGEMRVRIHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVV 85

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +++ E+ T +  GD + ALV GG Y+E  +      +P+P G + ++AA +PE++FTVW+
Sbjct: 86  LEIAEDVTRFGPGDRIMALVAGGAYSEEAIVQADVCIPVPAGLSMVEAAGIPETYFTVWS 145

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ A L+ G+TVL+HGG+SGIG TA  LA   GA + TT  S++KC A   LGA  +I
Sbjct: 146 NLFQRAGLQPGETVLLHGGTSGIGVTATLLAKAIGARMITTCGSDDKCRASEALGAIASI 205

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF+E  +  T+GRG ++++DMVG  Y+ ++L L++++G++  I+F  G+ A +++
Sbjct: 206 NYRTTDFVEAGRALTEGRGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMD 264

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+T+TGSTLR R  + K ++  S++ ++ PL+ +    PVI +V  L  V  A
Sbjct: 265 MGPLLFKRLTLTGSTLRARPLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAA 324

Query: 316 HDIMEKSEHIGKIIL 330
           H  +E S H GKIIL
Sbjct: 325 HAHLEASAHTGKIIL 339


>gi|261753385|ref|ZP_05997094.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           suis bv. 3 str. 686]
 gi|261743138|gb|EEY31064.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           suis bv. 3 str. 686]
          Length = 347

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 206/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+ L    +P  ++ E+ ++V A GVNRPD MQR G YPPP     +LGLE++G +
Sbjct: 26  GGPEVLELVPRELPALKRGEMRVRVHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVV 85

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +++ E+ T +  GD + ALV GG Y+E  +      +P+P G + ++AA +PE++FTVW+
Sbjct: 86  LEIAEDVTRFGPGDRIMALVAGGAYSEEAIVQADVCIPVPAGLSMVEAAGIPETYFTVWS 145

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ A L+ G+TVL+HGG+SGIG TA  LA   GA + TT  S++KC A   LGA  +I
Sbjct: 146 NLFQHAGLQPGETVLLHGGTSGIGVTATLLAKAIGARMITTCGSDDKCRASEALGAIASI 205

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF+E  +  T+GRG ++++DMVG  Y+ ++L L++++G++  I+F  G+ A +++
Sbjct: 206 NYRTTDFVEAGRALTEGRGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMD 264

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+T+TGSTLR R  + K ++  S++ ++ PL+ +    PVI +V  L  V  A
Sbjct: 265 MGPLLFKRLTLTGSTLRARPLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAA 324

Query: 316 HDIMEKSEHIGKIIL 330
           H  +E S H GKIIL
Sbjct: 325 HAHLEASAHTGKIIL 339


>gi|329890359|ref|ZP_08268702.1| NADPH quinone oxidoreductase, PIG3 family protein [Brevundimonas
           diminuta ATCC 11568]
 gi|328845660|gb|EGF95224.1| NADPH quinone oxidoreductase, PIG3 family protein [Brevundimonas
           diminuta ATCC 11568]
          Length = 323

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 197/320 (61%), Gaps = 4/320 (1%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
           +G G ++ + L   P+P P   EI I+V A GVNRPD++QR+G YPPP  A+ ILGLEVA
Sbjct: 8   NGRGPADALRLTTRPLPAPGPGEIRIRVRAAGVNRPDIVQREGRYPPPPGASDILGLEVA 67

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G++  L +  + W +GD VCAL+ GGGYAEY L    H LPIP G +  QAA+LPE+ FT
Sbjct: 68  GEVDALADGVSRWAVGDRVCALLGGGGYAEYALVDARHALPIPDGLDFTQAAALPETAFT 127

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
           V+AN+F+   L++G+T+LIHG +SGIG  AIQ+A   GA V  T++   K  A   LGA 
Sbjct: 128 VFANVFEGGGLKAGETLLIHGATSGIGVMAIQMAKAAGARVIATSRGAAKAEAARALGAD 187

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            +++  + D    +Q   +  G D++LDMVGA Y   +L  L   G+ ++I+ L G  A 
Sbjct: 188 FSLDATEHDLAAAIQ---EAGGADVVLDMVGAAYAELNLNALKPGGRWVVIATLTGAKA- 243

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           EI+L  I+ KRI +TGSTLR R    K  +  +++  +WP + S  +   +    PL + 
Sbjct: 244 EIDLMRIMLKRIVLTGSTLRSRPADEKARLAAAVEATVWPWVASGAVRAQVEATFPLAEA 303

Query: 313 AMAHDIMEKSEHIGKIILLP 332
             AH  +E   H+GK++LLP
Sbjct: 304 DAAHAHLEAGAHVGKVVLLP 323


>gi|256059394|ref|ZP_05449596.1| quinone oxidoreductase, PIG3 family protein [Brucella neotomae
           5K33]
 gi|261323355|ref|ZP_05962552.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           neotomae 5K33]
 gi|261299335|gb|EEY02832.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           neotomae 5K33]
          Length = 335

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 205/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+ L    +P  ++ E+ ++V A GVNRPD MQR G YPPP     +LGLE++G +
Sbjct: 14  GGPEVLELVPRELPALKRGEMRVRVHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVV 73

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +++ E+ T +  GD + ALV GG Y+E  +      +P+P G + ++AA +PE++FTVW+
Sbjct: 74  LEIAEDVTRFGPGDRIMALVAGGAYSEEAIVQADVCIPVPAGLSMVEAAGIPETYFTVWS 133

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ A L+ G+TVL+HGG+SGIG TA  LA   GA + TT  S++KC A   LGA  +I
Sbjct: 134 NLFQRAGLQPGETVLLHGGTSGIGVTATLLAKAIGARMITTCGSDDKCRASEALGAIASI 193

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF+E  +  T+GRG ++++DMVG  Y+ ++L L++++G++  I+F  G+ A +++
Sbjct: 194 NYRTTDFVEAGRALTEGRGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMD 252

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+T+TGSTLR R  + K ++  S++ ++ P + +    PVI +V  L  V  A
Sbjct: 253 MGPLLFKRLTLTGSTLRARPLVMKAALARSVEAEVLPFVLNKGARPVIDSVFDLADVQAA 312

Query: 316 HDIMEKSEHIGKIIL 330
           H  +E S H GKIIL
Sbjct: 313 HAHLEASAHTGKIIL 327


>gi|300782177|ref|YP_003762468.1| NADPH:quinone reductase and related Zn-dependent oxidoreductase
           [Amycolatopsis mediterranei U32]
 gi|299791691|gb|ADJ42066.1| NADPH:quinone reductase and related Zn-dependent oxidoreductase
           [Amycolatopsis mediterranei U32]
          Length = 325

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 135/315 (42%), Positives = 203/315 (64%), Gaps = 3/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  +V+  AE   P+P   E+L++V A  VNR D++QR+G YPPP  A+  LGLE +G I
Sbjct: 10  GDPDVLEWAEVADPRPGPGEVLLEVAASAVNRADLLQRQGQYPPPPGASETLGLECSGTI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
            +LGE    WN+GDEVCAL++GGGYAE  +   G  LP+P   + + AA+LPE   TVWA
Sbjct: 70  AELGEGVEDWNVGDEVCALLSGGGYAEKAVVPAGQLLPVPGEIDLLTAAALPEVACTVWA 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+   A L  G+ +L+HGG+ GIGT AIQ+    GATV  TA S E+  +C +LGA   I
Sbjct: 130 NVVMHAKLTEGEVLLVHGGAGGIGTHAIQVGKALGATVAVTAGSPERLESCRQLGADITI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           +Y +EDF+E+L+KET   G ++ILD +GA YL +++  L ++G+L+II   GG +  E+N
Sbjct: 190 DYKEEDFVEVLKKETG--GANVILDNMGAAYLGRNVDALQQDGRLVIIGMQGG-VKGELN 246

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           +  ++ KR ++  + LR R    K +I   ++ ++WPL+   ++ P++  V+P+ + A A
Sbjct: 247 VGALLGKRASVFAAGLRFRPLDQKAAIVGDVRDRLWPLVAEGLVKPIVGQVVPMAEAATA 306

Query: 316 HDIMEKSEHIGKIIL 330
           H IME+    GK++L
Sbjct: 307 HRIMEEGSVFGKVLL 321


>gi|307331253|ref|ZP_07610377.1| NAD(P)H quinone oxidoreductase, PIG3 family [Streptomyces
           violaceusniger Tu 4113]
 gi|306883131|gb|EFN14193.1| NAD(P)H quinone oxidoreductase, PIG3 family [Streptomyces
           violaceusniger Tu 4113]
          Length = 325

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 205/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G    +  AE P P P + E+L+ V A GVNR DV+QR+G+YPPP  A P  GLE +G+I
Sbjct: 10  GGPEALVWAEVPDPVPGEGEVLVDVAAAGVNRADVLQRQGVYPPPPGAAPYPGLECSGRI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
             LG   T W +GDEVCAL+ GGGYAE  +   G  LPIP+G + + AA+LPE   TVW+
Sbjct: 70  SALGPGVTGWAVGDEVCALLAGGGYAEKVVVPSGQLLPIPEGVDLVTAAALPEVTATVWS 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  ++LR G+T+L HGGSSGIGT AIQLA   GA V  TA   EK  AC +LGA   I
Sbjct: 130 NVFMISHLRPGETLLAHGGSSGIGTMAIQLAKAVGARVAVTAGGPEKLAACRELGADVLI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           +Y ++DF+E +++ T G G D+ILD+VGA+YL +++  L+  G+L II   GG  A E+N
Sbjct: 190 DYREQDFVEEVRRATDGVGADVILDIVGAKYLARNVETLATNGRLAIIGLQGGAKA-ELN 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L  +++K   +T + LR R+   K +I  ++Q  +WPL+    + PV++  +P+     A
Sbjct: 249 LASLLAKSAAVTATGLRGRSPAQKAAIIAAVQEHVWPLIAGGRVRPVVYRTIPMRDAPEA 308

Query: 316 HDIMEKSEHIGKIIL 330
           H ++E SEH+GKI+L
Sbjct: 309 HRLLESSEHVGKILL 323


>gi|87198090|ref|YP_495347.1| alcohol dehydrogenase [Novosphingobium aromaticivorans DSM 12444]
 gi|87133771|gb|ABD24513.1| alcohol dehydrogenase superfamily, zinc-containing [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 333

 Score =  272 bits (696), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 199/303 (65%), Gaps = 1/303 (0%)

Query: 28  IPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNI 87
           +PQP   ++L+KV   GVNRPDV+QR+G YPPP +A+P+ GLE+AG++V +G+  T   I
Sbjct: 29  VPQPGPGQVLVKVAFAGVNRPDVIQRQGFYPPPPDASPLPGLEIAGQVVAMGQGVTWPFI 88

Query: 88  GDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQ 147
           G  VCALV GGGYAEYC++     L +P G    QAA++PE+ FTVW N+F+   +  G+
Sbjct: 89  GTAVCALVAGGGYAEYCIAEADQCLQVPTGLPMAQAAAMPETLFTVWHNVFERGMVAEGE 148

Query: 148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQ 207
           T+L+HGG+SGIG+ AI L   FG  V  T    EKC   L +GA HAI+Y   DF+E   
Sbjct: 149 TILVHGGTSGIGSMAILLGKLFGVKVIATCGGPEKCEQALAIGAAHAIDYKAADFVEETL 208

Query: 208 KETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITIT 267
           + T+GRG+ ++LDMV  +Y+ ++L  L+ +G+ + I+  GG +  EIN+  ++ +R+T+T
Sbjct: 209 RLTEGRGVHMVLDMVAGDYVARNLKCLADDGRHVTIAVQGG-VRAEINMAEVMRRRLTLT 267

Query: 268 GSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGK 327
           GSTLR R+   K ++   ++  +WPL+    + P++    PL + A AH  ME+  HIGK
Sbjct: 268 GSTLRPRSRAFKGALASEIRDTVWPLVVEGALRPIMDQTFPLAEAAAAHVRMEQGAHIGK 327

Query: 328 IIL 330
           I+L
Sbjct: 328 IVL 330


>gi|294853798|ref|ZP_06794470.1| NADPH2:quinone reductase [Brucella sp. NVSL 07-0026]
 gi|294819453|gb|EFG36453.1| NADPH2:quinone reductase [Brucella sp. NVSL 07-0026]
          Length = 347

 Score =  272 bits (696), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 205/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+ L    +P  ++ E+ ++V A GVNRPD MQR G YPPP     +LGLE++G +
Sbjct: 26  GGPEVLELVPRELPALKRGEMRVRVHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVV 85

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +++ E+ T +   D + ALV GG Y+E  +      +P+P G + ++AA +PE++FTVW+
Sbjct: 86  LEIAEDVTRFGPDDRIMALVAGGAYSEEAIVQADVCIPVPAGLSMVEAAGIPETYFTVWS 145

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ A L+ G+TVL+HGG+SGIG TA  LA   GA + TT  S++KC A   LGA  +I
Sbjct: 146 NLFQRAGLQPGETVLLHGGTSGIGVTATLLAKAIGARMITTCGSDDKCRASEALGAIASI 205

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF+E  +  T+GRG ++++DMVG  Y+ ++L L++++G++  I+F  G+ A +++
Sbjct: 206 NYRTTDFVEAGRALTEGRGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMD 264

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+T+TGSTLR R  + K ++  S++ ++ PL+ +    PVI +V  L  V  A
Sbjct: 265 MGPLLFKRLTLTGSTLRARPLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAA 324

Query: 316 HDIMEKSEHIGKIIL 330
           H  +E S H GKIIL
Sbjct: 325 HAHLEASAHTGKIIL 339


>gi|119474800|ref|ZP_01615153.1| quinone oxidoreductase [marine gamma proteobacterium HTCC2143]
 gi|119451003|gb|EAW32236.1| quinone oxidoreductase [marine gamma proteobacterium HTCC2143]
          Length = 357

 Score =  272 bits (696), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 194/306 (63%), Gaps = 7/306 (2%)

Query: 25  ESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTH 84
           E PIPQ Q +E+LIKV   GVNR D+MQR+GLYPPP +A+P++GLEV+G ++ +G     
Sbjct: 52  EQPIPQLQADEVLIKVCGAGVNRGDLMQRQGLYPPPADASPVMGLEVSGIVIAVGAAVND 111

Query: 85  WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLR 144
            +IGD +CAL +G GY EY        + +P   + + AA+LPE+ FTVW N+FQ  +L 
Sbjct: 112 RSIGDRICALTHGAGYCEYTTVPASQCIAVPDSVSLLDAAALPEALFTVWHNVFQRCSLT 171

Query: 145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLE 204
           +G+TVLIHGGSSGIGT AIQ+A   GAT+Y TA ++EKC  C  LGA   +NY   DF  
Sbjct: 172 AGETVLIHGGSSGIGTMAIQMAKVIGATIYATAGTDEKCALCEALGASKTVNYKTGDF-- 229

Query: 205 ILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRI 264
               ET+   +++ILDM G ++  +++ LL+ +G++  I+ + G    +IN  P++ KR+
Sbjct: 230 ----ETELPPVNVILDMAGGDFFQKNINLLAPDGRVSTIAMVRG-FQADINFLPMMVKRL 284

Query: 265 TITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEH 324
            ITGST+R ++   K  +   +   I P + S  I PVI ++  L  V  AH+ M   EH
Sbjct: 285 IITGSTMRPQSFANKAQMALEISEHIMPAIVSGEIKPVIDSIYALSDVEKAHERMGSGEH 344

Query: 325 IGKIIL 330
            GK+IL
Sbjct: 345 AGKVIL 350


>gi|170782164|ref|YP_001710497.1| putative alcohol dehydrogenase [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169156733|emb|CAQ01895.1| putative alcohol dehydrogenase [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 325

 Score =  272 bits (696), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 138/324 (42%), Positives = 200/324 (61%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR +     G  +V+ L E P P     E+LI+V A GVNR D+ QR+G YPPP  A   
Sbjct: 1   MRAITFPSPGSPDVLSLTELPDPVAGPGEVLIRVAAAGVNRADLSQREGAYPPPAGAPTH 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEV+G +  +G+  T W++GD VCAL+ GGGYAE     + H LP+P   + +QAA L
Sbjct: 61  LGLEVSGTVEAVGQGATRWSVGDRVCALLAGGGYAELVAVDERHVLPVPDRLDLVQAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+   A L  G+T+L+HGGSSGIGT AIQLA+  GA V  TA S  K  AC
Sbjct: 121 PEVVATVWSNVVLDARLAPGETLLVHGGSSGIGTMAIQLATRLGARVAVTAGSPAKLDAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+  I+Y ++DF+  L + T GRG D+ILD +G +Y+++ +  L+++G++++I   
Sbjct: 181 RALGAEILIDYREQDFVAALLEATDGRGADVILDAIGGDYIDRDIRALARDGRIMVIGAQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G   T I L  ++++R  I G+TLR R    K  I  +++  +WP +    + PV+  V
Sbjct: 241 SGA-PTSIALGQLMARRGRIWGTTLRARDADDKARIVAAVRADVWPAVADGSVRPVVDRV 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH  +  S+H+GK++L
Sbjct: 300 FPLAEAAAAHAHVASSQHVGKVLL 323


>gi|254699647|ref|ZP_05161475.1| quinone oxidoreductase, PIG3 family protein [Brucella suis bv. 5
           str. 513]
 gi|261750111|ref|ZP_05993820.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           suis bv. 5 str. 513]
 gi|261739864|gb|EEY27790.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           suis bv. 5 str. 513]
          Length = 335

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 205/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+ L    +P  ++ E+ ++V A GVNRPD MQR G YPPP     +LGLE++G +
Sbjct: 14  GGPEVLELVPRELPALKRGEMRVRVHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVV 73

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +++ E+ T +  GD + ALV GG Y+E  +      + +P G + ++AA +PE++FTVW+
Sbjct: 74  LEIAEDVTRFGPGDRIMALVAGGAYSEEAIVQADVCITVPAGLSMVEAAGIPETYFTVWS 133

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ A L+ G+TVL+HGG+SGIG TA  LA   GA + TT  S++KC A   LGA  +I
Sbjct: 134 NLFQRAGLQPGETVLLHGGTSGIGVTATLLAKAIGARMITTCGSDDKCRASEALGAIASI 193

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF+E  +  T+GRG ++++DMVG  Y+ ++L L++++G++  I+F  G+ A +++
Sbjct: 194 NYRTTDFVEAGRALTEGRGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMD 252

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+T+TGSTLR R  + K ++  S++ ++ PL+ +    PVI +V  L  V  A
Sbjct: 253 MGPLLFKRLTLTGSTLRARPLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAA 312

Query: 316 HDIMEKSEHIGKIIL 330
           H  +E S H GKIIL
Sbjct: 313 HAHLEASAHTGKIIL 327


>gi|256111712|ref|ZP_05452696.1| quinone oxidoreductase, PIG3 family protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|265993183|ref|ZP_06105740.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           melitensis bv. 3 str. Ether]
 gi|262764053|gb|EEZ10085.1| zinc-containing alcohol dehydrogenase superfamily protein [Brucella
           melitensis bv. 3 str. Ether]
          Length = 335

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 205/315 (65%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   V+ L    +P  ++ E+ +++ A GVNRPD MQR G YPPP     +LGLE++G +
Sbjct: 14  GGPEVLELVPRELPALKRGEMRVRIHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVV 73

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           +++ E+ T +   D + ALV GG Y+E  +      +P+P G + ++AA +PE++FTVW+
Sbjct: 74  LEIAEDVTRFGPDDRIMALVAGGAYSEEAIVQADVCIPVPAGLSMVEAAGIPETYFTVWS 133

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           NLFQ A L+ G+TVL+HGG+SGIG TA  LA   GA + TT  S++KC A   LGA  +I
Sbjct: 134 NLFQRAGLQPGETVLLHGGTSGIGVTATLLAKAIGARMITTCGSDDKCRASEALGAIASI 193

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF+E  +  T+GRG ++++DMVG  Y+ ++L L++++G++  I+F  G+ A +++
Sbjct: 194 NYRTTDFVEAGRALTEGRGPEVVIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMD 252

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           + P++ KR+T+TGSTLR R  + K ++  S++ ++ PL+ +    PVI +V  L  V  A
Sbjct: 253 MGPLLFKRLTLTGSTLRARPLVMKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAA 312

Query: 316 HDIMEKSEHIGKIIL 330
           H  +E S H GKIIL
Sbjct: 313 HAHLEASAHTGKIIL 327


>gi|254419351|ref|ZP_05033075.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Brevundimonas
           sp. BAL3]
 gi|196185528|gb|EDX80504.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Brevundimonas
           sp. BAL3]
          Length = 345

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 197/317 (62%), Gaps = 4/317 (1%)

Query: 14  GYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAG 73
           G G +  +  A+ P P  +  E++I+V A G+NRPD++QR G+YPPP  A+ I+GLEVAG
Sbjct: 31  GSGPAEALRPADRPDPVARAGEVMIRVHAAGINRPDLLQRNGVYPPPPGASDIMGLEVAG 90

Query: 74  KIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTV 133
           ++  LGE  T W +GD VCAL+ GGGYA+  +    H LPIP G + +QAA LPE+ FTV
Sbjct: 91  EVEALGEGVTRWAVGDRVCALLGGGGYADRVVVDARHLLPIPDGLDYVQAAVLPETVFTV 150

Query: 134 WANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKH 193
           +AN+F+   L++GQ +LIHG +SGIG TAIQ+A   GATV  T++  +K  A   LGA  
Sbjct: 151 FANVFEAGGLKAGQNLLIHGATSGIGVTAIQMAKAAGATVIATSRGADKTAAARALGADV 210

Query: 194 AINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATE 253
           +++   +D    + +       D++LDMVG +Y   +L  L   G+ ++I+ L G+   E
Sbjct: 211 SLDAKTDDLAAAIAEAGG---ADVVLDMVGRDYAELNLKALKAGGRWVVIASLSGS-KVE 266

Query: 254 INLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA 313
           I+L  ++ KR+ +TGSTLR R+   K  +  +++  +WP + S  + P +    PL + A
Sbjct: 267 IDLMRVMLKRLVLTGSTLRSRSADEKARLTAAVEATVWPWVVSDAVRPPVQATFPLERAA 326

Query: 314 MAHDIMEKSEHIGKIIL 330
            AH  +E  +H+GK +L
Sbjct: 327 DAHRALEAGDHVGKFVL 343


>gi|194690546|gb|ACF79357.1| unknown [Zea mays]
          Length = 279

 Score =  272 bits (695), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 134/279 (48%), Positives = 186/279 (66%), Gaps = 2/279 (0%)

Query: 55  GLYPPPKNANPILGLEVAGKIVDLGENT-THWNIGDEVCALVNGGGYAEYCLSHQGHTLP 113
           G YPPP  A+P  GLE +G I+ LG N  + W +GD+VCAL++GGGYA+  ++  G  LP
Sbjct: 2   GRYPPPAGASPYPGLECSGTILALGPNVPSRWAVGDKVCALLSGGGYADKVVAPAGQLLP 61

Query: 114 IPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATV 173
           IP+G +   AA LPE   TVW+ +F T++L  G++ LIHGGSSGIGT AIQ+A + G  V
Sbjct: 62  IPEGVSLTHAAGLPEVACTVWSTVFMTSHLSPGESFLIHGGSSGIGTFAIQIAKHLGIKV 121

Query: 174 YTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTL 233
           + TA SEEK  AC  LGA   INY  EDF+E +++ET G+G+D+ILD +G  YL ++L  
Sbjct: 122 FVTAGSEEKLAACKALGADVCINYRTEDFVERIKQETNGKGVDVILDNIGGSYLQRNLNS 181

Query: 234 LSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPL 293
           L  +G+L II F GG IA E+NL  ++++R+TI  + LR R+   K  I   ++  +WP 
Sbjct: 182 LGVDGRLFIIGFQGG-IAAEVNLQAVLARRLTIQAAGLRNRSLANKAEIVSEVEKNVWPA 240

Query: 294 LNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
           + +  + PVI+   PL + A AH +ME S HIGKI+LLP
Sbjct: 241 VAAGKVKPVIYKTFPLCEAAEAHRLMEASTHIGKILLLP 279


>gi|117929308|ref|YP_873859.1| alcohol dehydrogenase [Acidothermus cellulolyticus 11B]
 gi|117649771|gb|ABK53873.1| Alcohol dehydrogenase, zinc-binding domain protein [Acidothermus
           cellulolyticus 11B]
          Length = 353

 Score =  271 bits (694), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 139/325 (42%), Positives = 202/325 (62%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + + G+G  +V+   E P P P   E++I V A GVNR D++QR+G YPPP  A  I
Sbjct: 1   MHAITIRGFGGPDVLTWTEVPDPVPASGEVVIDVVAAGVNRADLLQREGHYPPPPGAPDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG I  +G     W  GD VCAL+ GGGYAE       H LPIP G   ++AA+ 
Sbjct: 61  PGLECAGVISAVGPGVDGWQPGDRVCALLGGGGYAERVAVRADHVLPIPAGVTLVEAAAF 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+  TVW+ +F  A  R+G+T+LIHGG+SGIGT A+QLA+ +G  V  TA + EKC   
Sbjct: 121 PEAACTVWSTVFMAARARAGETLLIHGGASGIGTFAVQLATAWGLRVTATAGTAEKCERV 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+  INY  +DF+  +   T GRG+D++LD+VG  YL ++L +L+ +G++++I+  
Sbjct: 181 HALGAEFVINYRTQDFVAEISARTGGRGVDVVLDIVGGPYLARNLAVLAPDGRIVVIALQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E++L  +++KR +I  + LR R    K  I   ++  +WPL+ S  I PVI   
Sbjct: 241 GGRRA-ELDLAALMTKRGSIYAAGLRARPPEQKAEIVSEVRTHVWPLIGSGQIRPVIEAQ 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           +P+ + A AH I+E   H+GK++L+
Sbjct: 300 VPMHEAARAHRILEAGRHVGKVVLV 324


>gi|302531599|ref|ZP_07283941.1| NADPH:quinone reductase [Streptomyces sp. AA4]
 gi|302440494|gb|EFL12310.1| NADPH:quinone reductase [Streptomyces sp. AA4]
          Length = 325

 Score =  271 bits (694), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 136/324 (41%), Positives = 200/324 (61%), Gaps = 3/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G  +V+   E P P+P   E+L+ V A  VNR D++QR+G YPPP  A+ I
Sbjct: 1   MHAITIREPGAPDVLEWTEVPDPEPGPGEVLLDVTASAVNRADLLQRQGNYPPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I +LGE    W +GDEVCAL+ GGGYAE      G  LP+P     + AA L
Sbjct: 61  LGLECSGTIAELGEGVEGWQVGDEVCALLAGGGYAERVAVPAGQLLPVPGEIETVAAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVWAN+   A L  GQ +L+HGG+ GIGT AIQ+    GATV  TA S E+   C
Sbjct: 121 PEVACTVWANVVMHAGLGEGQVLLVHGGAGGIGTHAIQVGKALGATVAVTAGSPERLERC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY  +DF+E+L+ ET  +G D+ILD +GA+YL++++  L+ +G+L+II   
Sbjct: 181 RQLGADLTINYKDQDFVEVLRAET--KGADVILDNMGAKYLDRNVDALAADGRLVIIGMQ 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG I  E+N+  ++ KR ++  + LR R    K +I   ++ ++WPL+    + P++  V
Sbjct: 239 GG-IKGELNIGKLLGKRASVFAAGLRSRPLDQKAAIVADVRKRLWPLVEQGSVQPIVGHV 297

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           +P+ + A AH ++E+    GK++L
Sbjct: 298 VPMAEAASAHRMLEEGSIFGKVLL 321


>gi|218508841|ref|ZP_03506719.1| probable quinone oxidoreductase protein [Rhizobium etli Brasil 5]
          Length = 206

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 123/206 (59%), Positives = 155/206 (75%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           MP  ++MR V +  +G   VM +   P+P P + ++L++ +AIGVNRPD+ QR+G YPPP
Sbjct: 1   MPSPQEMRFVDLKSFGTPEVMTIGRGPLPVPGEGQVLVRAKAIGVNRPDIAQRQGSYPPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
           K+A+P+LGLE++G+IV +G + T   +GD+VC L NGG YAEYCL   G  LP PKGY+A
Sbjct: 61  KDASPVLGLELSGEIVAVGPDVTDHAVGDKVCGLANGGAYAEYCLLPSGQVLPFPKGYDA 120

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
           +QAA+LPE+FFTVWANLFQ A L  G+TVLIHGG+SGIGTTAIQLA  FGA VY TA S 
Sbjct: 121 VQAAALPETFFTVWANLFQMAGLTEGETVLIHGGTSGIGTTAIQLARAFGAEVYATAGSR 180

Query: 181 EKCLACLKLGAKHAINYLKEDFLEIL 206
           EKC AC  LGAK AINY  EDF E++
Sbjct: 181 EKCEACKTLGAKRAINYRSEDFAEVI 206


>gi|62870977|gb|AAY18430.1| putative quinone oxidoreductase [Noccaea caerulescens]
          Length = 325

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 145/325 (44%), Positives = 204/325 (62%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +S  G   V+ L E   PQ +  E+LIKV A  +NR D +QR G Y PP  ++P 
Sbjct: 1   MKAIVISEPGAPEVLQLREVEDPQVKDGEVLIKVHATALNRADTLQRLGFYHPPPGSSPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G I  +G+  + W IGD+VCAL++GGGYAE      G  LPIP G +   A + 
Sbjct: 61  PGLECSGTIESVGKGVSRWKIGDQVCALLSGGGYAEKVSVPAGQVLPIPAGVSLKDAVAF 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+ +F    L +G++ LIHGGSSGIGT AIQ+A + G  V+ TA SEEK  AC
Sbjct: 121 PEVACTVWSTVFMMGRLSAGESFLIHGGSSGIGTFAIQMAKHQGVRVFVTAGSEEKLAAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY  EDF+  ++ ET G+G+D+ILD +GA YL ++L  L+ +G+L II  +
Sbjct: 181 KELGADVCINYKTEDFVTKVKAETDGKGVDVILDCIGAPYLQKNLDSLNFDGRLCIIGLM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A EI L+ ++ KR+T+ G+ LR RT   K  +   ++  +WP + +  + PVI+  
Sbjct: 241 GGANA-EIKLSSLLPKRLTVLGAALRPRTAENKAVVVAEVEKNVWPAIEAGKVKPVIYKY 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           L L + A AH +ME S HIGKI+L+
Sbjct: 300 LILAQAAEAHSLMESSNHIGKILLV 324


>gi|294011234|ref|YP_003544694.1| putative dehydrogenase/reductase [Sphingobium japonicum UT26S]
 gi|292674564|dbj|BAI96082.1| putative dehydrogenase/reductase [Sphingobium japonicum UT26S]
          Length = 338

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 142/325 (43%), Positives = 202/325 (62%), Gaps = 2/325 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           +M  + ++  G   V+     P+P P  +E+LIKV A G+NRPDVMQR G YPPP  A  
Sbjct: 14  EMTAIGIAAPGGPEVLVPQRRPVPAPGPDEVLIKVAAAGINRPDVMQRLGKYPPPPGAPD 73

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLEV+G IV  G  +    IG  VCAL+ GGGYAEY ++  G  LP+P  Y+ ++AA+
Sbjct: 74  IPGLEVSGTIVAAG-GSAELLIGRRVCALLPGGGYAEYAVAPAGQCLPVPDDYDLVEAAA 132

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+ FTVW+NLF+ A +  G TVL+HGG+SGIGT AI L   F  TV  T  S+ KC  
Sbjct: 133 LPETLFTVWSNLFERAYVVEGDTVLVHGGTSGIGTMAISLCKLFDITVIVTCGSDAKCEQ 192

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
               GA HAINY  +DF+E +++ T G+G+  +LDMVG +YL +++  L+++G+ + I+ 
Sbjct: 193 AKAWGADHAINYRSQDFVEEVKRITGGQGVQAVLDMVGGDYLPRNIQCLAEDGRHVSIAT 252

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
            GG  A E+ +  I+ +R+T+TGSTLR R+   K  + D L   +W  +    + P +  
Sbjct: 253 TGGPKA-EVFIPAIMRRRLTLTGSTLRPRSVAFKSLVADELMRVVWAFIEQGRLRPAMDM 311

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL + A AH  M+  +H GKI+L
Sbjct: 312 RFPLAEAAKAHARMDSGDHFGKIVL 336


>gi|134096820|ref|YP_001102481.1| NADPH:quinone reductase [Saccharopolyspora erythraea NRRL 2338]
 gi|291005135|ref|ZP_06563108.1| NADPH:quinone reductase [Saccharopolyspora erythraea NRRL 2338]
 gi|133909443|emb|CAL99555.1| probable NADPH:quinone reductase [Saccharopolyspora erythraea NRRL
           2338]
          Length = 326

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 137/327 (41%), Positives = 202/327 (61%), Gaps = 7/327 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  +A+   G  +V+   E P P P   E+L+KV A GVNR D++QR+G YPPPK A+ I
Sbjct: 1   MYAIAIREPGDPDVLEWTEQPDPSPGAGEVLVKVAAAGVNRADLLQRRGFYPPPKGASEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I +LGE  T W +GD+VCAL++GGGYAE         LP+P G + ++AA L
Sbjct: 61  LGLECSGTIAELGEGVTGWTVGDQVCALLSGGGYAEQVAVPAAQVLPVPSGVDLVEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+   A LR GQ +L+HGGS GIGT AIQ+A+  GA V  TA S E    C
Sbjct: 121 PEVTCTVWSNVVMEAGLRGGQFLLVHGGSGGIGTCAIQVATALGARVAATAGSPETLQLC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA  AI+Y  EDF+E+++      G D+ILD +GA YL+++++ L+ +G L +I   
Sbjct: 181 RELGADPAISYRDEDFVEVVKGLG---GADVILDNMGASYLDRNISALAPDGHLAVIGMQ 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRT---DIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           GG  A E+++  +++KR  ++   LR R       K +I   ++ ++WPL+    + P++
Sbjct: 238 GGRKA-ELDMGKMLAKRARMSLLALRSRPVEGANGKAAIVTDVRERLWPLVEEGKVRPIV 296

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           H  +P+ + A AH  ++     GKI+L
Sbjct: 297 HGRIPMREAARAHSALDAGGVRGKILL 323


>gi|297564187|ref|YP_003683160.1| NAD(P)H quinone oxidoreductase, PIG3 family [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
 gi|296848636|gb|ADH70654.1| NAD(P)H quinone oxidoreductase, PIG3 family [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
          Length = 324

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 139/326 (42%), Positives = 201/326 (61%), Gaps = 6/326 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +S  G   V+   E P P P + E+L+ V A   NR DV QR+G YPPP  A+  
Sbjct: 1   MHAIRISEPGGPEVLAWTEVPDPVPGEGEVLVDVAASAANRADVSQRQGNYPPPPGASEY 60

Query: 67  LGLEVAGKIVDLGENT--THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
            GLE +G +  LG  T  + W++GD VCAL++GGGYAE      G  LP+P+G + ++AA
Sbjct: 61  PGLECSGTVAALGPGTEDSGWSVGDRVCALLSGGGYAEKVAVPVGQLLPVPEGVDLVEAA 120

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
           +LPE   TVW+NL     LR+G+TVL+HGG SGIGT A+Q A   GA V  TA S EK  
Sbjct: 121 ALPEVACTVWSNLVMVGGLRAGETVLVHGGGSGIGTFAVQFARALGARVAVTAGSREKLE 180

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
            C +LGA+  INY +EDF E ++   +  G D++LD++G  YL+ +L  L+  G+L+II+
Sbjct: 181 RCRELGAEILINYKEEDFTERMR---EAGGADLVLDIMGGSYLDANLRSLATNGRLVIIA 237

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
            +GG  A E +L  +++KR+++  +TLR R    K +I   +  ++WPL+   V+ PV+ 
Sbjct: 238 LMGGRRA-EADLGRMLAKRLSVHATTLRSRPLEEKAAIVSGVLEQVWPLVEQGVVRPVVD 296

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
             +P+   A AH +ME S H GKI+L
Sbjct: 297 RSVPMRNAAEAHRVMETSAHTGKILL 322


>gi|148272694|ref|YP_001222255.1| putative Zn-dependent oxidoreductase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|147830624|emb|CAN01560.1| putative Zn-dependant oxidoreductase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 325

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 197/324 (60%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR +     G  +V+ L + P P     E+LI+V A GVNR D+ QR+G YPPP  A   
Sbjct: 1   MRAITFPSPGGPDVLSLTDLPDPVAGPGEVLIRVAAAGVNRADLSQRQGAYPPPAGAPTH 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEV+G +  +G   T W +GD VCAL+ GGGYAE     + H LP+P G + ++AA L
Sbjct: 61  LGLEVSGTVAAVGAGATRWGVGDRVCALLAGGGYAELVAVDERHVLPVPDGLDLVEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+   A L  G+T+L+HGGSSGIGT AIQLA+  GA V  TA S  K  AC
Sbjct: 121 PEVVATVWSNVVLDAGLAPGETLLVHGGSSGIGTMAIQLAARLGARVAVTAGSPAKLEAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   I+Y ++DF++ L + T G G D++LD +G +Y+++ +  L+++G++++I   
Sbjct: 181 RALGADILIDYRQQDFVQALLEATDGHGADVVLDAIGGDYIDRDIRALARDGRIMVIGAQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G   T I L  ++++R  I G+TLR R    K  I  +++  +WP +    + PV+  V
Sbjct: 241 SGA-PTSIALGQLMARRGRIWGTTLRARDADDKARIVAAIRADVWPAVADGSVRPVVDRV 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL   A AH  +  S+H+GK++L
Sbjct: 300 FPLEDAAAAHAHVASSQHVGKVLL 323


>gi|259418813|ref|ZP_05742730.1| putative quinone oxidoreductase (Tumor protein p53-inducible
           protein 3) [Silicibacter sp. TrichCH4B]
 gi|259345035|gb|EEW56889.1| putative quinone oxidoreductase (Tumor protein p53-inducible
           protein 3) [Silicibacter sp. TrichCH4B]
          Length = 335

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 144/328 (43%), Positives = 211/328 (64%), Gaps = 1/328 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           +  +M  + +S  G  +V+  A  P P+P   +++I+V A GVN PDV+QR+G Y  P  
Sbjct: 5   LTNEMTCIEISQPGAPDVLVAARRPRPEPGPRDVIIQVAAAGVNYPDVLQRQGRYAVPPG 64

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+ + GLE AG +  LG   T  ++GD VCAL  GGGYAEYC       LP+P+G + ++
Sbjct: 65  ASDLPGLEAAGHVAALGTEVTGLSLGDAVCALAPGGGYAEYCRVPVEQCLPVPEGLSMVE 124

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA+LPE FFTVW NL    NL + + VLIHGGS GIG+ AIQLAS     VYTTA +EE 
Sbjct: 125 AATLPEVFFTVWFNLVMQGNLMTAERVLIHGGSGGIGSAAIQLASALAIEVYTTAVNEEA 184

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
           C  C  LGA  AINY++EDF+ ++ +++ G+G+D++LDMVG +Y+ +++  L + G+L+ 
Sbjct: 185 CTFCRDLGANTAINYMEEDFVSVIAEKSGGKGVDLVLDMVGGDYIQRNMECLGQGGRLVN 244

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           + ++ G+   E+ + P++ K +T+TGS LR +    KQ+I  +LQ  +WPL  S  I PV
Sbjct: 245 LYYMKGS-KVEVEMMPVLVKNLTLTGSLLRPQPLFVKQAIAQALQETVWPLFKSGRIKPV 303

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +  V  L K + AH +ME  +H GKI+L
Sbjct: 304 VKEVFSLEKASDAHALMETGQHFGKIVL 331


>gi|148657844|ref|YP_001278049.1| alcohol dehydrogenase [Roseiflexus sp. RS-1]
 gi|148569954|gb|ABQ92099.1| Alcohol dehydrogenase, zinc-binding domain protein [Roseiflexus sp.
           RS-1]
          Length = 329

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 138/324 (42%), Positives = 200/324 (61%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +     G   V+   ++P P P  +E+L++V A  VNR D++QR+G+Y PP  A+PI
Sbjct: 1   MKAILFDAPGSPEVLRYDDAPDPTPGADEVLVRVRATAVNRADLLQRRGVYAPPPGASPI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE+AG+++        W +GD V A+V GGGYAE  +   G  + IP   +  +A ++
Sbjct: 61  LGLELAGEVL---TPAGPWRVGDRVMAVVTGGGYAELAVVPVGMVMRIPDSLSFEEAGAI 117

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+F T + NLF    L++G+TVLIH G+SG+GT AIQLA   GA V+ TA S EKC  C
Sbjct: 118 PEAFLTAFLNLFTLGRLQAGETVLIHAGASGVGTAAIQLARVAGARVFATAGSPEKCALC 177

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+  INY +E F       T GRG+D++LD VGA Y  Q+   L+ +G+L +I FL
Sbjct: 178 RELGAELTINYREESFAARALDATGGRGVDLVLDFVGAPYWQQNTAALALDGRLQLIGFL 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG+ A +I+L PI++KR+ +TG+TLRR     K ++           L S  + PVI TV
Sbjct: 238 GGS-AGQIDLGPILAKRLHVTGTTLRRMPLPQKTALTADFVAFAHDRLASGELRPVIDTV 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH +ME + + GK++L
Sbjct: 297 YPLHQAAEAHRVMEANRNAGKLVL 320


>gi|284028209|ref|YP_003378140.1| NAD(P)H quinone oxidoreductase, PIG3 family [Kribbella flavida DSM
           17836]
 gi|283807502|gb|ADB29341.1| NAD(P)H quinone oxidoreductase, PIG3 family [Kribbella flavida DSM
           17836]
          Length = 325

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 132/324 (40%), Positives = 207/324 (63%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V   G G   V+ + E   P+   +E++I V A GVNR D++QR+G YPPP  A   
Sbjct: 1   MRAVVCEGAGGVEVLTVGEIEDPKVAVDEVVIDVVAAGVNRADLLQRQGHYPPPPGAPGT 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           +GLEV+G+I  +G     W++GDE CAL+ GGGYAE  +      +P+P G + + AA+L
Sbjct: 61  IGLEVSGRISAIGSEVEGWSVGDECCALLAGGGYAEKVVVPAPQVMPVPAGIDLVSAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F TA+L+ G+T+L+HGG+SGIGT AIQLA   GA V  T  S +K   C
Sbjct: 121 PEVVATVWSNVFMTAHLKHGETLLVHGGASGIGTMAIQLAVAHGARVLCTVGSADKMEFC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA  AINY + ++  ++++ T   G D+ILD++GA+YL  ++  L+ +G++++I   
Sbjct: 181 TRLGADVAINYKEAEWASVVKEATGQAGADVILDIMGAKYLPDNVKSLAFDGRIVVIGLQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E++L  ++++R +IT + LR R+   K  I   +   +WPL+ +  + P++H +
Sbjct: 241 GG-VKGELDLGRLMARRGSITATGLRARSVEDKGRILAEVVGHVWPLVEAKKVRPIVHGI 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL +VA AH+ +E+S   GK++L
Sbjct: 300 FPLEQVAQAHEALEQSAQTGKVLL 323


>gi|79325213|ref|NP_001031691.1| oxidoreductase, zinc-binding dehydrogenase family protein
           [Arabidopsis thaliana]
 gi|222423825|dbj|BAH19878.1| AT4G21580 [Arabidopsis thaliana]
 gi|332659074|gb|AEE84474.1| putative NADPH quinone oxidoreductase [Arabidopsis thaliana]
          Length = 292

 Score =  269 bits (687), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 131/291 (45%), Positives = 188/291 (64%), Gaps = 1/291 (0%)

Query: 40  VEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGG 99
           ++AI ++ PD +QR GLY PP  ++P LGLE +G I  +G+  + W +GD+VCAL++GGG
Sbjct: 1   MKAIVISEPDTLQRLGLYNPPPGSSPYLGLECSGTIESVGKGVSRWKVGDQVCALLSGGG 60

Query: 100 YAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIG 159
           YAE      G   PIP G +   AA+ PE   TVW+ +F    L  G++ LIHGGSSGIG
Sbjct: 61  YAEKVSVPAGQIFPIPAGISLKDAAAFPEVACTVWSTVFMMGRLSVGESFLIHGGSSGIG 120

Query: 160 TTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIIL 219
           T AIQ+A + G  V+ TA S+EK  AC +LGA   INY  EDF+  ++ ET G+G+D+IL
Sbjct: 121 TFAIQIAKHLGVRVFVTAGSDEKLAACKELGADVCINYKTEDFVAKVKAETDGKGVDVIL 180

Query: 220 DMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAK 279
           D +GA YL ++L  L+ +G+L II  +GG  A EI L+ ++ KR+T+ G+ LR R+   K
Sbjct: 181 DCIGAPYLQKNLDSLNFDGRLCIIGLMGGANA-EIKLSSLLPKRLTVLGAALRPRSPENK 239

Query: 280 QSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             +   ++  +WP + +  + PVI+  LPL + A  H +ME S HIGKI+L
Sbjct: 240 AVVVREVEKNVWPAIEAGKVKPVIYKYLPLSQAAEGHSLMESSNHIGKILL 290


>gi|15610913|ref|NP_218294.1| oxidoreductase [Mycobacterium tuberculosis H37Rv]
 gi|148663645|ref|YP_001285168.1| putative oxidoreductase [Mycobacterium tuberculosis H37Ra]
 gi|148824984|ref|YP_001289738.1| oxidoreductase [Mycobacterium tuberculosis F11]
 gi|167970940|ref|ZP_02553217.1| hypothetical oxidoreductase [Mycobacterium tuberculosis H37Ra]
 gi|218755562|ref|ZP_03534358.1| oxidoreductase [Mycobacterium tuberculosis GM 1503]
 gi|253800825|ref|YP_003033827.1| oxidoreductase [Mycobacterium tuberculosis KZN 1435]
 gi|254552892|ref|ZP_05143339.1| oxidoreductase [Mycobacterium tuberculosis '98-R604 INH-RIF-EM']
 gi|289556044|ref|ZP_06445254.1| oxidoreductase [Mycobacterium tuberculosis KZN 605]
 gi|289763961|ref|ZP_06523339.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|297636459|ref|ZP_06954239.1| oxidoreductase [Mycobacterium tuberculosis KZN 4207]
 gi|297733453|ref|ZP_06962571.1| oxidoreductase [Mycobacterium tuberculosis KZN R506]
 gi|306778138|ref|ZP_07416475.1| oxidoreductase [Mycobacterium tuberculosis SUMu001]
 gi|306778670|ref|ZP_07417007.1| oxidoreductase [Mycobacterium tuberculosis SUMu002]
 gi|306786692|ref|ZP_07425014.1| oxidoreductase [Mycobacterium tuberculosis SUMu003]
 gi|306791059|ref|ZP_07429381.1| oxidoreductase [Mycobacterium tuberculosis SUMu004]
 gi|306791378|ref|ZP_07429680.1| oxidoreductase [Mycobacterium tuberculosis SUMu005]
 gi|306795443|ref|ZP_07433745.1| oxidoreductase [Mycobacterium tuberculosis SUMu006]
 gi|306801418|ref|ZP_07438086.1| oxidoreductase [Mycobacterium tuberculosis SUMu008]
 gi|306805624|ref|ZP_07442292.1| oxidoreductase [Mycobacterium tuberculosis SUMu007]
 gi|306970021|ref|ZP_07482682.1| oxidoreductase [Mycobacterium tuberculosis SUMu009]
 gi|306974255|ref|ZP_07486916.1| oxidoreductase [Mycobacterium tuberculosis SUMu010]
 gi|307081963|ref|ZP_07491133.1| oxidoreductase [Mycobacterium tuberculosis SUMu011]
 gi|307086576|ref|ZP_07495689.1| oxidoreductase [Mycobacterium tuberculosis SUMu012]
 gi|313660784|ref|ZP_07817664.1| oxidoreductase [Mycobacterium tuberculosis KZN V2475]
 gi|1552860|emb|CAB02456.1| PROBABLE OXIDOREDUCTASE [Mycobacterium tuberculosis H37Rv]
 gi|148507797|gb|ABQ75606.1| putative oxidoreductase [Mycobacterium tuberculosis H37Ra]
 gi|148723511|gb|ABR08136.1| hypothetical oxidoreductase [Mycobacterium tuberculosis F11]
 gi|253322329|gb|ACT26932.1| oxidoreductase [Mycobacterium tuberculosis KZN 1435]
 gi|289440676|gb|EFD23169.1| oxidoreductase [Mycobacterium tuberculosis KZN 605]
 gi|289711467|gb|EFD75483.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|308213660|gb|EFO73059.1| oxidoreductase [Mycobacterium tuberculosis SUMu001]
 gi|308328393|gb|EFP17244.1| oxidoreductase [Mycobacterium tuberculosis SUMu002]
 gi|308328797|gb|EFP17648.1| oxidoreductase [Mycobacterium tuberculosis SUMu003]
 gi|308332640|gb|EFP21491.1| oxidoreductase [Mycobacterium tuberculosis SUMu004]
 gi|308340132|gb|EFP28983.1| oxidoreductase [Mycobacterium tuberculosis SUMu005]
 gi|308344118|gb|EFP32969.1| oxidoreductase [Mycobacterium tuberculosis SUMu006]
 gi|308347920|gb|EFP36771.1| oxidoreductase [Mycobacterium tuberculosis SUMu007]
 gi|308351788|gb|EFP40639.1| oxidoreductase [Mycobacterium tuberculosis SUMu008]
 gi|308352571|gb|EFP41422.1| oxidoreductase [Mycobacterium tuberculosis SUMu009]
 gi|308356523|gb|EFP45374.1| oxidoreductase [Mycobacterium tuberculosis SUMu010]
 gi|308360471|gb|EFP49322.1| oxidoreductase [Mycobacterium tuberculosis SUMu011]
 gi|308363989|gb|EFP52840.1| oxidoreductase [Mycobacterium tuberculosis SUMu012]
 gi|328460553|gb|AEB05976.1| oxidoreductase [Mycobacterium tuberculosis KZN 4207]
          Length = 328

 Score =  268 bits (685), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 142/317 (44%), Positives = 197/317 (62%), Gaps = 4/317 (1%)

Query: 17  KSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIV 76
            S+ +   E P       E+LIKV A GVNR DV+Q  G YPPP   + I+GLEV+G + 
Sbjct: 11  SSDRLVWQEVPDVSAGPGEVLIKVAASGVNRADVLQAAGKYPPPPGVSDIIGLEVSGIVA 70

Query: 77  DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWAN 136
            +G   T W+ G EVCAL+ GGGYAEY        LPIP   N + +A+LPE   TVW+N
Sbjct: 71  AVGPGVTEWSAGQEVCALLAGGGYAEYVAVPADQVLPIPPSVNLVDSAALPEVACTVWSN 130

Query: 137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAIN 196
           L  TA+LR GQ VLIHGG+SGIG+ AIQ+     A V  TA S EK   C  LGA+  IN
Sbjct: 131 LVMTAHLRPGQLVLIHGGASGIGSHAIQVVRALAARVAITAGSPEKLELCRDLGAQITIN 190

Query: 197 YLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINL 256
           Y  EDF+  L++ET G G DIILD++GA YL++++  L+ +G+LI+I   GG +  E+NL
Sbjct: 191 YRDEDFVARLKQETDGSGADIILDIMGASYLDRNIDALATDGQLIVIGMQGG-VKAELNL 249

Query: 257 NPIISKRITITGSTLRRRT---DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA 313
             +++KR  + G+TLR R       K +I  ++   +WP++ ++ + PVI T LP+ + A
Sbjct: 250 GKLLTKRARVIGTTLRARPVSGPHGKAAIAQAVAASVWPMIAANRVRPVIGTRLPIQQAA 309

Query: 314 MAHDIMEKSEHIGKIIL 330
            AH++M   +  GKI+L
Sbjct: 310 QAHELMLSGKTFGKILL 326


>gi|326410548|gb|ADZ67612.1| Zinc-containing alcohol dehydrogenase superfamily [Brucella
           melitensis M28]
 gi|326553839|gb|ADZ88478.1| Zinc-containing alcohol dehydrogenase superfamily [Brucella
           melitensis M5-90]
          Length = 302

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/293 (43%), Positives = 196/293 (66%), Gaps = 1/293 (0%)

Query: 38  IKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNG 97
           +++ A GVNRPD MQR G YPPP     +LGLE++G ++++ E+ T +  GD + ALV G
Sbjct: 3   VRIHAAGVNRPDAMQRAGQYPPPPGVTDVLGLELSGVVLEIAEDVTRFGPGDRIMALVAG 62

Query: 98  GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSG 157
           G Y+E  +      +P+P G + ++AA +PE++FTVW+NLFQ A L+ G+TVL+HGG+SG
Sbjct: 63  GAYSEEAIVQADVCIPVPAGLSMVEAAGIPETYFTVWSNLFQRAGLQPGETVLLHGGTSG 122

Query: 158 IGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDI 217
           IG TA  LA   GA + TT  S++KC A   LGA  +INY   DF+E  +  T+GRG ++
Sbjct: 123 IGVTATLLAKAIGARMITTCGSDDKCRASEALGAIASINYRTTDFVEAGRALTEGRGPEV 182

Query: 218 ILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDI 277
           ++DMVG  Y+ ++L L++++G++  I+F  G+ A ++++ P++ KR+T+TGSTLR R  +
Sbjct: 183 VIDMVGGSYMQRNLQLVAEDGRIAQIAFQQGSEA-QMDMGPLLFKRLTLTGSTLRARPLV 241

Query: 278 AKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            K ++  S++ ++ PL+ +    PVI +V  L  V  AH  +E S H GKIIL
Sbjct: 242 MKAALARSVEAEVLPLVLNKGARPVIDSVFDLADVQAAHAHLEASAHTGKIIL 294


>gi|326328969|ref|ZP_08195299.1| NADPH:quinone reductase [Nocardioidaceae bacterium Broad-1]
 gi|325953228|gb|EGD45238.1| NADPH:quinone reductase [Nocardioidaceae bacterium Broad-1]
          Length = 324

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 196/324 (60%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V     G   V+ + + P P+P   E++I V A G+NR D++QR+G YPPPK A+ I
Sbjct: 1   MRAVVAEQPGGPEVLTVTDRPDPEPGPGEVVIDVAAAGLNRADLLQRQGFYPPPKGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           +G+E +G +  +GE    W +GDEVCAL+ GGGYA       G  +P+P+G + + AA+L
Sbjct: 61  IGMECSGVVSAVGEGVDEWQVGDEVCALLAGGGYATKVAVPAGQVMPVPEGVDLVTAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F    L   +T L+HGG+ GIGT AIQLAS  G+ V TT  S EK    
Sbjct: 121 PEVTTTVWSNVFMVGGLTPDETFLVHGGAGGIGTMAIQLASQIGSRVITTVGSAEKAELA 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+  INY  +DF+E+ +      G D+ILD +GA+YL +++  L+ EG+L+II   
Sbjct: 181 KSLGAEVIINYKDQDFVEVAKVYG---GADVILDNMGAKYLARNIDALNPEGRLVIIGMQ 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E+++N ++ KR  +  + LR R    K  I   +  +IWP++ +  +  V+  V
Sbjct: 238 GGTKA-ELDINALLRKRAAVIATNLRGRPVEQKARICAEVVERIWPMVEAGEVKAVVQDV 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LPL + A AH +ME   H GKI+L
Sbjct: 297 LPLAEAAEAHRLMESGTHTGKILL 320


>gi|83859943|ref|ZP_00953463.1| alcohol dehydrogenase, zinc-containing [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852302|gb|EAP90156.1| alcohol dehydrogenase, zinc-containing [Oceanicaulis alexandrii
           HTCC2633]
          Length = 327

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 132/302 (43%), Positives = 190/302 (62%), Gaps = 4/302 (1%)

Query: 31  PQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDE 90
           P   E+LI V A G+NRPDV +R G YP P  A   LGLEV+G +  +G+  T +  GD 
Sbjct: 30  PAAGEVLIDVAASGINRPDVFERMGFYPAPDGAPEGLGLEVSGTVRAVGDGVTRYKAGDP 89

Query: 91  VCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVL 150
           V ALV+GGGYA+   +  G  LP PKG + ++AA LPE+ FTVW N+F    L+ G+ +L
Sbjct: 90  VVALVSGGGYADVARAKAGSVLPAPKGVDLVEAAGLPETVFTVWTNVFDAGALKPGERLL 149

Query: 151 IHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKET 210
           +HGG SGIG+TAIQ+A   GA V  TA   ++  ACL LGA  A +Y  ED+   ++ E 
Sbjct: 150 VHGGVSGIGSTAIQMAKAQGAYVIATAGGPDRAQACLDLGADRAFDYHAEDWSAAIRAEG 209

Query: 211 QGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGST 270
              G D+ILDMVG +Y+ ++L  L++ G++++I+FL G+   E++L  ++ KR T+TGST
Sbjct: 210 ---GADVILDMVGGDYVQKNLNCLNRFGRIVMIAFLKGS-RVELDLMGLMLKRQTLTGST 265

Query: 271 LRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           LR R+D  K  I  ++   +WP + +  + P+I +   L  VA AH  M+   H GKI+L
Sbjct: 266 LRSRSDEEKADIAQAVLTHVWPWIEAGKVRPLIDSTFALDDVAKAHARMDAGGHAGKILL 325

Query: 331 LP 332
           +P
Sbjct: 326 IP 327


>gi|54022186|ref|YP_116428.1| putative quinone oxidoreductase [Nocardia farcinica IFM 10152]
 gi|54013694|dbj|BAD55064.1| putative quinone oxidoreductase [Nocardia farcinica IFM 10152]
          Length = 334

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 137/330 (41%), Positives = 198/330 (60%), Gaps = 7/330 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + ++G+G   V+   ++  P P   E+LI V A GVNR D++QR+G YPPP  A+ I
Sbjct: 1   MRAIELNGFGGPEVLVWGKAADPVPGHGEVLIDVVAAGVNRADLLQRQGNYPPPAGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G + ++GE    W +GD VCAL++GGGYAE  +      LP+P+G +   AA L
Sbjct: 61  LGLECSGVVAEVGEGVREWQVGDRVCALLSGGGYAERVVVPATQVLPVPEGMDLAAAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+NL  TA L +GQ VLIHGG SGIGT AIQ+A   GA V  TA S EK   C
Sbjct: 121 PEVAATVWSNLVMTAGLHAGQLVLIHGGGSGIGTHAIQVARQRGARVAVTAGSAEKLERC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQG---RGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
            +LGA   INY ++DF+E+++ +  G    G DIILD +GA YL +++  L+  G L+II
Sbjct: 181 RELGADVLINYREQDFVEVVRAQESGAGAAGADIILDNMGAAYLGRNVAALAPHGHLVII 240

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDI---AKQSIRDSLQLKIWPLLNSHVIA 300
              GG +  E+N+  ++ K  ++  + +R R      +K  I   ++  +WPL+    + 
Sbjct: 241 GMQGG-VTGELNVGALLGKWGSVHATNVRNRPATGTGSKAEIIAEVRRHLWPLVADGAVV 299

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVIH    +   A AH +++ S   GK++L
Sbjct: 300 PVIHAEFDIADAAQAHRVLDSSRAFGKVVL 329


>gi|119773673|ref|YP_926413.1| alcohol dehydrogenase, zinc-containing [Shewanella amazonensis
           SB2B]
 gi|119766173|gb|ABL98743.1| alcohol dehydrogenase, zinc-containing [Shewanella amazonensis
           SB2B]
          Length = 333

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 204/322 (63%), Gaps = 1/322 (0%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
            V     G   VM L + P P PQ  E+LI+V A GVN PD+ QRKG YPPP  A+PILG
Sbjct: 7   QVVFDAPGSPEVMKLVQGPAPSPQVGEVLIRVAAAGVNGPDLAQRKGAYPPPPGASPILG 66

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEV+G++V++  + +   IGD+VCALV GGGYA   ++   H LPIP   +  +AA LPE
Sbjct: 67  LEVSGEVVEVAPDVSWPRIGDKVCALVPGGGYAGLVVTPALHCLPIPLTMSLEEAAGLPE 126

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW NLF  A L++G+T+LI GGS GIG+TAI LA  FGA V  T+ S EK   C+ 
Sbjct: 127 TFFTVWGNLFMRAGLKAGETLLIQGGSGGIGSTAILLARAFGARVLVTSGSAEKREYCVS 186

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA  A +Y  E  ++ +   T GRG+D++LDM G   +N +L +L+ +G+++ ++   G
Sbjct: 187 LGADMAFDYRDEALVDRVLAATDGRGVDVVLDMAGGAMVNNNLKMLANDGRMVSVAMQAG 246

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLP 308
             A E+++  I+SKRI  TGSTLR ++  AK +I   L+ K+WPLL+S      +  V  
Sbjct: 247 PRA-EVDVFRIMSKRILWTGSTLRPQSIEAKAAIAKELREKVWPLLDSGQCRIPLFGVYR 305

Query: 309 LGKVAMAHDIMEKSEHIGKIIL 330
           L +V   H IME   H GK++L
Sbjct: 306 LDEVVKVHSIMEAKSHHGKLVL 327


>gi|127514202|ref|YP_001095399.1| alcohol dehydrogenase [Shewanella loihica PV-4]
 gi|126639497|gb|ABO25140.1| Alcohol dehydrogenase, zinc-binding domain protein [Shewanella
           loihica PV-4]
          Length = 337

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 145/325 (44%), Positives = 207/325 (63%), Gaps = 5/325 (1%)

Query: 9   HVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILG 68
           HV  +  G   V+ LA+SP+P+   +++LIKVE  GVN PD+ QR+GLYPPP  A+ ILG
Sbjct: 10  HVQFNAPGGPEVLELAQSPLPEFAPDQLLIKVEYAGVNGPDIAQRRGLYPPPPGASEILG 69

Query: 69  LEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPE 128
           LEV+G +V +G+  T W +GD VCALV GGGY EY  +   H LPIP G    QAA+LPE
Sbjct: 70  LEVSGTVVAVGDAVTGWQLGDRVCALVPGGGYGEYVTTWGVHCLPIPTGVTMAQAAALPE 129

Query: 129 SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188
           +FFTVW ++F    L++G+TVLIHGGS GIG+ A+ LA  F   V  T   +EK   CL 
Sbjct: 130 TFFTVWGHMFMRGGLKAGETVLIHGGSGGIGSAAVTLAKQFAVKVLVTCGCQEKIDYCLA 189

Query: 189 LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248
           LGA H  NY  ED L  + K    +G+D++LDM   + ++ +L  L+ EG+L+ I+   G
Sbjct: 190 LGADHGFNYHDEDLLAQI-KAVAPQGVDLVLDMASGDLIDLNLKALAIEGRLVTIALQRG 248

Query: 249 NIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH---VIAPVIHT 305
             A E+++  +++KRI  TG+TLR ++  AKQ+I D L+ ++WP  ++     + P ++ 
Sbjct: 249 RRA-EVDVALLMAKRICWTGATLRPQSVAAKQAIADGLREQVWPKFDTQEGCSLVPHLYA 307

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
              LG  A AH +ME  +H GK++L
Sbjct: 308 EFALGDAAKAHALMESGQHRGKLVL 332


>gi|257054245|ref|YP_003132077.1| putative NAD(P)H quinone oxidoreductase, PIG3 family
           [Saccharomonospora viridis DSM 43017]
 gi|256584117|gb|ACU95250.1| putative NAD(P)H quinone oxidoreductase, PIG3 family
           [Saccharomonospora viridis DSM 43017]
          Length = 324

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 198/324 (61%), Gaps = 3/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +   G    +  A++P P     E+L++V A  VNR D++QR+G YPPP  A+ I
Sbjct: 1   MRAIRLREPGGPEKLEWADAPDPVAGPGEVLVEVAASAVNRADLLQRQGHYPPPPGASEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G IV++G+    W +GD VCAL+ GGGYA+      G  LP+P G     AASL
Sbjct: 61  LGLECSGTIVEVGDGVEGWRVGDHVCALLAGGGYAQQVAVPAGQLLPVPNGMELTTAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+   A L  G+T+L+HGG+ GIGT AIQ+    GATV  TA S+E+   C
Sbjct: 121 PEVACTVWSNVVMHARLTEGETLLVHGGAGGIGTHAIQVGKALGATVAVTAGSDERAQRC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA  AINY ++DF+E+++ ET   G D+ILD +GA+YL +++  L+  G+L++I   
Sbjct: 181 RQLGADIAINYREQDFVEVIKAETG--GADVILDNMGAKYLGRNVDALATGGRLVVIGMQ 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG    E++L  +I+KR +IT +TLR R    K  I   ++ ++WPL+    + PV+   
Sbjct: 239 GGTKG-ELHLGKLIAKRASITATTLRSRPKEEKARIVAEVRERLWPLVERGTVRPVVDRA 297

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P+ +   AH  +E     GKI+L
Sbjct: 298 YPMSQAGDAHRALEAGGIFGKILL 321


>gi|329897424|ref|ZP_08272079.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [gamma
           proteobacterium IMCC3088]
 gi|328921184|gb|EGG28586.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [gamma
           proteobacterium IMCC3088]
          Length = 330

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 130/330 (39%), Positives = 204/330 (61%), Gaps = 3/330 (0%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +  K +H++++   KS  ++L ES +  P+  ++LIKV A G+NR D++QR+GLYP P
Sbjct: 1   MQLPAKFKHISVNPDSKS--LYLDESILESPEARDVLIKVTAAGINRADLLQRQGLYPAP 58

Query: 61  KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
            +A+PILGLEVAG +   G + T W +GD VCALV+GGGYA YC   +   L +P     
Sbjct: 59  ADASPILGLEVAGVVAATGPDVTQWQVGDRVCALVHGGGYANYCAVREDQCLHVPDNIEL 118

Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180
             AA LPE+  T W N+F+ A L+ G+T+L+ GGSSGIG+ A+Q+A  +GA V  TA   
Sbjct: 119 DAAAGLPEALLTAWHNVFERAQLKPGETLLVQGGSSGIGSMAVQMAKLWGAKVIATAGGA 178

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240
            KC    ++G    I+Y ++DF  I++  T+G G+D+I DMVG +Y+ +H+   + EG++
Sbjct: 179 HKCQRLKEMGVDLVIDYREQDFEVIVKDYTEGGGVDVIFDMVGGDYIQKHINCAAVEGRI 238

Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300
           + I++  G +A EI+   ++ KR+++  STLR ++  AK  +   +       L+   + 
Sbjct: 239 VNIAYQNGFVA-EIHFGLVLIKRLSLLASTLRPQSFDAKARMTRVISEHFGAALSQGNLL 297

Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           PVI ++ PL +   A + M +  H GKI+L
Sbjct: 298 PVIDSIYPLAEAEKAQNAMAQGNHFGKILL 327


>gi|156741124|ref|YP_001431253.1| quinone oxidoreductase PIG3 [Roseiflexus castenholzii DSM 13941]
 gi|156232452|gb|ABU57235.1| Quinone oxidoreductase putative PIG3 [Roseiflexus castenholzii DSM
           13941]
          Length = 327

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 137/324 (42%), Positives = 200/324 (61%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +     G  +V+   ++P P P  +E+L++V A  VNR D++QR+G Y PP  A+PI
Sbjct: 1   MKAILFDTPGAPDVLQYGDAPDPTPGSDELLVRVRATAVNRADLLQRRGAYAPPPGASPI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE+AG++V     T  W  GD V A+V GGGYAE  +   G  + IP+  +  +AA++
Sbjct: 61  LGLELAGEVV---TPTGQWRAGDRVMAVVTGGGYAELAVVPAGIAMRIPENLSFEEAAAI 117

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+F T + NLF    L++G+TVLIH G+SG+GT AIQLA   GA V+ TA S EK   C
Sbjct: 118 PEAFLTAFLNLFAMGKLQTGETVLIHAGASGVGTAAIQLARVAGARVFATAGSAEKLALC 177

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+ AINY +E F   + + T  RG+D+ILD VGA Y  Q+   L+ +G+L +I FL
Sbjct: 178 RELGAELAINYREESFAMRVLEATGSRGVDLILDFVGAPYWQQNTAALALDGRLQLIGFL 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG+   +I+L PI++KR+ +TG+TLRR     K ++           L    + P+I T+
Sbjct: 238 GGSTG-QIDLGPIMTKRLRVTGATLRRTPLSQKIALTADFVAFAHDRLTRGELRPIIDTI 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL   A AH +ME + + GK++L
Sbjct: 297 YPLRDAAEAHRVMEANRNAGKLVL 320


>gi|295396627|ref|ZP_06806781.1| NADPH:quinone reductase [Brevibacterium mcbrellneri ATCC 49030]
 gi|294970511|gb|EFG46432.1| NADPH:quinone reductase [Brevibacterium mcbrellneri ATCC 49030]
          Length = 338

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 139/336 (41%), Positives = 201/336 (59%), Gaps = 14/336 (4%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR +     G  + + L++SP+P  Q  E+++KVEA GVNR DV+QR G Y PPK A  I
Sbjct: 1   MRSITAPQPGGPDALKLSDSPVPSAQPGEVVVKVEAAGVNRADVLQRMGFYTPPKGATDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE AG +  +G+    W +GD V  L+ GGGYAEY     G  LP+P+G + ++AA+L
Sbjct: 61  LGLEAAGTVHQVGDGVDDWQVGDRVAVLLTGGGYAEYVPVPAGQVLPVPEGMSFVEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TV++N+   A L  G+ +L+HGG+SGIGT AIQ+A   GA V  T  S+++   C
Sbjct: 121 PEVVATVYSNVVMEAGLSEGEWLLVHGGASGIGTMAIQIAKQMGARVAVTVGSDDRARKC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKET---QGR---------GIDIILDMVGAEYLNQHLTLL 234
             LGA   INY  EDF+E +++ T   +G          G D+ILD++GA+YL +++  L
Sbjct: 181 ADLGADAVINYRDEDFVERIREITGSGEGADGSAGARVPGADVILDIIGAKYLERNIQAL 240

Query: 235 SKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLL 294
           S +G+LIII   GG  A +INL  ++  R ++ G+TLR R    K  I   ++  +WP +
Sbjct: 241 SADGRLIIIGMQGGTKA-QINLGDLLPLRRSVMGTTLRARPAEQKAHIVAEVRKHVWPAV 299

Query: 295 NSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            S  I P++  V  L     AH+ M++  H GKI+L
Sbjct: 300 ASGKIRPIVDRVFALDDCVQAHEHMDQP-HFGKIVL 334


>gi|88706460|ref|ZP_01104165.1| Zinc-containing alcohol dehydrogenase superfamily protein
           [Congregibacter litoralis KT71]
 gi|88699396|gb|EAQ96510.1| Zinc-containing alcohol dehydrogenase superfamily protein
           [Congregibacter litoralis KT71]
          Length = 346

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 143/331 (43%), Positives = 210/331 (63%), Gaps = 7/331 (2%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I ++  H+  S       + L E   P P  +E+LI+V A G+NR D++Q KGLYPPP +
Sbjct: 22  ITRRFVHIDES----DRSLSLQEDQAPVPGADEVLIEVAAAGLNRADLLQWKGLYPPPPD 77

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
           A+PI+GLEVAG +V  GE    +  GDEVCAL +GGGYA + ++ +G TL +P  +   +
Sbjct: 78  ASPIMGLEVAGTVVACGEAVNEFRPGDEVCALTHGGGYASHAIAPRGQTLAVPAAFELHE 137

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA+LPE+  TVW N+FQ A L++G+ VLIHGG+SGIGT  + +    GATV++TA SEEK
Sbjct: 138 AAALPEALLTVWHNVFQRAGLKAGENVLIHGGASGIGTLGVGICKAMGATVFSTAGSEEK 197

Query: 183 CLACLKLGAKHAINYLKEDFLEILQK-ETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           C     LGA  A NY KEDF+E L     +GR I +ILDMVG +Y+ ++  + + EG+++
Sbjct: 198 CRRVEALGASKAFNYKKEDFVEGLDALGLKGR-IAVILDMVGGDYIERNFEVAAPEGRIV 256

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I+FL G    ++N  P++ KR+T+TGSTLR +++  K  +   ++ +++  L+   I  
Sbjct: 257 NIAFLRG-FKADVNFLPLLLKRLTLTGSTLRAQSETQKAQMVREIREELFEHLDKGSIQA 315

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
           VI    PL +   A + ME   H+GKI+L P
Sbjct: 316 VIDREFPLAQAQEALEYMESGVHMGKILLRP 346


>gi|326504158|dbj|BAK02865.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 327

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 150/328 (45%), Positives = 211/328 (64%), Gaps = 3/328 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAE-SPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           MR VA++  G    + + E   +P P + E+L+ V A GVNR D  QR+G YPPP  A+P
Sbjct: 1   MRVVAIASPGGPEALQVREVDDLPPPGEGEVLVAVAAAGVNRADTAQRQGRYPPPPGASP 60

Query: 66  ILGLEVAGKIVDLGENTT-HWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
             GLE +G I+ LG N    W +GD+VCAL+ GGGYAE  +   G  LP+P+G +   AA
Sbjct: 61  YPGLECSGTILALGANVPPRWAVGDQVCALLTGGGYAEKVVVPAGQLLPVPEGVSLTDAA 120

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCL 184
            LPE   TVW+ +F T++L  G++ LIHGGSSGIGT AIQ+A + G  V+ TA +EEK  
Sbjct: 121 GLPEVACTVWSTVFMTSHLSPGESFLIHGGSSGIGTFAIQIAKHLGIKVFVTAGNEEKLA 180

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           AC  LGA   INY  EDF+  +++ET G+G+D+ILD +G  YL ++L  L+ +G+L II 
Sbjct: 181 ACKDLGADVCINYKTEDFVARVKEETNGKGVDVILDNIGGSYLQRNLNSLAVDGRLFIIG 240

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
           F+GG   TE+NL  ++++R+TI G+ LR R+   K  I   ++  +WP   S  + PVI+
Sbjct: 241 FMGGT-TTEVNLQAMLARRLTIQGAGLRNRSLANKAQIVSEVEKNVWPAFVSGKVKPVIY 299

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIILLP 332
              PL + A +H +ME S HIGKI+L+P
Sbjct: 300 KTFPLSEAAESHKLMETSSHIGKILLIP 327


>gi|240168548|ref|ZP_04747207.1| oxidoreductase [Mycobacterium kansasii ATCC 12478]
          Length = 323

 Score =  265 bits (677), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 135/299 (45%), Positives = 192/299 (64%), Gaps = 6/299 (2%)

Query: 35  EILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCAL 94
           E+L+KV A GVNR DV+Q  G YPPP  A+ I+G+EV+G +  +G + T W+ G EVCAL
Sbjct: 26  EVLVKVAAAGVNRADVLQAAGKYPPPPGASEIIGMEVSGTVASVGADVTDWSAGQEVCAL 85

Query: 95  VNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGG 154
           + GGGYAEY     G  +P+P     + AA+LPE   TVW+NL  TA+L  GQ +LIHGG
Sbjct: 86  LAGGGYAEYVAVPAGQVMPLPPNVGLVDAAALPEVACTVWSNLVMTAHLAPGQLLLIHGG 145

Query: 155 SSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRG 214
           +SGIGT AIQ+A   GA V  TA + EK   C  LGA+  INY  EDF+  L++E  G G
Sbjct: 146 ASGIGTHAIQVARALGARVAVTAGTPEKLELCRGLGAQITINYHDEDFVARLKQE--GPG 203

Query: 215 IDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR 274
            D+ILD++GA YL++++  L+ +G+L++I   GG +  E+NL  +++KR  I G+TLR R
Sbjct: 204 ADVILDIMGAAYLDRNIDALAVDGQLVVIGMQGG-VKAELNLGKLLTKRARIIGTTLRAR 262

Query: 275 TDI---AKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                  K +I  ++   +WP++ +  + PVI T LP+ + A AH +M   +  GKI+L
Sbjct: 263 PVTGPNGKSAIAQAVTASVWPMIANERVRPVIGTRLPIQQAAQAHQLMLSGKTYGKILL 321


>gi|147805941|emb|CAN61224.1| hypothetical protein VITISV_038808 [Vitis vinifera]
          Length = 314

 Score =  265 bits (677), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 198/326 (60%), Gaps = 12/326 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V ++  G    + + E   P+   +E+LI+VEA  +N+ D +QRKGL PPPK  +P 
Sbjct: 1   MKAVVITTPGDPQXLQVQEVENPEIGDDEVLIRVEAAAINQADTLQRKGLXPPPKGGSPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G I  +G     W +GD+VCAL++GGGYAE   +  G  LP+P G +   AA +
Sbjct: 61  PGLECSGIIEAVGXAVVRWKVGDQVCALLSGGGYAEKVAAPAGLVLPVPSGVSLXDAAGI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+++F  + L +G+T L+HGGSSGIG  AIQ+A + GA V+ TA +EEK   C
Sbjct: 121 PEVACTVWSSVFMXSXLSAGETFLVHGGSSGIGIFAIQIAKHIGARVFVTAGNEEKLXVC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY  EDF+  +++ET G+G+D+ILD +G  Y            +L II F 
Sbjct: 181 KDLGADVCINYKTEDFVARVKEETGGKGVDVILDTIGGAYF-----------QLFIIGFQ 229

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +A E+NL+ ++++R+T+  + LR R+   K  I   ++  +WP + +  +  V++  
Sbjct: 230 GGTVA-EVNLSGLLARRLTVQAAGLRNRSLENKAVIVSEVEKNVWPAIMAGKVKTVVYKY 288

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILLP 332
            PL   A AH +ME  +H GKI+L+P
Sbjct: 289 FPLTDAAEAHLLMESGKHFGKILLIP 314


>gi|258650552|ref|YP_003199708.1| NAD(P)H quinone oxidoreductase, PIG3 family [Nakamurella
           multipartita DSM 44233]
 gi|258553777|gb|ACV76719.1| NAD(P)H quinone oxidoreductase, PIG3 family [Nakamurella
           multipartita DSM 44233]
          Length = 343

 Score =  265 bits (677), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 142/327 (43%), Positives = 197/327 (60%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +   G    +   E P P P   ++LI V A  VNR D++Q  G YPPP  A   
Sbjct: 1   MKAIVVEQPGSPARLVWREVPDPVPGAGDVLINVAASAVNRADLLQAAGHYPPPPGAPDT 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I  LG + + W +GD VCAL+ GGGYA+      G  LP+P G + I+AA L
Sbjct: 61  LGLECSGVIAQLGPDVSGWRVGDRVCALLAGGGYAQRVAVPAGQVLPVPDGVDLIEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+NL  TA L +G+TVLIHGG SGIGT AIQ+A   GA V  TA  +     C
Sbjct: 121 PEVACTVWSNLVLTAGLTAGRTVLIHGGGSGIGTMAIQVAVQLGARVAVTASRDAVLDRC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+  INY ++DF+E +Q  T GRG D+ILD +GA+YL +++  L+  G+L+II   
Sbjct: 181 RTLGAQVTINYAQQDFVEAIQDATDGRGADVILDPIGAKYLARNIDALADGGRLVIIGLQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDI---AKQSIRDSLQLKIWPLLNSHVIAPVI 303
           GG  A E+++N ++ KR  + G+TLR R      +K  I + ++  +WPL+ +  + PVI
Sbjct: 241 GGTRA-ELDINGLMRKRAGVIGTTLRSRPIAGPGSKSEIVERVRTDLWPLVAAGAVRPVI 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            +VL L   A AH  M +  H+GKI+L
Sbjct: 300 DSVLDLPDAAAAHARMAEGGHVGKILL 326


>gi|313902921|ref|ZP_07836317.1| NAD(P)H quinone oxidoreductase, PIG3 family [Thermaerobacter
           subterraneus DSM 13965]
 gi|313466856|gb|EFR62374.1| NAD(P)H quinone oxidoreductase, PIG3 family [Thermaerobacter
           subterraneus DSM 13965]
          Length = 327

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 132/324 (40%), Positives = 197/324 (60%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +   G    + + E P P+P   E+L++V A  +NR D++QR+G+YPPP  A+P+
Sbjct: 1   MKAILVRQPGGVENLVMGEVPDPEPGPGELLVRVRATALNRADILQRRGMYPPPPGASPL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE AG++V LG     W+ GD V AL+ GGGYA+Y        LPIP   +  +AA++
Sbjct: 61  LGLEAAGEVVALGTGCEGWHPGDRVFALLPGGGYAQYVTVPAAMALPIPPNLSFEEAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+F T +  LF    L++G+ VLIH G+SG+GT AIQLA   GA V  TA +E K  AC
Sbjct: 121 PEAFLTAYQCLFWIGGLQAGEWVLIHAGASGVGTAAIQLARDAGARVAVTAGTEPKLEAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+ A+NY    F  ++++ T   G+ +ILD VGA Y  Q+L  L  +G+L++I+ +
Sbjct: 181 RQLGAEVAVNYKLGPFAPVIREATGQAGVQLILDFVGAPYWEQNLDCLGMDGRLVLIATM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +    +L  ++ KR+ ITG+TLR R+   K  +     ++  P L S  I PVI  +
Sbjct: 241 GGGVVDRFDLRRLMGKRLQITGTTLRSRSAEYKVQLTREFAVRYLPKLASGAIRPVIDRI 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P  +V  AH  ME++ + GKI+L
Sbjct: 301 FPWDQVREAHRYMERNRNTGKIVL 324


>gi|297193228|ref|ZP_06910626.1| quinone oxidoreductase [Streptomyces pristinaespiralis ATCC 25486]
 gi|197720498|gb|EDY64406.1| quinone oxidoreductase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 329

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 199/316 (62%), Gaps = 1/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G    +  AE P P P + E+L+ V A  VNR D++QR+G Y PP  ++P  GLE +G+I
Sbjct: 10  GGPEALVWAEVPDPVPGEGEVLVDVAASAVNRADLLQRQGFYDPPPGSSPYPGLECSGRI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
             +G   + W +GDEVCAL+ GGGYAE      G  LP+P G + I AA+LPE   TVW+
Sbjct: 70  SAVGPGVSGWAVGDEVCALLAGGGYAEKVAVPAGQLLPVPDGMDLITAAALPEVTATVWS 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  A+LR G+T+L+HGG+SGIGT A+QLA   GA V  TA S EK   C +LGA   I
Sbjct: 130 NVFMIAHLRPGETLLVHGGASGIGTMAVQLAKAVGARVAVTAGSSEKLARCAELGADILI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY ++DF+E + K T G G D+ILD+VGA+YL++++  L+  G+L +I   GG +  E+N
Sbjct: 190 NYREQDFVEEIGKATDGAGADVILDIVGAKYLDRNVKALAVNGRLAVIGLQGG-VKGELN 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L  ++ KR  +T ++LR R    K +I  +++  +WPL+    +  V+   +PL   A  
Sbjct: 249 LGALLRKRAAVTATSLRGRPLGEKAAIVAAVREHVWPLIGGGRVQAVVDRKVPLTDAAEG 308

Query: 316 HDIMEKSEHIGKIILL 331
           H  +E  +H+GK++L+
Sbjct: 309 HRALESGDHVGKVLLI 324


>gi|116750703|ref|YP_847390.1| alcohol dehydrogenase [Syntrophobacter fumaroxidans MPOB]
 gi|116699767|gb|ABK18955.1| Alcohol dehydrogenase, zinc-binding domain protein [Syntrophobacter
           fumaroxidans MPOB]
          Length = 333

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 135/315 (42%), Positives = 196/315 (62%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  N + + E P+PQ +++E++++V A  VNR D++QR+GLYPPP  A+ I+GL+ AG I
Sbjct: 18  GDWNELSIEEVPLPQVKQDEVIVQVHACSVNRADLLQRRGLYPPPLGASSIMGLDFAGTI 77

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
            ++G N   W    +V  +  GGGY  Y      H +PIP   + + AA+  E FFT + 
Sbjct: 78  TEVGSNVEGWEPWAKVFGITAGGGYGRYVAVPAAHLVPIPANLSFVDAAAAAEVFFTAFL 137

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  A + SG+T+LIHGG SG+GT AIQLA      V  TA SE+K   CL+LGA H I
Sbjct: 138 NIFLEAMIESGETLLIHGGGSGVGTAAIQLARAAAVRVIVTAGSEDKLQRCLELGAAHGI 197

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY ++DF   + + T+GRG+D+ILD +GA YL +HL +L   G+L++I  +GG   TEI 
Sbjct: 198 NYKEQDFAAEVLELTEGRGVDVILDWIGASYLEKHLRILKTRGRLVLIGLMGGT-RTEIQ 256

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L  +++KR+ I GS LR ++D  K ++  +    + PLL S  + PV+  V P+ KV  A
Sbjct: 257 LPVVLTKRLRIIGSVLRSQSDKEKAALVRAFTDWVLPLLESGKVRPVVDRVFPIDKVEEA 316

Query: 316 HDIMEKSEHIGKIIL 330
           H  M   EH GK++L
Sbjct: 317 HQYMLAGEHFGKLVL 331


>gi|159899763|ref|YP_001546010.1| quinone oxidoreductase putative PIG3 [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159892802|gb|ABX05882.1| Quinone oxidoreductase putative PIG3 [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 326

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 137/324 (42%), Positives = 200/324 (61%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +     G ++V+ LAE    QPQ  E+LI+V A  VNR D++QR+G+YP P  A+ I
Sbjct: 1   MQAIIFEQAGDADVLQLAEIADLQPQAGELLIRVYATAVNRADILQRRGMYPAPAGASEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE+AG+++  G   T   +G  VCAL+ GGGYA+  +      +PIP   +  QAA++
Sbjct: 61  LGLEIAGEVIGHGVGVTAPALGTRVCALLPGGGYAQQVVIPAELAMPIPANLSYEQAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE + T + NLF    L +G+ +L+HGGSSGIGT AIQLA + GA V  TA SE K   C
Sbjct: 121 PEVWMTAYDNLFNWGRLSAGERLLVHGGSSGIGTAAIQLARWRGAEVLITAGSEAKIARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY  E + E +Q  T+ +G+D++LDM+GA Y N +L  L   G+L+II+ +
Sbjct: 181 RELGAFAGINYRTEHWPERVQALTEQQGVDVVLDMLGASYFNDNLASLRVGGRLVIIATM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG   TE++L  ++ KR+T+ G+TLR R   AK ++   +   + P        PVI  V
Sbjct: 241 GGA-QTELDLRTLMLKRLTVCGTTLRARPIAAKAALTQQMLADVLPRFADGTFQPVIEAV 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L + + AH ++E S+H+GKI+L
Sbjct: 300 FDLAEASAAHRLLESSQHVGKIVL 323


>gi|289642589|ref|ZP_06474731.1| NAD(P)H quinone oxidoreductase, PIG3 family [Frankia symbiont of
           Datisca glomerata]
 gi|289507584|gb|EFD28541.1| NAD(P)H quinone oxidoreductase, PIG3 family [Frankia symbiont of
           Datisca glomerata]
          Length = 331

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 137/327 (41%), Positives = 203/327 (62%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAE-SPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           MR V ++ +G   VM  AE   +  P   EI I V A  VNR D++QR+G YPPP  A+ 
Sbjct: 1   MRAVTVASFGAPEVMSWAEVDDLAPPGPGEIAIDVVASAVNRADLLQRQGFYPPPPGASA 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           +LG+E +G++  +G   T W  GDEVCAL+ GGGYA       GH LP+P G + ++AA 
Sbjct: 61  VLGMECSGRVAAVGAGVTAWQPGDEVCALLAGGGYATRVNVPAGHVLPVPAGVSLLEAAG 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYF--GATVYTTAKSEEKC 183
           LPE+  TV + +F  A+LR G+  L+HGG+SGIGT AIQ        +T+ TTA S  K 
Sbjct: 121 LPEAAATVHSTVFGVADLRDGEVFLVHGGASGIGTFAIQAVRALRPSSTIATTAGSPAKL 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
           +   +LGA  AI+Y  EDF++ +++ T GRG D+ILD +G  YL +++  L+ EG++++I
Sbjct: 181 VRVRELGADLAISYRDEDFVDRVREATGGRGADVILDNMGGAYLARNVEALAVEGRIVVI 240

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
              GG    E+NL  +++KR ++   +LR R D  K +I   ++ +IWP + +  I PVI
Sbjct: 241 GLQGGR-KGELNLAALLAKRGSVHALSLRARPDERKAAIVADVRERIWPAVEAGAIRPVI 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             V+P+ KVA AH  +E+  H+GK++L
Sbjct: 300 DQVVPIEKVADAHRHVEELGHVGKVLL 326


>gi|291297794|ref|YP_003509072.1| NAD(P)H quinone oxidoreductase PIG3 family [Stackebrandtia
           nassauensis DSM 44728]
 gi|290567014|gb|ADD39979.1| NAD(P)H quinone oxidoreductase, PIG3 family [Stackebrandtia
           nassauensis DSM 44728]
          Length = 324

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 136/324 (41%), Positives = 201/324 (62%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++  G    + + ++P P P   E++I+V A G+NR D  QR+G YPPP+ A+P 
Sbjct: 1   MRAVEIAEPGGPEALKVIDAPDPIPGSGEVVIEVAAAGINRADAAQRRGKYPPPEGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G+I+ +G      ++GDEVCAL++GGGYAE         LPIP G + + AA L
Sbjct: 61  PGLEVSGRIIAIGPGVAGVSVGDEVCALLSGGGYAERVAVDARLLLPIPDGVDLVDAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+FQ A L  G+ +L+HGGS GIGT AIQLA+  G  V TTA+S     A 
Sbjct: 121 PEVAATVWSNVFQIARLTEGEMLLVHGGSGGIGTFAIQLATARGCGVLTTARS-HNADAL 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+  I+Y  +DF E +   T GRG+D+ILD +GA YL++++  L+  G+L IIS  
Sbjct: 180 RGLGAELVIDYRDQDFAEEVATHTDGRGVDVILDHLGASYLDRNVASLNLNGRLAIISMQ 239

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG+  TE NL  ++ +R +++ +TLR R    +  I  +++  +WP + S  + PV+   
Sbjct: 240 GGS-KTEFNLGALMRRRGSVSATTLRSRPIGERADIIAAVRDNVWPQVASGQVKPVVAQR 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL  V  AH +++   ++GKI+L
Sbjct: 299 FPLADVVEAHRVLDAGGYLGKILL 322


>gi|169627312|ref|YP_001700961.1| quinone oxidoreductase [Mycobacterium abscessus ATCC 19977]
 gi|169239279|emb|CAM60307.1| Probable quinone oxidoreductase [Mycobacterium abscessus]
          Length = 328

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 134/327 (40%), Positives = 197/327 (60%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +   E P P P   EILI V A   NR D++QR+GLY PP  A+ I
Sbjct: 1   MHAITVDNPGGPEALRWTEVPDPVPGPGEILIDVTAAAANRADLLQRRGLYSPPPGASSI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G +  LG +  HW++G  VCAL++GGGYAE  ++     LP+P       AA+L
Sbjct: 61  LGLECSGTVAALGADVAHWSVGQPVCALLSGGGYAEKVVAPATQLLPVPTNVQLDVAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+  T  + +GQ++LIHGG+SGIGT  IQ+A   G  V  TA + EK  AC
Sbjct: 121 PEVACTVWSNMMMTTKMSAGQSILIHGGASGIGTHTIQVAKALGLRVAVTAGTPEKLDAC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA  AINY   DF++ +   T G G+D ILD++GA+YL++++  L  +G L+II   
Sbjct: 181 RDLGADLAINYRDTDFVQAVHSFTDGSGVDRILDIMGAKYLSRNVDALGNDGHLVIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRT---DIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           GG +  E+N+  +I+KR ++T +TLR R       K +I +S+   +WPL+ +  + PV+
Sbjct: 241 GG-VTAELNIAKLIAKRGSLTATTLRARPIAGPCGKAAIVESVAQNLWPLVEAGKVRPVV 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
              +PL + A AH ++E    +GK++L
Sbjct: 300 GAEIPLSQAAEAHRLLENGAVVGKVLL 326


>gi|315506827|ref|YP_004085714.1| nad(p)h quinone oxidoreductase, pig3 family [Micromonospora sp. L5]
 gi|315413446|gb|ADU11563.1| NAD(P)H quinone oxidoreductase, PIG3 family [Micromonospora sp. L5]
          Length = 324

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 200/325 (61%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++  G    +     P P+P   E++++V A  VNR D++QR+G YPPP  A+  
Sbjct: 1   MRAVTITEPGGPEALVWTHVPDPEPGPGEVIVEVRASAVNRADLLQRQGHYPPPPGASAY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G +  LG   T W++G EVCAL+ GGGYAE      G  LP+P G + + AA+L
Sbjct: 61  PGLECSGTVRALGPGVTGWSVGQEVCALLAGGGYAEQVAVPAGQLLPVPAGVDLVDAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+   A L  G T+L+HGG SGIGT AIQ     GATV  TA+S  K    
Sbjct: 121 PEVACTVWSNVVDLARLAEGDTLLVHGGGSGIGTFAIQFGVALGATVVVTARS-AKHDRL 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA H I+Y ++DF++ +++ T GRG D+ILD++GA YL +++  L+  G+L++I   
Sbjct: 180 RELGAAHTIDYREQDFVDEVRRVTDGRGADVILDIMGASYLPRNVAALATGGRLVVIGMQ 239

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG    E++L  +++KR  +  + LR R    K +I   ++ ++WPL+ +  I PV+H  
Sbjct: 240 GGR-KGELDLGMLLAKRAAVHATALRSRPVEGKAAIVRGVREQVWPLVEAGRIRPVVHAR 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           + +   A AH ++E ++H+GK++L+
Sbjct: 299 VDMADAAAAHRLVETNDHLGKVLLV 323


>gi|311897262|dbj|BAJ29670.1| putative oxidoreductase [Kitasatospora setae KM-6054]
          Length = 327

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 139/324 (42%), Positives = 202/324 (62%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +   G    +  AE P P P   E+L++V A  VNR D++QR+G Y PP  ++P 
Sbjct: 1   MRAITIPEPGGPERLVWAEVPDPVPAAGEVLVEVAATAVNRADLLQRQGFYDPPPGSSPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG+I  LG     W +GDEVCAL+ GGGYA+      G  LP+PKG    QAA+L
Sbjct: 61  PGLECAGRIAALGPGVAGWAVGDEVCALLAGGGYAQRVAVPVGQLLPVPKGLTPQQAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+FQ A+LR G+TVL+HGG+SGIGT AIQLA   GA V  TA   EK   C
Sbjct: 121 PEVACTVWSNVFQVAHLRPGETVLLHGGASGIGTMAIQLAKAVGARVAVTAGGPEKLARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   I+Y ++DF+  L       G D+ILD++GA+YL +++  L+  G+L++I   
Sbjct: 181 AELGADLLIDYRRQDFVAELAALG---GADVILDIIGAKYLERNVEALAVNGRLVVIGLQ 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E+NL+ ++++R  +  + LR R    K +I  +++  +WPL+ + V+ PV+  V
Sbjct: 238 GGAKA-EVNLSTLLARRAALVATNLRGRPLGEKAAIVAAVREHVWPLVEAGVVRPVVDRV 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LP+ + A AH ++E    +GK++L
Sbjct: 297 LPIAEAAEAHRVVEAGAQVGKVVL 320


>gi|114571119|ref|YP_757799.1| alcohol dehydrogenase [Maricaulis maris MCS10]
 gi|114341581|gb|ABI66861.1| Alcohol dehydrogenase, zinc-binding domain protein [Maricaulis
           maris MCS10]
          Length = 332

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 139/316 (43%), Positives = 190/316 (60%), Gaps = 4/316 (1%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  +V+ +   PIP P   EILI+  A GVNRPD ++R G YP P  A   LGLEVAG +
Sbjct: 20  GGPDVLDVVARPIPSPAAGEILIRNTACGVNRPDQIERLGFYPAPPGAPEGLGLEVAGHV 79

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
             LGE  T +  GD VCALV GGGYA Y L+  G  LP+P+G     AA LPE+ FTVW 
Sbjct: 80  EALGEGVTGYKAGDPVCALVAGGGYAAYSLAPAGSVLPVPEGVPVEDAAGLPETVFTVWT 139

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F+   L   +T+L+HGG+SGIG+TAIQLA   GA V  TA + EK   C +LGA  AI
Sbjct: 140 NVFEIGALSRDETLLVHGGTSGIGSTAIQLAKAAGARVIATAGTPEKVAQCRQLGADIAI 199

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY   DF  ++   T+  G D+ILDMVG  Y+ +++       ++  I+FL G+   E++
Sbjct: 200 NYRDTDFETVV---TEAGGADVILDMVGGGYVQKNINCARVGARIASIAFLAGS-RVEVD 255

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L  ++ KRIT+TGSTLR R    K  +  +++  +WP +    + P+I +   L     A
Sbjct: 256 LMRVMLKRITLTGSTLRARPVEEKARLAQAVRQTVWPWIADGKMRPLIDSRFDLDDARSA 315

Query: 316 HDIMEKSEHIGKIILL 331
           H+ ++  EH GKI+LL
Sbjct: 316 HERLDSGEHAGKILLL 331


>gi|302520553|ref|ZP_07272895.1| quinone oxidoreductase [Streptomyces sp. SPB78]
 gi|302429448|gb|EFL01264.1| quinone oxidoreductase [Streptomyces sp. SPB78]
          Length = 297

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/282 (44%), Positives = 188/282 (66%), Gaps = 1/282 (0%)

Query: 49  DVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQ 108
           D++QR+G Y PP  A+P  GLEV+G+I  LG   + W +GDEVCAL+ GGGYAE      
Sbjct: 14  DLLQRQGFYDPPPGASPYPGLEVSGRIAALGAGVSGWAVGDEVCALLGGGGYAEKVAVPA 73

Query: 109 GHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASY 168
           G  LP+P G + ++AA+LPE   TVW+N+F  A LR G+T+L+HGGSSGIGT AIQLA  
Sbjct: 74  GQLLPVPSGVDLVEAAALPEVVCTVWSNVFMVAGLRPGETLLVHGGSSGIGTMAIQLAKA 133

Query: 169 FGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLN 228
             A V  TA +  K  +C +LGA   INY ++DF+  L K T+G G D+ILD +GA+YL+
Sbjct: 134 VDARVAVTAGTAAKLESCRELGADTLINYREQDFVAELGKATEGHGADVILDNMGAKYLD 193

Query: 229 QHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQL 288
           +++  L+  G+L II   GG +  E+NL+ +++KR  +T ++LR R    K ++  +++ 
Sbjct: 194 RNIQALATSGRLAIIGMQGG-VKGELNLSALMNKRAAVTATSLRARPAAEKAAVVAAVRE 252

Query: 289 KIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            +WPLL+S  + PV+   +P+ + A  H ++++S HIGK++L
Sbjct: 253 HVWPLLSSGAVKPVVDRRIPMSEAATGHRVLDESTHIGKVLL 294


>gi|149927538|ref|ZP_01915792.1| probable zinc-binding dehydrogenase [Limnobacter sp. MED105]
 gi|149823811|gb|EDM83037.1| probable zinc-binding dehydrogenase [Limnobacter sp. MED105]
          Length = 339

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 141/324 (43%), Positives = 207/324 (63%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +   G ++ + L E P+P P+  E+L++V A GVNRPDV+QR GLYPPP +ANP 
Sbjct: 13  MKAVGVKAPGGADQLELIELPVPLPKPGEVLVQVRAAGVNRPDVLQRLGLYPPPPDANPN 72

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEV+G +V +G+  +   +G  V AL NGGGYAEY  +  G  + IP+G +  +AASL
Sbjct: 73  LGLEVSGVVVAVGQGVSESMLGTPVMALCNGGGYAEYACAPAGQCMQIPEGLSFTEAASL 132

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE + TVW NLF     +SGQTVLIHGGSSGIGT AIQL    G   + T  ++EK   C
Sbjct: 133 PEVYMTVWQNLFMKGGAKSGQTVLIHGGSSGIGTAAIQLCKKHGLRTFVTVGNQEKADFC 192

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA+ A  Y  +D+ +++ ++TQ +G+D+ILDMV  EYLN+ L+ +  +G +I+I+ L
Sbjct: 193 LGLGAEKAYLYKTQDWEQLVLQDTQHQGVDLILDMVAGEYLNKDLSCVRPQGMVIVIALL 252

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A  I+   +++K++ +TG+TLR R+   K  +   +  ++    +S V+  ++   
Sbjct: 253 GGRFAN-IDAAKLMTKQVVLTGTTLRPRSAEFKAELARQVGHELKEGFSSGVLKSLVQAT 311

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
             L  VA AH +ME    +GKI+L
Sbjct: 312 FALDDVAKAHLLMESGNSLGKIVL 335


>gi|260198826|ref|ZP_05766317.1| oxidoreductase [Mycobacterium tuberculosis T46]
 gi|289441214|ref|ZP_06430958.1| oxidoreductase [Mycobacterium tuberculosis T46]
 gi|289414133|gb|EFD11373.1| oxidoreductase [Mycobacterium tuberculosis T46]
          Length = 328

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 198/317 (62%), Gaps = 4/317 (1%)

Query: 17  KSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIV 76
            S+ +   E P       E+LIKV A GVNR DV+Q  G YPPP   + I+GLEV+G + 
Sbjct: 11  SSDRLVWQEVPDVSAGPGEVLIKVAASGVNRADVLQAAGKYPPPPGVSDIIGLEVSGIVA 70

Query: 77  DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWAN 136
            +G   T W+ G EVCAL+ GGGYAEY        LPIP   N + +A+LPE   TVW+N
Sbjct: 71  AVGPGVTEWSAGQEVCALLAGGGYAEYVAVPADQVLPIPPSVNLVDSAALPEVACTVWSN 130

Query: 137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAIN 196
           L  TA+LR GQ VLIHGG+SGIGT AIQ+A    A V  TA S EK   C  LGA+  IN
Sbjct: 131 LVMTAHLRPGQLVLIHGGASGIGTHAIQVARALAARVAITAGSPEKLELCRDLGAQITIN 190

Query: 197 YLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINL 256
           Y  EDF+  L++ET G G DIILD++GA YL++++  L+ +G+LI+I   GG +  E+NL
Sbjct: 191 YRDEDFVARLKQETDGSGADIILDIMGASYLDRNIDALATDGQLIVIGMQGG-VKAELNL 249

Query: 257 NPIISKRITITGSTLRRRT---DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA 313
             +++KR  + G+TLR R       K +I  ++   +WP++ ++ + PVI T LP+ + A
Sbjct: 250 GKLLTKRARVIGTTLRARPVSGPHGKAAIAQAVAASVWPMIAANRVRPVIGTRLPIQQAA 309

Query: 314 MAHDIMEKSEHIGKIIL 330
            AH++M   +  GKI+L
Sbjct: 310 QAHELMLSGKTFGKILL 326


>gi|302870590|ref|YP_003839227.1| NAD(P)H quinone oxidoreductase, PIG3 family [Micromonospora
           aurantiaca ATCC 27029]
 gi|302573449|gb|ADL49651.1| NAD(P)H quinone oxidoreductase, PIG3 family [Micromonospora
           aurantiaca ATCC 27029]
          Length = 324

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 200/325 (61%), Gaps = 2/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++  G    +     P P+P   E++++V A  VNR D++QR+G YPPP  A+  
Sbjct: 1   MRAVTITEPGGPEALVWTHVPDPEPGPGEVIVEVRASAVNRADLLQRQGHYPPPPGASAY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G +  LG   T W++G EVCAL+ GGGYAE      G  LP+P G + + AA+L
Sbjct: 61  PGLECSGTVRALGPGVTGWSVGQEVCALLAGGGYAEQVAVPAGQLLPVPAGVDLVDAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+   A L  G T+L+HGG SGIGT AIQL    GATV  TA+   K    
Sbjct: 121 PEVACTVWSNVVDLARLAEGDTLLVHGGGSGIGTFAIQLGVALGATVVVTARP-AKHDRL 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA H I+Y ++DF++ +++ T GRG D+ILD++GA YL +++  L+  G+L++I   
Sbjct: 180 RELGAAHTIDYREQDFVDEVRRVTDGRGADVILDIMGASYLPRNVAALATGGRLVVIGMQ 239

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG    E++L  +++KR  +  + LR R    K +I   ++ ++WPL+ +  I PV+H  
Sbjct: 240 GGR-KGELDLGMLLAKRAAVHATALRSRPVEGKAAIVRGVREQVWPLVEAGRIRPVVHAR 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           + +   A AH ++E ++H+GK++L+
Sbjct: 299 VDMADAAAAHRLVETNDHLGKVLLV 323


>gi|317507754|ref|ZP_07965458.1| zinc-binding dehydrogenase [Segniliparus rugosus ATCC BAA-974]
 gi|316253953|gb|EFV13319.1| zinc-binding dehydrogenase [Segniliparus rugosus ATCC BAA-974]
          Length = 326

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 144/329 (43%), Positives = 214/329 (65%), Gaps = 6/329 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +  +G ++ M LAE+  P+P  +++LI+V A GVNR DV QR+G YPPP  A+ +
Sbjct: 1   MRAITLPAFGDADAMVLAEAARPEPGPQDVLIEVVASGVNRADVAQRQGFYPPPPGASDL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEV+G++V++G+ T  W +GDEVCAL+ GGGYA+Y ++HQ   LP+P G    +AA+L
Sbjct: 61  LGLEVSGRVVEVGDRTEGWTVGDEVCALLPGGGYAQYAVAHQSCVLPVPPGVTLAEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+  TVW NL     LR+G  VL+HGG SGIGT AIQ+A+ FGA V  TA S+ K   C
Sbjct: 121 PEAAATVWLNLGMIGGLRAGDRVLVHGGGSGIGTHAIQVAAAFGAEVAVTA-SQGKAERC 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+  ++Y  +DF E L +E    G + +LD +G  YL ++L +L+ +GK+++I+ +
Sbjct: 180 EELGARIVVDYKADDFAEAL-RERWPEGANFVLDHIGGPYLARNLQVLALDGKIVVIATM 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRT---DIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           GG   TE+NL  + +KR ++ GSTLR R     + K  +   ++  +WPL+ +  + PV+
Sbjct: 239 GGA-KTELNLLALHAKRASLIGSTLRNRAIDGPLGKAEVIRQVREHVWPLIAAGRVRPVL 297

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
               PL + A AH  +E  E  GK +LLP
Sbjct: 298 GRTFPLAEAAAAHRALEAGEIFGKAVLLP 326


>gi|325962169|ref|YP_004240075.1| NAD(P)H quinone oxidoreductase, PIG3 family [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323468256|gb|ADX71941.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 327

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 140/327 (42%), Positives = 203/327 (62%), Gaps = 3/327 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +S  G   V+ + E+  P P   E+LI V A G+NR DV QR+G YPPP  A+ I
Sbjct: 1   MKAVFISEPGGPEVLEVRETEAPVPGNGEVLIDVVAAGLNRADVQQRRGFYPPPPGASEI 60

Query: 67  LGLEVAGKIVDLGENTTH-WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
            GLEV+G+I   G      +++GD+V AL+ GGGYA+         L +P+G + + AA+
Sbjct: 61  PGLEVSGRIAGFGPGVKKAFSLGDKVVALLAGGGYAQQVAVPAEQVLRVPEGVDLVTAAA 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC-L 184
           LPE   TV++NL  TA L++G+TVLIHG + GIGT AIQLA   GA V  TA S+EK   
Sbjct: 121 LPEVAATVYSNLVMTAQLQAGETVLIHGATGGIGTMAIQLAKALGARVAATAGSDEKVGT 180

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           A   LGA  AINY +EDF E L+++  G+G D+ILD+VGA+YL Q++  L+  G+L++I 
Sbjct: 181 AKAFLGADIAINYAEEDFPESLRRQNGGKGADVILDVVGAKYLAQNVDALADYGRLVVIG 240

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
             GG    E++L  ++ KR  +  + LR R    K +I ++++  +WPL++   I P++ 
Sbjct: 241 LQGGT-KGELDLGQLLKKRAAVVATALRPRPVAEKGAIMNAVREAVWPLVSDGSIRPLVA 299

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIILL 331
              PL +V  AH   +  EH+GKI+LL
Sbjct: 300 KTFPLDQVRAAHRYFDTGEHVGKILLL 326


>gi|220911602|ref|YP_002486911.1| NAD(P)H quinone oxidoreductase, PIG3 family [Arthrobacter
           chlorophenolicus A6]
 gi|219858480|gb|ACL38822.1| NAD(P)H quinone oxidoreductase, PIG3 family [Arthrobacter
           chlorophenolicus A6]
          Length = 327

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 138/327 (42%), Positives = 205/327 (62%), Gaps = 3/327 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +S  G   V+ + E   P P   E+LI V A G+NR DV QR+G YPPP  A+ I
Sbjct: 1   MKAVYISEPGGPEVLEVREVEAPVPGPGEVLIDVVAAGLNRADVQQRRGFYPPPPGASEI 60

Query: 67  LGLEVAGKIVDLGENTTH-WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
            GLEV+G+I   G   T  +++GD+V AL+ GGGYA+         L +P G + + AAS
Sbjct: 61  PGLEVSGRIAGFGTGVTKPFSLGDKVVALLAGGGYAQQVAVPAEQVLRLPDGVDLVTAAS 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK-CL 184
           LPE   TV++NL  TA L++G+TVLIHG + GIGT AIQLA  +GA V TTA ++EK   
Sbjct: 121 LPEVAATVYSNLVMTAQLQAGETVLIHGATGGIGTMAIQLAKAYGAKVATTAGTDEKVST 180

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           A   LGA  AINY +EDF E L+++  G+G D+ILD+VGA+YL Q++  L++ G+L++I 
Sbjct: 181 AKAFLGADIAINYAEEDFPESLRRQNGGKGADVILDVVGAKYLKQNIEALAEYGRLVVIG 240

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
             GG    E++L  ++ KR  +  + LR R    K +I + ++  +WP++    I P++ 
Sbjct: 241 LQGGT-KGELDLGELLRKRAAVVATALRPRPVAEKGAILNEVRDHVWPMVADGRIQPLVA 299

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIILL 331
              PL +V+ AH+  +  +H+GK++L+
Sbjct: 300 RTFPLDQVSAAHEYFDSGDHVGKVLLV 326


>gi|148553056|ref|YP_001260638.1| quinone oxidoreductase putative, PIG3 [Sphingomonas wittichii RW1]
 gi|148498246|gb|ABQ66500.1| Quinone oxidoreductase putative, PIG3 [Sphingomonas wittichii RW1]
          Length = 331

 Score =  262 bits (670), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 139/316 (43%), Positives = 203/316 (64%), Gaps = 2/316 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G   ++     P+P P   ++LI+V A GVNRPDV QR G YPPP  A  ILGLEVAG++
Sbjct: 17  GGPEILRPVRRPVPGPGPGQVLIRVAAAGVNRPDVAQRNGAYPPPPGAPSILGLEVAGEV 76

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V LGE      +G  VCALV GGGYA+Y  +  G  L +P   + ++AA++PE+ FTVW+
Sbjct: 77  VALGEGALPELLGQPVCALVAGGGYADYVAAEAGLCLSVPNTLSMVEAAAIPETLFTVWS 136

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+++ A    G  +L+HGG+SGIGT AI L   F      TA S+EKC A +KLGA HAI
Sbjct: 137 NVYERAYAADGDRLLVHGGTSGIGTMAILLGRIFQVETIVTAGSDEKCAAAIKLGAAHAI 196

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY  +D++  + + T G+G+DI+LDMVG  Y+ ++L  L+++G+ + I+ LGG  A EI 
Sbjct: 197 NYRSQDYVAEVARITGGKGVDIVLDMVGGAYVPRNLDCLAEDGRHVSIAVLGGAKA-EIP 255

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           +  I+ KR+T+TGSTLR R+   K ++ D +   +WP +    + PVI    PL + A A
Sbjct: 256 IWKIMQKRLTLTGSTLRPRSVAFKTAVADEIASVVWPHVEEGRLKPVIDATFPLAQAADA 315

Query: 316 HDIMEKSEHIGKIILL 331
           H  +++ +H+GK++L+
Sbjct: 316 HRRLDE-DHVGKVVLV 330


>gi|15843400|ref|NP_338437.1| quinone oxidoreductase [Mycobacterium tuberculosis CDC1551]
 gi|31794950|ref|NP_857443.1| putative oxidoreductase [Mycobacterium bovis AF2122/97]
 gi|121639694|ref|YP_979918.1| putative oxidoreductase [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|215405833|ref|ZP_03418014.1| oxidoreductase [Mycobacterium tuberculosis 02_1987]
 gi|215413706|ref|ZP_03422374.1| oxidoreductase [Mycobacterium tuberculosis 94_M4241A]
 gi|215425025|ref|ZP_03422944.1| oxidoreductase [Mycobacterium tuberculosis T92]
 gi|215432757|ref|ZP_03430676.1| oxidoreductase [Mycobacterium tuberculosis EAS054]
 gi|215448124|ref|ZP_03434876.1| oxidoreductase [Mycobacterium tuberculosis T85]
 gi|219559864|ref|ZP_03538940.1| oxidoreductase [Mycobacterium tuberculosis T17]
 gi|224992189|ref|YP_002646879.1| putative oxidoreductase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|254366324|ref|ZP_04982368.1| hypothetical oxidoreductase [Mycobacterium tuberculosis str.
           Haarlem]
 gi|260184701|ref|ZP_05762175.1| oxidoreductase [Mycobacterium tuberculosis CPHL_A]
 gi|289445378|ref|ZP_06435122.1| oxidoreductase [Mycobacterium tuberculosis CPHL_A]
 gi|289572026|ref|ZP_06452253.1| oxidoreductase [Mycobacterium tuberculosis T17]
 gi|289747619|ref|ZP_06506997.1| quinone oxidoreductase [Mycobacterium tuberculosis 02_1987]
 gi|289748298|ref|ZP_06507676.1| oxidoreductase [Mycobacterium tuberculosis T92]
 gi|289755910|ref|ZP_06515288.1| quinone oxidoreductase [Mycobacterium tuberculosis EAS054]
 gi|289759943|ref|ZP_06519321.1| oxidoreductase [Mycobacterium tuberculosis T85]
 gi|294995310|ref|ZP_06801001.1| oxidoreductase [Mycobacterium tuberculosis 210]
 gi|298527251|ref|ZP_07014660.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|13883766|gb|AAK48251.1| quinone oxidoreductase [Mycobacterium tuberculosis CDC1551]
 gi|31620548|emb|CAD95992.1| PUTATIVE OXIDOREDUCTASE [Mycobacterium bovis AF2122/97]
 gi|121495342|emb|CAL73829.1| Putative oxidoreductase [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|134151836|gb|EBA43881.1| hypothetical oxidoreductase [Mycobacterium tuberculosis str.
           Haarlem]
 gi|224775305|dbj|BAH28111.1| putative oxidoreductase [Mycobacterium bovis BCG str. Tokyo 172]
 gi|289418336|gb|EFD15537.1| oxidoreductase [Mycobacterium tuberculosis CPHL_A]
 gi|289545780|gb|EFD49428.1| oxidoreductase [Mycobacterium tuberculosis T17]
 gi|289688147|gb|EFD55635.1| quinone oxidoreductase [Mycobacterium tuberculosis 02_1987]
 gi|289688885|gb|EFD56314.1| oxidoreductase [Mycobacterium tuberculosis T92]
 gi|289696497|gb|EFD63926.1| quinone oxidoreductase [Mycobacterium tuberculosis EAS054]
 gi|289715507|gb|EFD79519.1| oxidoreductase [Mycobacterium tuberculosis T85]
 gi|298497045|gb|EFI32339.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|323717644|gb|EGB26846.1| oxidoreductase [Mycobacterium tuberculosis CDC1551A]
 gi|326905617|gb|EGE52550.1| oxidoreductase [Mycobacterium tuberculosis W-148]
          Length = 328

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 198/317 (62%), Gaps = 4/317 (1%)

Query: 17  KSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIV 76
            S+ +   E P       E+LIKV A GVNR DV+Q  G YPPP   + I+GLEV+G + 
Sbjct: 11  SSDRLVWQEVPDVSAGPGEVLIKVAASGVNRADVLQAAGKYPPPPGVSDIIGLEVSGIVA 70

Query: 77  DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWAN 136
            +G   T W+ G EVCAL+ GGGYAEY        LPIP   N + +A+LPE   TVW+N
Sbjct: 71  AVGPGVTEWSAGQEVCALLAGGGYAEYVAVPADQVLPIPPSVNLVDSAALPEVACTVWSN 130

Query: 137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAIN 196
           L  TA+LR GQ VLIHGG+SGIG+ AIQ+A    A V  TA S EK   C  LGA+  IN
Sbjct: 131 LVMTAHLRPGQLVLIHGGASGIGSHAIQVARALAARVAITAGSPEKLELCRDLGAQITIN 190

Query: 197 YLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINL 256
           Y  EDF+  L++ET G G DIILD++GA YL++++  L+ +G+LI+I   GG +  E+NL
Sbjct: 191 YRDEDFVARLKQETDGSGADIILDIMGASYLDRNIDALATDGQLIVIGMQGG-VKAELNL 249

Query: 257 NPIISKRITITGSTLRRRT---DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA 313
             +++KR  + G+TLR R       K +I  ++   +WP++ ++ + PVI T LP+ + A
Sbjct: 250 GKLLTKRARVIGTTLRARPVSGPHGKAAIAQAVAASVWPMIAANRVRPVIGTRLPIQQAA 309

Query: 314 MAHDIMEKSEHIGKIIL 330
            AH++M   +  GKI+L
Sbjct: 310 QAHELMLSGKTFGKILL 326


>gi|296392824|ref|YP_003657708.1| PIG3 family NAD(P)H quinone oxidoreductase [Segniliparus rotundus
           DSM 44985]
 gi|296179971|gb|ADG96877.1| NAD(P)H quinone oxidoreductase, PIG3 family [Segniliparus rotundus
           DSM 44985]
          Length = 326

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 137/318 (43%), Positives = 193/318 (60%), Gaps = 5/318 (1%)

Query: 17  KSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIV 76
               MFLAE+P P+P   ++LI+V A GVNR D+ QR G YPPP  A+ ILGLEVAG+I 
Sbjct: 10  DGEAMFLAEAPRPEPGPRDVLIEVAAAGVNRADLAQRAGAYPPPPGASQILGLEVAGRIA 69

Query: 77  DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWAN 136
           ++G   T W +GDEVCAL+ GGGYA+Y ++H+   LP+P G    +AA LPE   TVW N
Sbjct: 70  EIGGEVTDWAVGDEVCALLAGGGYAQYAVAHEACVLPVPPGATLAEAAGLPEVAATVWLN 129

Query: 137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAIN 196
           L     L  G+ VLIHGG SG+GT A+QL    GA    TA S+ K   C +LGA+  I+
Sbjct: 130 LGMIGGLAPGRRVLIHGGGSGVGTHAVQLVRAVGAEAAVTA-SQGKADRCRELGAQIVID 188

Query: 197 YLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINL 256
           Y  EDF ++L++     G D++LD +G  YL + L +L  +GK+++I+ +GG  A +I+L
Sbjct: 189 YRTEDFADVLRRRWP-DGADLVLDHIGGPYLARDLKVLGLDGKILLIASIGGRHAEQIDL 247

Query: 257 NPIISKRITITGSTLRRRT---DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA 313
             +  KR ++ GSTLR R     + K +I   ++  +WPL+    + PV+    PL +  
Sbjct: 248 GALQLKRASVIGSTLRNRATGGTLGKAAIIAQVREHVWPLIAEGTVKPVLDRTFPLAEAE 307

Query: 314 MAHDIMEKSEHIGKIILL 331
            AH  +   E  GK +LL
Sbjct: 308 AAHRALAAGEIFGKTVLL 325


>gi|304319989|ref|YP_003853632.1| NADPH/quinone reductase and related Zn-dependent oxidoreductase
           [Parvularcula bermudensis HTCC2503]
 gi|303298892|gb|ADM08491.1| NADPH/quinone reductase and related Zn-dependent oxidoreductase
           [Parvularcula bermudensis HTCC2503]
          Length = 327

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 203/324 (62%), Gaps = 5/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR +A++  G    +  A+ P P P   +IL+ V A GVNRPD +QR+GLYPPPK A+P+
Sbjct: 1   MRCIAITSPGGPEALVPADRPAPLPGPGQILVAVAAAGVNRPDALQRQGLYPPPKGASPL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG +   GE  T   +G  V AL+ GGGYAE       H LP+P   + ++AA++
Sbjct: 61  PGLEIAGTVSGHGEGVTSPPLGTRVMALLPGGGYAETVAVDARHILPLPDDLSFVEAAAM 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ FTV+ANL +   L  G  VL+HG +SGIGT AI+LA+ +GA ++ TA + ++C A 
Sbjct: 121 PETLFTVFANLIEAGQLVEGARVLVHGLTSGIGTMAIRLATAYGAFIWGTAGTADRCRAA 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA    +Y +ED+   L  E     +DI+LDM+G +Y+ ++L LL+  G+ + I+FL
Sbjct: 181 EALGAVRCYDYRQEDWAAALSTEPP---MDIVLDMIGGDYVAKNLGLLAIGGRHVSIAFL 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  AT I +  ++++R+ +TGSTLR R+D  K  +  ++   + P++    + PVI +V
Sbjct: 238 GGAKAT-IPIPLVMTRRLHLTGSTLRSRSDEEKARLTAAIAQHVLPMIAEGTVRPVIDSV 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + A AH  ++   HIGKI+L
Sbjct: 297 FPLAEAADAHRRLDD-HHIGKIVL 319


>gi|221236338|ref|YP_002518775.1| quinone oxidoreductase [Caulobacter crescentus NA1000]
 gi|220965511|gb|ACL96867.1| quinone oxidoreductase [Caulobacter crescentus NA1000]
          Length = 324

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 202/329 (61%), Gaps = 8/329 (2%)

Query: 3   ICKKMRHVAM-SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPK 61
           + + M  +A+  G G +  +       P P   EILIK+ A GVNRPD++QR G YPPP 
Sbjct: 1   MAETMTAIAIEGGKGPAQALHATRLDRPTPGPGEILIKMAAAGVNRPDLLQRMGFYPPPP 60

Query: 62  NANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121
            A   LGLEVAG++V        W  GD+VCAL+ GGGYAEY +    H LPIP   + +
Sbjct: 61  GAPATLGLEVAGEVV---VGAGRWKAGDKVCALLGGGGYAEYAVVDARHALPIPGDLDLV 117

Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181
           QAA+LPE+ FTV+AN+F+   L++G+T+L+HGG+SGIGTTAI +A   GA V  T +  +
Sbjct: 118 QAAALPETVFTVFANVFEHGALKAGETLLVHGGTSGIGTTAIAMAKAAGAKVIATGRGAD 177

Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241
           K    L+LGA  A++   EDF E+++      G D+ILDMVGA Y +++L  L+  G+++
Sbjct: 178 KKAKALELGADIAVDTKAEDFAEVVKAAG---GADVILDMVGASYFDKNLDALNVGGRIV 234

Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301
            I+ LGG+   E+ +  I+ KR  ITGSTLR R+   K  +   ++  +WP + +  + P
Sbjct: 235 YIASLGGST-LEVPVMKIMQKRAVITGSTLRPRSADEKARLAAEVERVVWPWVAAGKLKP 293

Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +I    PL   A AH  +E  EH+GK++L
Sbjct: 294 IIDATFPLADAAKAHAHLEAGEHVGKVVL 322


>gi|326385006|ref|ZP_08206679.1| NAD(P)H quinone oxidoreductase, PIG3 family protein [Gordonia
           neofelifaecis NRRL B-59395]
 gi|326196297|gb|EGD53498.1| NAD(P)H quinone oxidoreductase, PIG3 family protein [Gordonia
           neofelifaecis NRRL B-59395]
          Length = 321

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 195/314 (62%), Gaps = 8/314 (2%)

Query: 21  MFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGE 80
           M + E P P+P   E+++ V A GVNR D++QR G YPPP  A+ + GLEV+G I  +G+
Sbjct: 10  MTVVELPDPEPGPGEVIVDVVAAGVNRADLLQRAGHYPPPAGASDVFGLEVSGTICAVGD 69

Query: 81  NTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQT 140
             T W IGDEVCAL+ GGGYAE         +P+P+G + + AA LPE   TV +N+  T
Sbjct: 70  GVTGWRIGDEVCALLAGGGYAEKVAVPWEQVMPVPRGIDPVAAAGLPEVACTVMSNVVMT 129

Query: 141 ANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKE 200
             L  G+  L+HGGSSGIGT AIQLA   GA V TTA++ +K      LGA   I+Y  +
Sbjct: 130 GCLAPGEMFLVHGGSSGIGTHAIQLAHAMGARVATTARNADKLARAADLGADILIDYRTD 189

Query: 201 DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPII 260
           DF+EIL  E    G D+ILD++GA+YL Q+L+ L+  G+L+II   GG  A E+N+  ++
Sbjct: 190 DFVEILAAEG---GADVILDIIGAKYLAQNLSALATNGRLVIIGMQGGAKA-ELNIGALM 245

Query: 261 SKRITITGSTLRRRTDI----AKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAH 316
           +KR +++G+TLR R       +K +I      + WPL+ S  IAPVI +  PL   A AH
Sbjct: 246 AKRASVSGTTLRSRPTTGGPDSKFAIVTETVARTWPLIESGDIAPVIDSTFPLADAAAAH 305

Query: 317 DIMEKSEHIGKIIL 330
             +E  + +GK++L
Sbjct: 306 ARLESGDAVGKVLL 319


>gi|330470708|ref|YP_004408451.1| nad(p)h quinone oxidoreductase, pig3 family protein [Verrucosispora
           maris AB-18-032]
 gi|328813679|gb|AEB47851.1| nad(p)h quinone oxidoreductase, pig3 family protein [Verrucosispora
           maris AB-18-032]
          Length = 325

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 137/324 (42%), Positives = 204/324 (62%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +S  G   V+  +E P PQP   E+L+ V A  VNR D++QR+G YPPP  A+  
Sbjct: 1   MRAIVVSEPGGPEVLSWSEVPDPQPGPGEVLVDVRATAVNRADLLQRQGHYPPPPGASEY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I  LG     W +G +VCAL+ GGGYAE      G  LP+P G + + AA+L
Sbjct: 61  LGLECSGVISALGAGVDGWAVGQQVCALLAGGGYAERVAVPVGQLLPVPDGVDLVDAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+ Q A L +G+T+L+HGG SGIGT AIQL +  GATV  TA++  K    
Sbjct: 121 PEVASTVWSNVVQVARLAAGETLLVHGGGSGIGTFAIQLGAALGATVVATARA-AKHDRL 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA H I+Y ++DF+E +++ T   G D+ILD++GA YL +++  L+ +G+L+ I   
Sbjct: 180 RALGAAHLIDYREQDFVEEVRRVTSDAGADVILDIMGASYLGRNVAALAYDGRLVTIGMQ 239

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG    E++L  +++KR T+  + LR R    K +I   ++ ++WPL+ +  I PVI   
Sbjct: 240 GGR-KGELDLGALLAKRGTVAATALRSRPLEQKSAIVRGVREQVWPLVEACRIRPVIDRR 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           +P+ + A AH ++E S+H+GK++L
Sbjct: 299 MPISEAADAHRLVESSDHVGKVLL 322


>gi|260202981|ref|ZP_05770472.1| oxidoreductase [Mycobacterium tuberculosis K85]
 gi|289572429|ref|ZP_06452656.1| oxidoreductase [Mycobacterium tuberculosis K85]
 gi|289536860|gb|EFD41438.1| oxidoreductase [Mycobacterium tuberculosis K85]
          Length = 328

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 142/317 (44%), Positives = 197/317 (62%), Gaps = 4/317 (1%)

Query: 17  KSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIV 76
            S+ +   E P       E+LIKV A GVNR DV+Q  G YPPP   + I+GLEV+G + 
Sbjct: 11  SSDRLVWQEVPDVSAGPGEVLIKVAASGVNRADVLQAAGKYPPPPGVSDIIGLEVSGIVA 70

Query: 77  DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWAN 136
            +G   T W+ G EVCAL+ GGGYAEY        LPIP   N + +A+LPE   TVW+N
Sbjct: 71  AVGPGVTEWSAGQEVCALLAGGGYAEYVAVPADQVLPIPPSVNLVDSAALPEVACTVWSN 130

Query: 137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAIN 196
           L  TA+LR GQ VLIHGG+SGIG+  IQ+A    A V  TA S EK   C  LGA+  IN
Sbjct: 131 LVMTAHLRPGQLVLIHGGASGIGSHTIQVARALAARVAITAGSPEKLELCRDLGAQITIN 190

Query: 197 YLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINL 256
           Y  EDF+  L++ET G G DIILD++GA YL++++  L+ +G+LI+I   GG +  E+NL
Sbjct: 191 YRDEDFVARLKQETDGSGADIILDIMGASYLDRNIDALATDGQLIVIGMQGG-VKAELNL 249

Query: 257 NPIISKRITITGSTLRRRT---DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA 313
             +++KR  + G+TLR R       K +I  ++   +WP++ ++ + PVI T LP+ + A
Sbjct: 250 GKLLTKRARVIGTTLRARPVSGPHGKAAIAQAVAASVWPMIAANRVRPVIGTRLPIQQAA 309

Query: 314 MAHDIMEKSEHIGKIIL 330
            AH++M   +  GKI+L
Sbjct: 310 QAHELMLSGKTFGKILL 326


>gi|254233271|ref|ZP_04926597.1| hypothetical protein TBCG_03704 [Mycobacterium tuberculosis C]
 gi|124603064|gb|EAY61339.1| hypothetical protein TBCG_03704 [Mycobacterium tuberculosis C]
          Length = 328

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 142/317 (44%), Positives = 197/317 (62%), Gaps = 4/317 (1%)

Query: 17  KSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIV 76
            S+ +   E P       E+LIKV A GVNR DV+Q  G YPPP   + I+GLEV+G + 
Sbjct: 11  SSDRLVWQEVPDVSAGPGEVLIKVAASGVNRADVLQAAGKYPPPPGVSDIIGLEVSGIVA 70

Query: 77  DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWAN 136
            +G   T W+ G EVCAL+ GGGYAEY        LPIP   N + +A+LPE   TVW+N
Sbjct: 71  AVGPGVTEWSAGQEVCALLAGGGYAEYVAVPADQVLPIPPSVNLVDSAALPEVACTVWSN 130

Query: 137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAIN 196
           L  TA+LR GQ VLIHGG+SGIG+ AIQ+A    A V  T  S EK   C  LGA+  IN
Sbjct: 131 LVMTAHLRPGQLVLIHGGASGIGSHAIQVARALAARVAITVGSPEKLELCRDLGAQITIN 190

Query: 197 YLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINL 256
           Y  EDF+  L++ET G G DIILD++GA YL++++  L+ +G+LI+I   GG +  E+NL
Sbjct: 191 YRDEDFVARLKQETDGSGADIILDIMGASYLDRNIDALATDGQLIVIGMQGG-VKAELNL 249

Query: 257 NPIISKRITITGSTLRRRT---DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA 313
             +++KR  + G+TLR R       K +I  ++   +WP++ ++ + PVI T LP+ + A
Sbjct: 250 GKLLTKRARVIGTTLRARPVSGPHGKAAIAQAVAASVWPMIAANRVRPVIGTRLPIQQAA 309

Query: 314 MAHDIMEKSEHIGKIIL 330
            AH++M   +  GKI+L
Sbjct: 310 QAHELMLSGKTFGKILL 326


>gi|16127523|ref|NP_422087.1| zinc-containing alcohol dehydrogenase [Caulobacter crescentus CB15]
 gi|13424987|gb|AAK25255.1| alcohol dehydrogenase zinc-containing [Caulobacter crescentus CB15]
          Length = 320

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 196/318 (61%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G +  +       P P   EILIK+ A GVNRPD++QR G YPPP  A   LGLEVA
Sbjct: 8   GGKGPAQALHATRLDRPTPGPGEILIKMAAAGVNRPDLLQRMGFYPPPPGAPATLGLEVA 67

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G++V        W  GD+VCAL+ GGGYAEY +    H LPIP   + +QAA+LPE+ FT
Sbjct: 68  GEVV---VGAGRWKAGDKVCALLGGGGYAEYAVVDARHALPIPGDLDLVQAAALPETVFT 124

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
           V+AN+F+   L++G+T+L+HGG+SGIGTTAI +A   GA V  T +  +K    L+LGA 
Sbjct: 125 VFANVFEHGALKAGETLLVHGGTSGIGTTAIAMAKAAGAKVIATGRGADKKAKALELGAD 184

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            A++   EDF E+++      G D+ILDMVGA Y +++L  L+  G+++ I+ LGG+   
Sbjct: 185 IAVDTKAEDFAEVVKAAG---GADVILDMVGASYFDKNLDALNVGGRIVYIASLGGST-L 240

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  I+ KR  ITGSTLR R+   K  +   ++  +WP + +  + P+I    PL   
Sbjct: 241 EVPVMKIMQKRAVITGSTLRPRSADEKARLAAEVERVVWPWVAAGKLKPIIDATFPLADA 300

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E  EH+GK++L
Sbjct: 301 AKAHAHLEAGEHVGKVVL 318


>gi|302543911|ref|ZP_07296253.1| NADPH:quinone reductase [Streptomyces hygroscopicus ATCC 53653]
 gi|302461529|gb|EFL24622.1| NADPH:quinone reductase [Streptomyces himastatinicus ATCC 53653]
          Length = 325

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/315 (44%), Positives = 201/315 (63%), Gaps = 1/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  + +   E P P P + E+L+++ A GVNR D+MQR+G YPPP  A    GLE +G+I
Sbjct: 10  GGPDALQWTEVPDPVPGEGEVLVEIVASGVNRADLMQRQGHYPPPPGAPEYPGLECSGRI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
           V+LG   + W +GDEVCAL+ GGGYA       G  LP+P G + + AA LPE   TVW+
Sbjct: 70  VELGPGVSGWAVGDEVCALLAGGGYAGKVAVPAGQLLPVPDGVDLVTAAGLPEVTATVWS 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+F  ++LR G+T+L+HGGSSGIGT AIQLA   GA V  TA S EK  AC +LGA   I
Sbjct: 130 NVFMISHLRPGETLLVHGGSSGIGTMAIQLAKAAGARVAVTAGSAEKLAACRELGADVLI 189

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           NY ++DF+E ++  T G G D+ILD+VGA+YL +++  L+  G+L II   GG  A E+N
Sbjct: 190 NYREQDFVEEVRAATDGAGADVILDIVGAKYLARNVDALAVNGRLAIIGLQGGAKA-ELN 248

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L  ++ K   +T + LR R    K +I  +++  +WPL+ S  +  ++   LP+ + A A
Sbjct: 249 LVKLLGKNGAVTAAGLRGRPLGEKAAIVAAVREHVWPLIGSGRVRAIVDRTLPMREAAEA 308

Query: 316 HDIMEKSEHIGKIIL 330
           H ++E S H+GK++L
Sbjct: 309 HRLLESSGHVGKVLL 323


>gi|312194185|ref|YP_004014246.1| NAD(P)H quinone oxidoreductase, PIG3 family [Frankia sp. EuI1c]
 gi|311225521|gb|ADP78376.1| NAD(P)H quinone oxidoreductase, PIG3 family [Frankia sp. EuI1c]
          Length = 328

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 190/304 (62%), Gaps = 3/304 (0%)

Query: 29  PQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIG 88
           P P  +E++I V A  VNR D++QR+GLY PP  A+ I+GLE +G+I  +G     W +G
Sbjct: 24  PGPGPDEVVIDVVATAVNRADLLQRQGLYAPPPGASDIIGLECSGRIAAVGPGVDGWRVG 83

Query: 89  DEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQT 148
           DEVCAL++GGGYA   +   G  LP+P G + + A  LPE   TV++ +FQ A L  G+T
Sbjct: 84  DEVCALLSGGGYATKVVVPAGQVLPVPPGVDLVTAGGLPEVTSTVYSTVFQRAQLLDGET 143

Query: 149 VLIHGGSSGIGTTAIQLASYF--GATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEIL 206
            L+HGG+SGIGT AIQ        A + TTA S EK   C +LGA   I Y  EDF+  +
Sbjct: 144 FLVHGGASGIGTFAIQAVRALRPKALIATTAGSPEKLERCRELGADVTICYRDEDFVARV 203

Query: 207 QKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITI 266
           ++ T GRG D+ILD +GA+YL +++ +L+ +G+L++I   GG I  E+NL  +++KR  +
Sbjct: 204 KEATGGRGADVILDNMGAKYLARNVDVLAPDGRLVVIGMQGG-IKAELNLATLLTKRGAV 262

Query: 267 TGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIG 326
              +LR R    K +I   ++ ++WP   S  I PVI  VLPL + A AH ++E   H+G
Sbjct: 263 HAMSLRHRPGEQKAAIVAGVRAEVWPAFASGAIRPVIDRVLPLREAAEAHRVVESLGHVG 322

Query: 327 KIIL 330
           K++L
Sbjct: 323 KVLL 326


>gi|258510237|ref|YP_003183671.1| NAD(P)H quinone oxidoreductase, PIG3 family [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257476963|gb|ACV57282.1| NAD(P)H quinone oxidoreductase, PIG3 family [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 328

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 194/324 (59%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  V M  +G   V+ + E   PQP   E+L++V A  +NR D++QR+GLYPPP  A+ I
Sbjct: 1   MLAVIMKQFGGPEVLEIGEVQTPQPGPGEVLVRVRATALNRADLLQRRGLYPPPPGASEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE+AG +  LG   +  ++GD V AL+ GGGYA+Y +   G  + +P   +  Q A++
Sbjct: 61  LGLEMAGDVEALGPGVSSVSVGDRVAALLPGGGYAQYAVVPAGMLIRLPDTLSYEQGAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+F T + NLF    L  G+TVL+H G+SG+GT+AIQL    GA    TA S +K   C
Sbjct: 121 PETFLTAYLNLFVLGRLSPGETVLVHAGASGVGTSAIQLIRLAGAHSIVTAGSADKIAKC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L+LGAK   NY    F++ +++ET GRG DII D VGA Y + +L  L+ +G+LI+I  +
Sbjct: 181 LELGAKAGWNYHDGSFVDFVRRETDGRGADIIFDFVGAPYFHDNLRALAVDGRLIVIGTM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG      +L  I++KR  I G+ LR R+  AK  +  +     +  L    IAPVI  V
Sbjct: 241 GGTKVDGFDLGQILAKRQQIIGTALRSRSLEAKIELTAAFVAFAYDALAKGEIAPVIDQV 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
               +V  AH+ ME +++IGKI+L
Sbjct: 301 YDWREVRAAHERMEANQNIGKIVL 324


>gi|218290346|ref|ZP_03494482.1| NAD(P)H quinone oxidoreductase, PIG3 family [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218239582|gb|EED06775.1| NAD(P)H quinone oxidoreductase, PIG3 family [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 328

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 194/324 (59%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  V M  +G   V+ + E   PQP   E+L++V A  +NR D++QR+GLYPPP  A+ I
Sbjct: 1   MLAVIMKQFGGPEVLEIGEVQTPQPGPGEVLVRVRATALNRADLLQRRGLYPPPPGASEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE+AG +  LG   +  ++GD V AL+ GGGYA+Y +   G  + +P   +  Q A++
Sbjct: 61  LGLEMAGDVEALGPGVSSVSVGDRVAALLPGGGYAQYAVVPAGMLIRLPDTLSYEQGAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+F T + NLF    L  G+TVL+H G+SG+GT+AIQL    GA    TA S +K   C
Sbjct: 121 PETFLTAYLNLFVLGRLSPGETVLVHAGASGVGTSAIQLIRLAGAHSIVTAGSADKIAKC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGAK   NY    F++ +++ET GRG DIILD VGA Y + +L  L+ +G+LI+I  +
Sbjct: 181 FELGAKAGWNYHDGSFVDFVRRETDGRGADIILDFVGAPYFHDNLRALAVDGRLIVIGTM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG      +L  I++KR  I G+ LR R+  AK  +  +     +  L    IAPVI  V
Sbjct: 241 GGTKVDGFDLGQILAKRQQIIGTALRSRSLEAKIELTAAFVAFAYDALAKGEIAPVIDQV 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
               +V  AH+ ME +++IGKI+L
Sbjct: 301 YDWREVRAAHERMEANQNIGKIVL 324


>gi|256374296|ref|YP_003097956.1| NAD(P)H quinone oxidoreductase, PIG3 family [Actinosynnema mirum
           DSM 43827]
 gi|255918599|gb|ACU34110.1| NAD(P)H quinone oxidoreductase, PIG3 family [Actinosynnema mirum
           DSM 43827]
          Length = 324

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 128/328 (39%), Positives = 201/328 (61%), Gaps = 11/328 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +S +G   V+  +E   P P   E+L+ V A  VNR D++QRKG YPPP+ A+ +
Sbjct: 1   MRAITLSEFGGPEVLQWSEVRDPAPGPGEVLLDVAATAVNRADLLQRKGHYPPPRGASEV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G +  LG     W++GDEVCAL+ GGGYAE  +      LP+P G + + AA+L
Sbjct: 61  LGLECSGVVAALGPGVEGWSVGDEVCALLAGGGYAERVVVPAAQLLPVPVGVDLVTAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+   A LR+G+T+L+HGG+ GIGT AIQ+    GA V  TA S E+   C
Sbjct: 121 PEVACTVWSNVVVLAGLRAGETLLVHGGAGGIGTHAIQVGKALGARVAVTAGSAERLARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   ++Y ++DF+E++         D++LD +GA YL +++ +L+ +G+L++I   
Sbjct: 181 AELGADVLVDYREQDFVEVVGAA------DVVLDNMGASYLGRNVDVLAPDGRLVVIGMQ 234

Query: 247 GGNIATEINLNPIISKRITITGSTLRRR---TDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           GG +  E++L  ++ KR ++  + LR R       K ++  +++  +WPL+    + PV+
Sbjct: 235 GG-VKGELDLGKMLGKRASLIATGLRHRPVEGRTGKGAVVAAVREGLWPLVADGRVRPVV 293

Query: 304 HTVLPLGKVAMAHDIMEKSEHI-GKIIL 330
           H VLPL + A AH  +E    + GK++L
Sbjct: 294 HEVLPLERAADAHRALEGGGAVFGKLVL 321


>gi|311742243|ref|ZP_07716053.1| NADPH:quinone reductase [Aeromicrobium marinum DSM 15272]
 gi|311314736|gb|EFQ84643.1| NADPH:quinone reductase [Aeromicrobium marinum DSM 15272]
          Length = 327

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 134/326 (41%), Positives = 200/326 (61%), Gaps = 7/326 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++  G    + + + P P+P   E+L++V A GVNR D++QR+G Y PP  A P+
Sbjct: 1   MRAVIVNQPGGPETLEITQLPEPEPAAGEVLVRVAAAGVNRADLLQRRGFYDPPAGATPV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G++V +G +     +G  V AL+ GGGYAEY     G   P+P   + + A  L
Sbjct: 61  LGLECSGEVVGVGADVDPSVVGQRVAALLTGGGYAEYVAVPLGQVAPVPGDLDDVAAGGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
            E+  TVW+N+F+TA L +G+ +L+HGG+SGIGTTAIQ+A   GA V  T  S EK   C
Sbjct: 121 METAATVWSNVFETAGLTAGEVLLVHGGASGIGTTAIQMAVAAGARVVVTVGSPEKAQVC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGI--DIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
             LGA+ AI Y   DFL+    E +G  +  D+ILD++GA YL +++  L+  G+L++I 
Sbjct: 181 RDLGAERAIEYRTTDFLD----ELKGADLRPDVILDIMGAAYLERNVRALATGGRLVVIG 236

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
             GG I  E++LN ++ KR ++T ++LR R    K SI   L   +WP +   ++ PV+H
Sbjct: 237 LQGG-IKGELDLNRLLMKRASVTATSLRARPAHEKASIVAGLVTAVWPWVAEGLVRPVVH 295

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +  PL +V  AH ++E S H GK++L
Sbjct: 296 STFPLERVQEAHQVLEDSSHTGKVVL 321


>gi|294633591|ref|ZP_06712149.1| NADPH:quinone reductase [Streptomyces sp. e14]
 gi|292830233|gb|EFF88584.1| NADPH:quinone reductase [Streptomyces sp. e14]
          Length = 319

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 196/325 (60%), Gaps = 8/325 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +++   G   V+   E+  P P   E+++ V A  +NR DVMQR GLYP     +P 
Sbjct: 1   MKAISIREPGGPEVLEWVEADDPTPAAGEVVVDVAAGALNRADVMQRWGLYPLAPGTSPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G+I  LGE  T W +GDEVCAL+ GGGYA+      G  L IP+G    +AA+L
Sbjct: 61  PGLEVSGRIGALGEGVTGWQVGDEVCALLTGGGYAQKVAVPAGQLLTIPEGVGLAEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+  TA L++G+T+L+HGG+ G+GT AIQ+A   GA V TT    EK    
Sbjct: 121 PEVTATVWSNIVMTAGLKAGETLLVHGGAGGVGTMAIQIAKALGARVVTTVGGPEKVAQA 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA  A++Y  +DF +           D+ILD++G +YL +++  L+ +G+L++I   
Sbjct: 181 RELGADEAVDYRTQDFADFGP-------YDVILDVIGGDYLERNIRSLAADGRLVVIGLQ 233

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G +  ++NL  I+ KR+++ G+TLR R+   K +I   +Q  +WP++ S  +  VI   
Sbjct: 234 NG-LEGQLNLAEIVFKRVSVHGTTLRTRSKEEKAAIVAEVQKHVWPMIESGAVRLVIDRT 292

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           +PL + A AH +ME   H GKI+L+
Sbjct: 293 VPLAEAAEAHRLMEAGGHTGKILLV 317


>gi|260904842|ref|ZP_05913164.1| quinone oxidoreductase [Brevibacterium linens BL2]
          Length = 342

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 132/329 (40%), Positives = 195/329 (59%), Gaps = 5/329 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +S  G  +V+ + E P P    +E+L+ V A GVNR D++QR+G Y PP  A  I
Sbjct: 1   MRAITISEPGGPDVLQITEEPTPDIAADEVLVTVHAAGVNRADLLQRQGFYDPPAGATLI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G I +LG   T W +GD V AL++GGGYAE      G  LP+P   +  +AA L
Sbjct: 61  PGLEVSGTIAELGSEVTGWKVGDRVAALLSGGGYAESVPVPAGQLLPVPDSLDLTEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TV +N+   AN+++G+ +L+HGG SGIGT AIQ+A + G  +  T  SE K   C
Sbjct: 121 PEVLSTVHSNIVGNANIQAGEWLLVHGGGSGIGTAAIQIAKHLGVKIVVTVGSERKAEFC 180

Query: 187 LKLGAKHAINYLKEDFL----EILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
             LGA   INY +E+F+    EI  +     G D+ILD++GA+YL  ++  L  +G+L+I
Sbjct: 181 RNLGADAVINYREENFVERVHEICVRPDGSTGADVILDIIGAKYLKSNVKALGTDGRLVI 240

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           I   GG  A E+++  ++  R ++ G+TLR R    K  I   +  ++WP + S  I P+
Sbjct: 241 IGMQGGAKA-ELSIASLMQPRKSVAGTTLRARPKEQKIEIVAEVAAQLWPAVISGDIRPI 299

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
           IH  +PL +   AH  +E+   IGK++L+
Sbjct: 300 IHETMPLSEARKAHTALEEGTSIGKVLLI 328


>gi|264677194|ref|YP_003277100.1| alcohol dehydrogenase, zinc-binding protein [Comamonas testosteroni
           CNB-2]
 gi|262207706|gb|ACY31804.1| Alcohol dehydrogenase, zinc-binding protein [Comamonas testosteroni
           CNB-2]
          Length = 260

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 122/245 (49%), Positives = 168/245 (68%), Gaps = 3/245 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V ++ YG  +V+ +   P+P   + E+LI+V A G+NRPDV+QRKG Y PP  A+ +
Sbjct: 13  MRAVEITSYGAPDVLRMGVRPMPVAAEGEVLIRVAASGINRPDVLQRKGHYAPPPGASDL 72

Query: 67  LGLEVAGKIVDLGENTTH---WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
            GLEVAG IV   E       + +GD VCALV GGGYA +C +     LP+P+G++ +QA
Sbjct: 73  PGLEVAGVIVAGDEAAMRKAGFKLGDRVCALVAGGGYASFCAAPVDQCLPVPEGFSDVQA 132

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A+LPE+FFTVW+N+F    L+ G+T+L+ GGSSGIG TAIQLA  +GATV  TA S+ KC
Sbjct: 133 AALPETFFTVWSNVFDRGALQPGETLLVQGGSSGIGVTAIQLAKAWGATVIVTAGSDAKC 192

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             CLKLGA HAINY  +DF   +Q+ T G G+++ILDMV   Y+ + +  L+ +G+L+II
Sbjct: 193 DDCLKLGADHAINYKTQDFAAEVQRITAGEGVNVILDMVAGSYVAREVQCLAPDGRLVII 252

Query: 244 SFLGG 248
           +  GG
Sbjct: 253 AVQGG 257


>gi|304309716|ref|YP_003809314.1| Zinc-containing alcohol dehydrogenase [gamma proteobacterium HdN1]
 gi|301795449|emb|CBL43647.1| Zinc-containing alcohol dehydrogenase [gamma proteobacterium HdN1]
          Length = 322

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 128/306 (41%), Positives = 187/306 (61%), Gaps = 1/306 (0%)

Query: 25  ESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTH 84
           + P P P+  E+ I V+A  VNR D+MQRKGLYPPP  A+ I+GLE AG I  +G   T 
Sbjct: 16  DVPTPLPKAGEVAISVKATAVNRADLMQRKGLYPPPLGASEIMGLECAGTISAVGPGVTG 75

Query: 85  WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLR 144
           W +G+ VCAL+ GGGYAE  +   GH LP+P GY+  Q A++ E + T W N+F     +
Sbjct: 76  WQVGESVCALLTGGGYAETVVCPAGHVLPLPSGYSFAQGAAIVEVYATAWLNIFLEGAAK 135

Query: 145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLE 204
            G+ VLIH G+SG+GT AIQL    G   + T  S+ K   CLKLGA          F E
Sbjct: 136 LGERVLIHAGASGVGTAAIQLCKALGNPCFVTVGSQPKLDFCLKLGASAGCLRQDNHFEE 195

Query: 205 ILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRI 264
            ++  +QG G+D+ILD VGA+YL+ +L  L+ +G+L++I  +GG  A+ I+L  ++ KR+
Sbjct: 196 RVRDWSQGAGVDVILDCVGADYLDANLRSLNTDGRLVLIGIMGGRTAS-IDLGRMLIKRL 254

Query: 265 TITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEH 324
            + GSTLR R + +K ++  SL+ ++WP      +  +IH   P+ +V  A   +  + +
Sbjct: 255 KVWGSTLRSRDNQSKTALIRSLREQVWPRFEKGELRSIIHAEYPIQEVERAFADIASNAN 314

Query: 325 IGKIIL 330
           IGKI+L
Sbjct: 315 IGKIVL 320


>gi|329935721|ref|ZP_08285526.1| quinone oxidoreductase [Streptomyces griseoaurantiacus M045]
 gi|329304812|gb|EGG48685.1| quinone oxidoreductase [Streptomyces griseoaurantiacus M045]
          Length = 330

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 142/325 (43%), Positives = 201/325 (61%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G    +  AE P P P + E+L+ V A  VNR D+MQR+G YPPP  A   
Sbjct: 1   MHAITIPEPGGPEALVWAEVPDPVPGEGEVLLDVVATAVNRADLMQRQGFYPPPPGAPAY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE AG+I  LG   +   +G+EVCAL+ GGGYAE      G  LP+PKG    QAA+L
Sbjct: 61  PGLECAGRIAALGPGVSGHTVGEEVCALLAGGGYAEKVAVPVGQLLPVPKGLELRQAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A+LR G+T+L+HGGSSGIGT AIQLA   GA V  TA ++EK   C
Sbjct: 121 PEVTCTVWSNVFMVAHLRPGETLLVHGGSSGIGTMAIQLAKAVGARVAVTAGTKEKLDFC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   INY ++DF+E ++  T G G D+ILD +GA+YL +++  L+  G+L II   
Sbjct: 181 ADLGADVLINYREQDFVEEVRAATGGAGADVILDNMGAKYLGRNVDALAVNGRLAIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG    E+N+  ++ KR  ++ ++LR R    K +I  +++  +WPLL    + PV+   
Sbjct: 241 GGT-KGELNIGTLLGKRAAVSATSLRARPLDEKAAIVAAVREHVWPLLADGHVRPVVDRE 299

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           LP+ + A  H ++E+S HIGK++L+
Sbjct: 300 LPMPEAAEGHRVLEESGHIGKVLLV 324


>gi|325915618|ref|ZP_08177926.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325538178|gb|EGD09866.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 325

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 130/318 (40%), Positives = 187/318 (58%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G +N ++  E P P+P   ++LI+V A G+NRPD++QR G YPPP  A   LGLEVA
Sbjct: 13  DGKGDANALYATEQPRPRPAPGQVLIRVHAAGINRPDLLQRAGHYPPPPGAPETLGLEVA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G+IV   E    W +GD VCAL+ GGGYA+Y      H LPIP G + +QAA+LPE+ FT
Sbjct: 73  GEIV---EPAGRWKVGDRVCALLGGGGYAQYAAVDARHVLPIPAGMDLVQAAALPETIFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
            + NLF+   L +G+ +L+HG +SGIG TAIQ+A   GA V  TA+S  K     +LGA 
Sbjct: 130 AYTNLFEHGRLAAGEWLLLHGATSGIGVTAIQMAKAAGAHVLATARSASKAAQARELGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+   E F+ + Q      G+D+ LDMVG       L  L+  G+++ I+   G+   
Sbjct: 190 VAIDSTSESFVAVAQAHG---GVDVSLDMVGGAVFADTLEALNPRGRIVYIASQAGST-I 245

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  ++ K+  +TGSTLR RT   K  +   ++  +WP +    I  +I    PL + 
Sbjct: 246 EVPIPQLMRKQAILTGSTLRPRTADEKARLAAEVERVVWPWIEQGKIRVLIDKRFPLVEA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E+  H+GK++L
Sbjct: 306 AAAHRYLEQGSHLGKVVL 323


>gi|238061752|ref|ZP_04606461.1| alcohol dehydrogenase [Micromonospora sp. ATCC 39149]
 gi|237883563|gb|EEP72391.1| alcohol dehydrogenase [Micromonospora sp. ATCC 39149]
          Length = 333

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 136/324 (41%), Positives = 202/324 (62%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +   G  + +  AE P P P   E+++ V A  VNR D++QR+G YPPP  A   
Sbjct: 1   MRAITIPKPGGPDALAWAEVPDPAPGPGEVVVDVRASAVNRADLLQRQGHYPPPPGAPAY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G I  LG     W +G EVCAL+ GGGYAE      G  LP+P G + + AA+L
Sbjct: 61  PGLECSGVISALGPGVAGWEVGQEVCALLAGGGYAERVAVPAGQLLPVPDGVDLVDAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+ QTA L  G+T+L+HGG SGIGT A+QL +  GATV  TA+S  K    
Sbjct: 121 PEVACTVWSNVVQTARLARGETLLVHGGGSGIGTFAVQLGAALGATVVVTARS-AKHERL 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA HAI+Y ++DF++ +++ T GRG D+ILD++GA YL +++  L+  G+L++I   
Sbjct: 180 RGLGAAHAIDYREQDFVDEVRRVTDGRGADVILDIMGAAYLARNVAALATGGRLVVIGMQ 239

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E++L  +++KR ++  + LR R    K +I   ++ ++WPL+ +  I PV+   
Sbjct: 240 GGRKA-ELDLGALLAKRASVAATALRSRPLAEKAAIVAGVREQVWPLVAAGTIRPVVDRR 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LP+ + A AH ++E + H GK++L
Sbjct: 299 LPITEAAEAHRLVESNAHTGKVLL 322


>gi|301648249|ref|ZP_07247993.1| NAD(P)H quinone oxidoreductase, PIG3 family [Escherichia coli MS
           146-1]
 gi|301073665|gb|EFK88471.1| NAD(P)H quinone oxidoreductase, PIG3 family [Escherichia coli MS
           146-1]
          Length = 331

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 133/328 (40%), Positives = 200/328 (60%), Gaps = 2/328 (0%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           I + M  V     G   V+   +  +PQP   E+LI+V   GVNRPD+MQR G+ P P  
Sbjct: 2   IPEMMNAVIARQPGGPEVLEQVQRAVPQPSAGEVLIRVANAGVNRPDIMQRNGM-PLPPG 60

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
              +LGLEV+G +V  G       IG  V AL+NGGGYA+YC++     L +PK     Q
Sbjct: 61  ITDVLGLEVSGTVVAQGAGVESPAIGAPVMALLNGGGYADYCVARAELCLSVPKNLPLAQ 120

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA +PE+ FTVW NLF+   ++ G++VLIHG +SG+GT AIQ A   GA V  TA   +K
Sbjct: 121 AAGVPEAAFTVWHNLFELGRMQPGESVLIHGAASGVGTFAIQCAQACGARVIATAGGTDK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
             A  +LG   AI+   EDF+ ++ +ETQGRG+DI+LD VG +Y+  +L++L+  G+ + 
Sbjct: 181 IRALRQLGVGRAIDRHSEDFVAVILEETQGRGVDIVLDNVGGDYVASNLSILAPGGRHVS 240

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
           +SF+ G    E++L  ++ K +++T STLR ++ + K  +   +   + PL+ +  I P+
Sbjct: 241 LSFMQGA-KIELDLQLVMRKGLSLTSSTLRPKSPVEKMRLAQRISRHLLPLIAAGKITPI 299

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +H  LPL + A AH I+E + +IGK++L
Sbjct: 300 LHQTLPLAQAADAHRILEANTNIGKVLL 327


>gi|15826951|ref|NP_301214.1| oxidireductase [Mycobacterium leprae TN]
 gi|221229429|ref|YP_002502845.1| putative oxidireductase [Mycobacterium leprae Br4923]
 gi|13092498|emb|CAC29626.1| putative oxidireductase [Mycobacterium leprae]
 gi|219932536|emb|CAR70211.1| putative oxidireductase [Mycobacterium leprae Br4923]
          Length = 336

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 136/317 (42%), Positives = 192/317 (60%), Gaps = 6/317 (1%)

Query: 17  KSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIV 76
            +N M   E P       E+LI+V A GVNR DV+Q  G YP P  A+ I+G+EVAG + 
Sbjct: 8   SANQMVWREVPDVTAGPGEVLIEVAASGVNRADVLQVAGKYPHPPGASAIIGMEVAGVVA 67

Query: 77  DLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWAN 136
            +    T W++G EVCAL+ GGGYAEY        +PIPKG N + +A +PE   TVW+N
Sbjct: 68  AVSSGVTEWSVGQEVCALLAGGGYAEYVAVPASQVMPIPKGVNVVDSAGIPEVACTVWSN 127

Query: 137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAIN 196
           L   A+L +GQ +L+HGG+SGIG+  IQ+A   GA V  TA SEEK   C  LGA+  IN
Sbjct: 128 LVMAAHLSAGQLLLLHGGTSGIGSHGIQVARALGAKVAVTAGSEEKLEFCRALGAQITIN 187

Query: 197 YLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINL 256
           Y  EDF+  LQ+  Q  G D+ILD++GA YL++++  L+ +G+LI+I   GG +  E+NL
Sbjct: 188 YRDEDFVARLQQ--QNGGADVILDIMGAAYLDRNIDALAIDGQLIVIGLQGG-VKGELNL 244

Query: 257 NPIISKRITITGSTLRRR---TDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA 313
             ++SKR  I GSTLR R      +K  I  ++   IWP++    + P+I   + + + A
Sbjct: 245 GKVLSKRARIIGSTLRARPVNGPNSKSEIVAAVTASIWPMIADGSVRPIIGARMAVQQAA 304

Query: 314 MAHDIMEKSEHIGKIIL 330
            AH ++   +  GKI+L
Sbjct: 305 DAHQLLLSGKVSGKIVL 321


>gi|166710669|ref|ZP_02241876.1| quinone reductase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 325

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 129/318 (40%), Positives = 187/318 (58%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G ++ ++  E P P+P   ++L++V A G+NRPD++QR G YPPP  A   LGLE+A
Sbjct: 13  DGKGDADALYATEQPRPRPAAGQVLMRVHAAGINRPDLLQRAGHYPPPPGAPETLGLEIA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G+IV   E    W +G+ VCAL+ GGGYA+Y      H LPIP G + + AA+LPE+ FT
Sbjct: 73  GEIV---EPAGRWKVGERVCALLGGGGYAQYAAVDARHVLPIPAGMDLVHAAALPETIFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
            +ANLF+   L +GQ +L+HG +SGIG TAIQ+A   GA V  TA+S  K      LGA 
Sbjct: 130 AYANLFEHGRLAAGQWLLLHGATSGIGVTAIQMAKAAGAHVLATARSASKAAQARALGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+   E F+E+ +      GID+ LDMVGA      L  L+  G+++ I+   G    
Sbjct: 190 VAIDSTSESFVEVAKAHG---GIDVALDMVGAAVFADTLEALNHRGRIVYIASQAGAT-I 245

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  ++ K+  ITGSTLR RT   K  +   ++  +WP +    +  ++    PL + 
Sbjct: 246 ELPIPVLMRKQAVITGSTLRPRTADEKARLAAEVERVVWPWIAEGKLRVLVDKRFPLAEA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E+  H+GKI+L
Sbjct: 306 AAAHRYLEQGSHLGKIVL 323


>gi|302382525|ref|YP_003818348.1| NAD(P)H quinone oxidoreductase, PIG3 family [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193153|gb|ADL00725.1| NAD(P)H quinone oxidoreductase, PIG3 family [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 323

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 135/317 (42%), Positives = 194/317 (61%), Gaps = 4/317 (1%)

Query: 14  GYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAG 73
           G G ++ + + E   P+    EI I+V A GVNRPD++QR G YPPP  A+ ILGLEVAG
Sbjct: 9   GSGPADALRIGERTDPRAGPGEIRIRVRAAGVNRPDLLQRIGAYPPPPGASDILGLEVAG 68

Query: 74  KIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTV 133
           +I  +GE  + W++GD VCAL+ GGGYAEY +    H LP+P   + +QAA+LPE+ FTV
Sbjct: 69  EIDQIGEGVSRWSVGDRVCALLGGGGYAEYAVVDARHALPLPDDLDFVQAAALPETLFTV 128

Query: 134 WANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKH 193
           +AN+F+   L +G+T+LIHG +SGIG  AIQ+A   GA V  T++   K  A L LGA  
Sbjct: 129 FANVFEGGRLSAGETLLIHGATSGIGVMAIQMAKAAGARVIATSRGAAKAKAALALGADV 188

Query: 194 AINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATE 253
           +++    D    +       G D+ILDMVGA Y   +L  L   G+ ++I+ L G + ++
Sbjct: 189 SLDATDGDLARGIADAG---GADVILDMVGAAYAGLNLDALKPFGRWVVIATLTGGL-SQ 244

Query: 254 INLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA 313
           + L  ++ K+ T+TGSTLRRR    K  +  +++ + WP + S  + P I    PL +  
Sbjct: 245 VELGKVMMKQATLTGSTLRRRPADEKARLAAAVEARAWPWVVSGQVRPPIDATFPLDEAG 304

Query: 314 MAHDIMEKSEHIGKIIL 330
            AH  +E  EH+GKIIL
Sbjct: 305 PAHLRLEAGEHVGKIIL 321


>gi|312137754|ref|YP_004005090.1| zinc binding alcohol dehydrogenase [Rhodococcus equi 103S]
 gi|311887093|emb|CBH46402.1| putative zinc binding alcohol dehydrogenase [Rhodococcus equi 103S]
          Length = 331

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 205/327 (62%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +S  G  +VM  +E P P P + E+L+ V A  VNR D++QR+G YPPP  A+ I
Sbjct: 1   MYAITVSEPGGPDVMSWSEVPDPTPGRGEVLLDVVATAVNRADLLQRQGFYPPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           +GLE +G I ++G +   W +GD V AL+ GGGYAE         LP+P+G +   AASL
Sbjct: 61  IGLECSGVIAEIGPDVHGWKVGDRVAALLAGGGYAEKVTVPATQLLPVPEGLDLRAAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+NL   + L +GQ +L+HGG  GIGT AIQ+    GA V  TA S +K   C
Sbjct: 121 PEVACTVWSNLVMESGLHAGQVLLVHGGGGGIGTHAIQVGKALGARVAVTAGSADKLERC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+  INY + DF+E+L++ T+GRG DIILD +GA YL++++  L+ +G+L+II   
Sbjct: 181 AELGAEILINYREADFVEVLREATRGRGADIILDNMGASYLDRNIDALAPDGQLVIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDI---AKQSIRDSLQLKIWPLLNSHVIAPVI 303
           GG    E+++  ++ KR  +  + LR R +    +K ++  +++ K+WPL+   ++ PV+
Sbjct: 241 GGR-KGELDIGKLLGKRARVLATGLRGRPETGPSSKAAVIAAVRDKLWPLVGDGIVVPVV 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
              LP+ +   AH++++  + +GK++L
Sbjct: 300 SAELPITEAPTAHELLDSPDTVGKVVL 326


>gi|58583430|ref|YP_202446.1| quinone reductase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84625246|ref|YP_452618.1| quinone reductase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188575313|ref|YP_001912242.1| quinone reductase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|58428024|gb|AAW77061.1| quinone reductase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84369186|dbj|BAE70344.1| quinone reductase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188519765|gb|ACD57710.1| quinone reductase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 325

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 188/318 (59%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G ++ ++  E P P+P   ++L++V A G+NRPD++QR G YPPP  A   LGLE+A
Sbjct: 13  DGKGDADALYATEQPRPRPAAGQVLMRVNAAGINRPDLLQRAGHYPPPPGAPETLGLEIA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G+IV   E    W +G+ VCAL+ GGGYA+Y      H LPIP G + + AA+LPE+ FT
Sbjct: 73  GEIV---EPAGRWKVGERVCALLGGGGYAQYAAVDARHVLPIPAGMDLVHAAALPETIFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
            +ANLF+   L +G+ +L+HG +SGIG TAIQ+A   GA V  TA+S  K      LGA 
Sbjct: 130 AYANLFEHGRLAAGEWLLLHGATSGIGVTAIQMAKAAGAHVLATARSASKAAQARALGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+   E F+E+ +      GID+ LDMVGA      L  L++ G+++ I+   G    
Sbjct: 190 VAIDSTSESFVEVAKAHG---GIDVALDMVGAAVFADTLEALNQRGRIVYIASQAGAT-I 245

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  ++ K+  ITGSTLR RT   K  +   ++  +WP +    +  ++    PL + 
Sbjct: 246 ELPIPVLMRKQAVITGSTLRPRTADEKARLAAEVERVVWPWIAEGKLRVLVDKRFPLAEA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E+  H+GKI+L
Sbjct: 306 AAAHRYLEQGSHLGKIVL 323


>gi|158312150|ref|YP_001504658.1| quinone oxidoreductase putative PIG3 [Frankia sp. EAN1pec]
 gi|158107555|gb|ABW09752.1| Quinone oxidoreductase putative PIG3 [Frankia sp. EAN1pec]
          Length = 316

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 130/313 (41%), Positives = 190/313 (60%), Gaps = 4/313 (1%)

Query: 21  MFLAESP-IPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLG 79
           M  +E P +P P   E+ + + A  VNR D++QR+G YPPP+ A  I+G+E +G++  LG
Sbjct: 1   MSWSEVPDLPPPGNGEVTVDIVATAVNRADLLQRQGFYPPPRGATEIIGMECSGRVAALG 60

Query: 80  ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQ 139
                + +GDEVCAL+ GGGYA          LP+P G + I AA LPE   TV + +F+
Sbjct: 61  PGVDGFALGDEVCALLVGGGYATQVNVPAAQLLPVPSGVDLIHAAGLPEVACTVHSTVFE 120

Query: 140 TANLRSGQTVLIHGGSSGIGTTAIQLASYF--GATVYTTAKSEEKCLACLKLGAKHAINY 197
            A L  G+  L+HGG+SGIGT AIQ        A V TTA S EK + C +LGA   + Y
Sbjct: 121 RAALADGEVFLVHGGASGIGTFAIQAVRALRPSAVVATTAGSAEKLVRCRELGAHITVAY 180

Query: 198 LKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLN 257
             EDF+  ++ ET G G D+ILD +GA YL +++ LL+ EG+L++I   GG   T +NL 
Sbjct: 181 RDEDFVARVRAETGGHGADVILDNMGASYLERNVDLLATEGRLVVIGLQGGTKGT-LNLG 239

Query: 258 PIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHD 317
            ++ KR ++   +LR R D  K  I   ++ + WP + +  I PVI  VLP+ +VA AH 
Sbjct: 240 ALLPKRASVHALSLRARPDAQKARIVAGVREEFWPEVAAGRIRPVIDRVLPITEVATAHR 299

Query: 318 IMEKSEHIGKIIL 330
           ++E+S H+GK+++
Sbjct: 300 VLEESGHVGKVVM 312


>gi|325675094|ref|ZP_08154780.1| NADPH:quinone reductase [Rhodococcus equi ATCC 33707]
 gi|325554055|gb|EGD23731.1| NADPH:quinone reductase [Rhodococcus equi ATCC 33707]
          Length = 331

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 204/327 (62%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +S  G  +VM  +E P P P + E+L+ V A  VNR D++QR+G YPPP  A+ I
Sbjct: 1   MYAITVSEPGGPDVMSWSEVPDPTPGRGEVLLDVVATAVNRADLLQRQGFYPPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           +GLE +G I ++G +   W +GD V AL+ GGGYAE         LP+P+G +   AASL
Sbjct: 61  IGLECSGVIAEIGPDVHGWKVGDRVAALLAGGGYAEKVTVPATQLLPVPEGLDLRAAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+NL     L +GQ +L+HGG  GIGT AIQ+    GA V  TA S +K   C
Sbjct: 121 PEVACTVWSNLVMECGLHAGQVLLVHGGGGGIGTHAIQVGKALGARVAVTAGSADKLERC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+  INY + DF+E+L++ T+GRG DIILD +GA YL++++  L+ +G+L+II   
Sbjct: 181 AELGAEILINYREADFVEVLREATRGRGADIILDNMGASYLDRNIDALAPDGQLVIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDI---AKQSIRDSLQLKIWPLLNSHVIAPVI 303
           GG    E+++  ++ KR  +  + LR R +    +K ++  +++ K+WPL+   ++ PV+
Sbjct: 241 GGR-KGELDIGKLLGKRARVLATGLRGRPETGPSSKAAVIAAVRDKLWPLVGDGIVVPVV 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
              LP+ +   AH++++  + +GK++L
Sbjct: 300 SAELPITEAPTAHELLDSPDTVGKVVL 326


>gi|145596979|ref|YP_001161276.1| alcohol dehydrogenase [Salinispora tropica CNB-440]
 gi|145306316|gb|ABP56898.1| Alcohol dehydrogenase, zinc-binding domain protein [Salinispora
           tropica CNB-440]
          Length = 325

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 206/326 (63%), Gaps = 6/326 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +  +G  + +   E P P+P   E+++ V A  VNR DV+QRKG YPPP  A+P 
Sbjct: 1   MHAITIQEFGGPDALVWTEVPDPEPGPGEVIVDVRASAVNRADVLQRKGYYPPPPGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G I  + ++   W +G  VCAL+ GGGYAE      G  LP+P G + + AA+L
Sbjct: 61  PGLECSGVISAIADDVPGWAVGQPVCALLAGGGYAERVAVPAGQLLPVPGGVDLVDAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK--SEEKCL 184
           PE   TVW+N+ + A L +G+T+L+HGG SGIGT AIQL S  GATV  TA+    ++  
Sbjct: 121 PEVACTVWSNVVRKARLAAGETLLVHGGGSGIGTFAIQLGSALGATVLVTARLAKHDRLR 180

Query: 185 ACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           A   LGA H I+Y ++DF E +++ T GRG D+ILD++GA YL +++  L+ +G+L++I 
Sbjct: 181 A---LGAAHPIDYREQDFAEEVRQVTGGRGADVILDIMGAAYLGRNVAALATDGRLMLIG 237

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
            LGG  A E++L  +++KR T+  +TLR      K  I + ++ ++WPL+ +  + PV+ 
Sbjct: 238 LLGGRKA-ELDLGALLAKRATVAATTLRSLPPSQKAEIVEGVREQVWPLIAAGKVRPVVD 296

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
             LP+   A AH ++E +EH+GK++L
Sbjct: 297 RRLPMTDAAEAHRLVESNEHVGKVLL 322


>gi|227831946|ref|YP_002833653.1| putative quinone oxidoreductase [Corynebacterium aurimucosum ATCC
           700975]
 gi|262183199|ref|ZP_06042620.1| putative quinone oxidoreductase [Corynebacterium aurimucosum ATCC
           700975]
 gi|227452962|gb|ACP31715.1| putative quinone oxidoreductase [Corynebacterium aurimucosum ATCC
           700975]
          Length = 318

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 193/308 (62%), Gaps = 8/308 (2%)

Query: 23  LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT 82
           L E+  PQ Q  E+L+KV+A GVNR D++Q +G YPPP  A+ I+GLEVAG++VD G+  
Sbjct: 17  LGETNKPQLQDGEVLVKVKAAGVNRADLLQARGHYPPPPGASEIIGLEVAGEVVDAGD-- 74

Query: 83  THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTAN 142
           T   +G +V AL+ GGGYAEY    +G  LPIP GY+  +AAS+ E   TVW+N+   A 
Sbjct: 75  TDIEVGSKVGALLAGGGYAEYVAVPKGQLLPIPSGYSFAEAASVIEVACTVWSNIAMEAE 134

Query: 143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDF 202
           L  GQT+LIHGG+ GIGT AIQ+A   GATV  TA S EK   C +LGA   INY ++DF
Sbjct: 135 LDKGQTILIHGGAGGIGTFAIQVAKQLGATVAVTAGSAEKLATCKELGADILINYNEQDF 194

Query: 203 LEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISK 262
            E L+ +      D+ILD++GA+YL ++L  L+K G ++ I   GG  A E+N+  +++K
Sbjct: 195 AEELKNQC-----DVILDIMGAKYLKKNLIALAKGGHMVTIGMQGGTKA-ELNMGVLLNK 248

Query: 263 RITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS 322
           R+T+ G+TLR R+   K +I       +WP L    +   +H    L + A AH  ++  
Sbjct: 249 RLTLQGTTLRSRSLEGKAAIVADTVKNVWPWLEDGSVKHHLHATYALARAAEAHQALDSG 308

Query: 323 EHIGKIIL 330
           +  GK++L
Sbjct: 309 KVTGKLVL 316


>gi|226363391|ref|YP_002781173.1| oxidoreductase [Rhodococcus opacus B4]
 gi|226241880|dbj|BAH52228.1| putative oxidoreductase [Rhodococcus opacus B4]
          Length = 331

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 129/327 (39%), Positives = 200/327 (61%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G   VM  AE P P+     +L+ V A  VNR D++QR+G YPPP  A+ +
Sbjct: 1   MYAITIDQPGGPEVMTWAEQPDPELPPGHVLLDVAATAVNRADLLQRQGFYPPPPGASDV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I +LGE  + W++GD+VCAL+ GGGYAE         LP+P+G + + AASL
Sbjct: 61  LGLECSGTIAELGEGVSGWSVGDQVCALLAGGGYAEKVAVPASQLLPLPEGVDLLVAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+   A L  G  +L+HGG  GIGT AIQ+    GA V  TA SEEK   C
Sbjct: 121 PEVACTVWSNVVMGAGLTRGDVLLVHGGGGGIGTHAIQVGVALGARVAVTAGSEEKLARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   +NY + DF++ ++K T G G D+ILD +G  YL++++ +L+ +G+L++I   
Sbjct: 181 RELGADILVNYREADFVDEIRKATDGHGADVILDNMGGAYLDRNVDVLAADGRLVVIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRD---SLQLKIWPLLNSHVIAPVI 303
           GG    E++L  +++KR  +T + LR R +  ++   D    ++ ++WPL+    + PV+
Sbjct: 241 GGR-KGELDLGKVLAKRAHVTAAGLRGRPESGREGKADIVADVRKRLWPLIAEGAVHPVV 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
              LP+ +    H++++ +E +GK+IL
Sbjct: 300 SAELPITEAPRGHELLDSAETVGKVIL 326


>gi|114799986|ref|YP_758745.1| NAD(P)H quinone oxidoreductase PIG3 family protein [Hyphomonas
           neptunium ATCC 15444]
 gi|114740160|gb|ABI78285.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Hyphomonas
           neptunium ATCC 15444]
          Length = 324

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 131/307 (42%), Positives = 188/307 (61%), Gaps = 5/307 (1%)

Query: 25  ESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTH 84
           E P P P + EILI+V A G+NR D+ QR G YPPP  A+ ILGLEV+G +V LG  T+ 
Sbjct: 20  ERPRPVPGQGEILIEVAAAGLNRADLAQRAGRYPPPPGASDILGLEVSGTVVGLGPGTSR 79

Query: 85  WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLR 144
           +  GD VCAL+ GGGYA + +  +G  LP+P   + + AA  PE+  T WAN+F  A L+
Sbjct: 80  FKQGDRVCALLAGGGYASHVVVDEGSVLPVPGDMDLVTAACFPEALMTAWANVFDRAGLK 139

Query: 145 SGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFL 203
            G+T L HG +SGIG  AIQ+A  +GA  ++ TA SEEKC     LGA  AINY ++DF 
Sbjct: 140 PGETFLCHGATSGIGVMAIQMAKAYGAPKIFGTAGSEEKCALARDLGADIAINYREQDFE 199

Query: 204 EILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKR 263
           +I++   +  G D+ LDMVG +Y+ +++     +G++I I++  G +A E+N   ++ KR
Sbjct: 200 QIVK---EAGGADVTLDMVGGDYIQKNIGAAKADGRIINIAYQNGMVA-EVNFGLVLMKR 255

Query: 264 ITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE 323
           +++  +TLR R    K  IR +++   WP + S  I  V+    PL +   A   MEK  
Sbjct: 256 LSLMATTLRARPVPEKSRIRAAVEKDFWPHVASGKIRAVLEKTYPLAEAEAALAHMEKGG 315

Query: 324 HIGKIIL 330
           H GKI+L
Sbjct: 316 HSGKILL 322


>gi|41406343|ref|NP_959179.1| hypothetical protein MAP0245c [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41394691|gb|AAS02562.1| hypothetical protein MAP_0245c [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 323

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 128/288 (44%), Positives = 181/288 (62%), Gaps = 6/288 (2%)

Query: 46  NRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCL 105
           NR DV+Q  G YPPP  A+  +G+EV+G I ++G+  T W++G EVCAL+ GGGYAEY  
Sbjct: 37  NRADVLQAAGKYPPPPGASETIGMEVSGVIAEVGDGVTEWSVGQEVCALLAGGGYAEYVA 96

Query: 106 SHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQL 165
              G  LPIP G + + AA LPE   TVW+NL   A LR+GQ +L+HGG+SGIG+ AIQ+
Sbjct: 97  VPAGQLLPIPAGVDLVDAAGLPEVACTVWSNLVLIAGLRNGQRLLVHGGASGIGSHAIQV 156

Query: 166 ASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAE 225
           A   GA V  TA S EK   C +LGA   INY  EDF+  L  ET  RG D+ILD++GA 
Sbjct: 157 AQALGARVAVTAGSAEKLDFCRELGADITINYRDEDFVARLADET--RGADVILDIMGAA 214

Query: 226 YLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR---TDIAKQSI 282
           YL++++  L+ +G+L+II   GG +  E+N+  +++KR  + G+TLR R      +K  I
Sbjct: 215 YLDRNIDALATDGQLVIIGMQGG-VKAELNIGKLLAKRARVIGTTLRGRPVSGPNSKTEI 273

Query: 283 RDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             ++   +WP++    + P+I   LP+ +   AH  +  SE  GKI+L
Sbjct: 274 VQAVTASVWPMIADGRVRPIIGARLPIQQAGDAHRRLVASEVTGKIVL 321


>gi|167463614|ref|ZP_02328703.1| Quinone oxidoreductase putative PIG3 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322381595|ref|ZP_08055568.1| oxidoreductase-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321154431|gb|EFX46734.1| oxidoreductase-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 329

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 125/325 (38%), Positives = 196/325 (60%), Gaps = 1/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +     G   V+++ E   P+ ++ E+LI+V+A  +NR D+ QR+GLYPP    + I
Sbjct: 1   MKAICFDQAGGPEVLYVGEVQEPELKEGELLIEVKAAALNRADLAQRRGLYPPVPGESEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE+AGK+   G     W+ GD VCAL+ GGGYAE      G  + +P+     +AA+L
Sbjct: 61  LGLEIAGKVTRTGTGVKGWSPGDRVCALLPGGGYAERVAIPAGMAMRLPEKMTFQEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+F T + NL     +++G  V +  G+SG+GT AIQ+    GA  Y +A SEEK   C
Sbjct: 121 PEAFLTAYLNLVWLGGMKAGHNVFVPAGASGVGTAAIQIIRASGANAYVSAGSEEKLALC 180

Query: 187 LKLGAKHAINYLK-EDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
            +LGA    NY +   F + L++ET GRG+D++LD+VGA  +  ++  L+++G ++++  
Sbjct: 181 SELGALAGWNYREGGSFADWLRRETGGRGVDLVLDLVGAPNMAGYVEALAEDGAILLVGL 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           +GG+   E++LNP++ KR+ I GSTLR+RT   K ++        +PL   + + PVI +
Sbjct: 241 VGGSKVKELDLNPLLMKRLKIMGSTLRKRTKDEKIALTKQFWTWAYPLFTENRMKPVIDS 300

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             P  K A AH  ME +++ GKI+L
Sbjct: 301 TFPWKKAAEAHAYMESNQNKGKIVL 325


>gi|327399470|ref|YP_004340339.1| NAD(P)H quinone oxidoreductase, PIG3 family [Hippea maritima DSM
           10411]
 gi|327182099|gb|AEA34280.1| NAD(P)H quinone oxidoreductase, PIG3 family [Hippea maritima DSM
           10411]
          Length = 329

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 196/326 (60%), Gaps = 3/326 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V   G+G   V+ +A+   P+P+ +++LIKV A  VN PD++QR+G YPPP   + I
Sbjct: 1   MKAVICDGFGGIEVLKIADVEKPKPKPDQVLIKVMATSVNMPDIVQRRGKYPPPPGESEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEVAG I +LG     +  GD+V ALV GGGYAEY  ++  H +PIP+  +  +AA +
Sbjct: 61  LGLEVAGIIEELGSEVEEYKKGDKVMALVGGGGYAEYATAYASHIIPIPESMSFEEAACV 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
            E++ T + N+F    ++    VL HGG  G+ T AIQL       V     +  + +  
Sbjct: 121 CEAYITAFLNVFMIGGIKDNDYVLYHGGGGGVNTAAIQLTRALTNNVNIIITASPRKMDK 180

Query: 187 LK-LGAKHAINYLKE-DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
           +K +GA   INY +  +F +I+++ T+ RG+DIILD VGA YL+Q++  L+ EG+LIII 
Sbjct: 181 VKEIGANLVINYKENPNFSDIIKEYTKKRGVDIILDHVGATYLDQNIKSLAYEGRLIIIG 240

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
            + G I  E+NL  ++ KR  I GS LR R    K  I    + K  P      I P+I+
Sbjct: 241 VISG-IKAELNLGLLMVKRQKIIGSVLRSRPVENKAQIIKEFKEKAIPKFADRTIVPIIY 299

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
           TVLPL +VA AH IMEK EH GKI+L
Sbjct: 300 TVLPLEEVAKAHQIMEKGEHFGKIVL 325


>gi|289663621|ref|ZP_06485202.1| putative quinone oxidoreductase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289671001|ref|ZP_06492076.1| putative quinone oxidoreductase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 325

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 126/318 (39%), Positives = 187/318 (58%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G ++ ++  E P P+P   ++LI+V A G+NRPD++QR G YPPP  A   LGLE+A
Sbjct: 13  DGKGDADALYAIEQPRPRPAPGQVLIRVHAAGINRPDLLQRAGHYPPPPGAPETLGLEIA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G+IV   E    W +GD VCAL+ GGGYA+Y      H LPIP G + + AA+LPE+ FT
Sbjct: 73  GEIV---EPAGRWKVGDRVCALLGGGGYAQYAAVDARHVLPIPAGMDLVHAAALPETIFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
            +ANLF+   L +G+ +L+HG +SGIG TAIQ+A   GA V  TA+S  K     +LGA 
Sbjct: 130 AYANLFEHGRLAAGEWLLLHGATSGIGVTAIQMAKAAGAHVLATARSASKAAQARELGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            A++   E F+E+ +      G+D+ LDMVGA      L  L+  G+++ I+   G    
Sbjct: 190 VAVDSTGESFVEVAKGHG---GVDVALDMVGATVFADTLEALNPRGRIVYIASQAGAT-I 245

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  ++ K+  ITGSTLR R    K  +   ++  +WP +    +  ++    PL + 
Sbjct: 246 EVPIPVLMRKQAVITGSTLRPRNADEKARLAAEVERVVWPWIEQGKLRVLLDKRFPLSEA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E+  H+GK++L
Sbjct: 306 AAAHRYLEQGSHLGKVVL 323


>gi|21241564|ref|NP_641146.1| quinone reductase [Xanthomonas axonopodis pv. citri str. 306]
 gi|21106917|gb|AAM35682.1| quinone reductase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 325

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 127/318 (39%), Positives = 187/318 (58%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G ++ ++  E P P+P   ++LI+V A G+NRPD++QR G YPPP  A   LGLE+A
Sbjct: 13  DGKGDADALYATEQPRPRPAPGQVLIRVHAAGINRPDLLQRAGHYPPPPGAPETLGLEIA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G+IV   E    W +GD VCAL+ GGGYA+Y      H LPIP G + + AA+LPE+ FT
Sbjct: 73  GEIV---EPAGRWKVGDRVCALLGGGGYAQYAAVDARHVLPIPAGMDLVHAAALPETIFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
            +ANLF+   L +GQ +L+HG +SGIG TAIQ+A   GA V  TA+S  K     +LGA 
Sbjct: 130 AYANLFEHGRLAAGQWLLLHGATSGIGVTAIQMAKAAGAHVLATARSAVKAAQARELGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+     F+E+ +      G+D+ LDMVGA      L  L+  G+++ I+   G    
Sbjct: 190 VAIDSTTASFVEVAKAHG---GVDVALDMVGAAVFADTLEALNPHGRIVYIASQAGAT-I 245

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  ++ K+  ITGSTLR R+   K  +   ++  +WP +    +  ++    PL + 
Sbjct: 246 EVPIPVLMRKQAVITGSTLRPRSADEKARLAAEVERVVWPWIEQGKLRVLLDKRFPLREA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E+  H+GK++L
Sbjct: 306 AAAHRYLEQGSHLGKVVL 323


>gi|108801951|ref|YP_642148.1| zinc-binding alcohol dehydrogenase [Mycobacterium sp. MCS]
 gi|119871103|ref|YP_941055.1| alcohol dehydrogenase [Mycobacterium sp. KMS]
 gi|126437932|ref|YP_001073623.1| alcohol dehydrogenase [Mycobacterium sp. JLS]
 gi|108772370|gb|ABG11092.1| Alcohol dehydrogenase, zinc-binding protein [Mycobacterium sp. MCS]
 gi|119697192|gb|ABL94265.1| Alcohol dehydrogenase, zinc-binding domain protein [Mycobacterium
           sp. KMS]
 gi|126237732|gb|ABO01133.1| Alcohol dehydrogenase, zinc-binding domain protein [Mycobacterium
           sp. JLS]
          Length = 327

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 129/321 (40%), Positives = 196/321 (61%), Gaps = 13/321 (4%)

Query: 22  FLAESP-------IPQP--QKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            +AESP       +P+   Q  ++ I V A G+NR D++Q  G YPPPK A+ I+GLEV+
Sbjct: 4   IVAESPAKLIWTEVPERPLQSGDVRIDVVAAGINRADLLQAAGKYPPPKGASDIMGLEVS 63

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G I D+ ++ + W +G  VCAL+ GGGYAE      G  +P+P+  +   AA+LPE   T
Sbjct: 64  GVISDVADDVSGWAVGQPVCALLAGGGYAENVTVPAGQVMPVPESVDLAHAAALPEVACT 123

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
           VW+N+  TA L +G+ +LIHGG+SGIGT AIQ+A+  G  V  TA S  K   C +LGA+
Sbjct: 124 VWSNVVMTAALAAGEVLLIHGGASGIGTHAIQVANALGCRVAVTAGSANKLDLCRELGAE 183

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AINY  EDF+E L+ ET G G D+ILD++GA YL++++  L+  G+L II   GG +  
Sbjct: 184 VAINYRDEDFVERLRAETDGAGADVILDIMGAAYLDRNVDALATGGRLAIIGMQGG-VKA 242

Query: 253 EINLNPIISKRITITGSTLRRRT---DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPL 309
           E+N+  +++KR ++T + LR R      +K  I   +   +WP++    + P+I    P+
Sbjct: 243 ELNIGKLLAKRASVTATALRSRPVSGPGSKSDIVAEVVANVWPMVADGRVRPIIGAEFPV 302

Query: 310 GKVAMAHDIMEKSEHIGKIIL 330
            +   A ++++  E  GK++L
Sbjct: 303 QEAQAAQEMLDSGEVSGKVLL 323


>gi|294666433|ref|ZP_06731677.1| quinone reductase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292603802|gb|EFF47209.1| quinone reductase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 325

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/318 (39%), Positives = 186/318 (58%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G ++ ++  E P P+P   ++L++V A G+NRPD++QR G YPPP  A   LGLE+A
Sbjct: 13  DGKGDADALYATEQPRPRPAPGQVLVRVHAAGINRPDLLQRAGHYPPPPGAPETLGLEIA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G+IV   E    W +GD VCAL+ GGGYA+Y      H LPIP G + + AA+LPE+ FT
Sbjct: 73  GEIV---EPAGRWKVGDRVCALLGGGGYAQYAAVDARHVLPIPAGMDLVHAAALPETIFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
            +ANLF+   L +GQ +L+HG +SGIG TAIQ+A   GA V  TA+S  K     +LGA 
Sbjct: 130 AYANLFEHGRLAAGQWLLLHGATSGIGVTAIQMAKAAGAHVLATARSASKAAQARELGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+     F+E+ +      G+D+ LDMVGA      L  L+  G+++ I+   G    
Sbjct: 190 VAIDSTTASFVEVAKAHG---GVDVALDMVGAAVFADTLEALNPRGRIVYIASQAGAT-I 245

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  ++ K+  ITGSTLR R    K  +   ++  +WP +    +  ++    PL + 
Sbjct: 246 EVPIPVLMRKQAVITGSTLRPRHADEKARLAAEVERVVWPWIEQGKLRVLLDKRFPLSEA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E+  H+GK++L
Sbjct: 306 AAAHRYLEQGSHLGKMVL 323


>gi|296166904|ref|ZP_06849321.1| possible NADPH:quinone reductase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295897781|gb|EFG77370.1| possible NADPH:quinone reductase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 322

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 131/299 (43%), Positives = 185/299 (61%), Gaps = 7/299 (2%)

Query: 35  EILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCAL 94
           E+LIKV A GVNR D++Q  G YPPP  A+ I+G+EV+G + + G   T W+ G +VCAL
Sbjct: 26  EVLIKVAAAGVNRADLLQAAGKYPPPPGASEIIGMEVSGVVAETGAGVTDWSAGQQVCAL 85

Query: 95  VNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGG 154
           + GGGYAEY     G  LPIP   + + AA LPE   TVW+NL  TA+L  GQ +L+HGG
Sbjct: 86  LAGGGYAEYVAVPAGQVLPIPARVDLVDAAGLPEVACTVWSNLVMTAHLGKGQLLLVHGG 145

Query: 155 SSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRG 214
           +SGIG+ AIQ+A   G  V  TA S EK   C +LGA+  INY  EDF+E L+   Q  G
Sbjct: 146 ASGIGSHAIQVARALGVRVAVTAGSAEKLEFCRELGAEITINYRDEDFVERLR---QNGG 202

Query: 215 IDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR 274
            D+ILD++GA YL++++  L+ +G+L+II   GG I  E+N+  ++ KR  + G+TLR R
Sbjct: 203 ADVILDIMGAAYLDRNIDALATDGQLVIIGMQGG-IKGELNIAKLLGKRARVIGTTLRAR 261

Query: 275 TDIAKQSIRDSLQL---KIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                 S  + +Q     +WPL+    + P+I   LP+ +   AH  +  S+  GK++L
Sbjct: 262 PVTGPNSKTEIVQAVIGSVWPLIAEGRVRPIIGARLPIQRAGEAHQQLTSSKVTGKVVL 320


>gi|317122298|ref|YP_004102301.1| NAD(P)H quinone oxidoreductase, PIG3 family [Thermaerobacter
           marianensis DSM 12885]
 gi|315592278|gb|ADU51574.1| NAD(P)H quinone oxidoreductase, PIG3 family [Thermaerobacter
           marianensis DSM 12885]
          Length = 327

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 134/324 (41%), Positives = 200/324 (61%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +   G +  + L E P P+P   E+ I+V A  +NR D++QR+GLYPPP  ++P+
Sbjct: 1   MKAVLVRQPGGAENLVLGEFPTPEPGPGELRIRVRATALNRADILQRRGLYPPPPGSSPL 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE AG++  LGE    W +GD V AL+ GGGYA+Y        LPIP   +  +AA++
Sbjct: 61  LGLEAAGEVDALGEGCQGWRVGDRVFALLPGGGYAQYVTVPAAMALPIPPNLSFEEAAAI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+FFT +  LF    L+ G+ VLIH G+SG+GT AIQLA   GA V  TA +E K   C
Sbjct: 121 PEAFFTAYQALFWIGRLQPGEWVLIHAGASGVGTAAIQLARDAGAHVAVTAGTEPKLETC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+ A+NY +  F   +++    RG+D++LD VGA Y +Q+L  L+ +G+L++I+ +
Sbjct: 181 RQLGAEVAVNYKQGPFARAIREAVGDRGVDLVLDFVGAPYWDQNLECLATDGRLVLIATM 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +    +L  +++KR+ +TG+TLR R+   K  +      ++ P L S  I PVI  V
Sbjct: 241 GGGVVDRFDLRQLMAKRLQVTGTTLRSRSPEYKAQLTREFAARVLPKLASGRIRPVIDRV 300

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P  +V  AH  ME++ + GKI+L
Sbjct: 301 FPWDRVQDAHRYMERNLNTGKIVL 324


>gi|184201534|ref|YP_001855741.1| putative oxidoreductase [Kocuria rhizophila DC2201]
 gi|183581764|dbj|BAG30235.1| putative oxidoreductase [Kocuria rhizophila DC2201]
          Length = 327

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 201/327 (61%), Gaps = 5/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V     G   V+ ++E P P+     +LI+V A G+NR DV+QR+G YP P +A  +
Sbjct: 1   MRAVRDLESGGPEVLTVSEVPEPELTAGGVLIEVAAAGLNRADVLQRQGHYPVPPDATDV 60

Query: 67  LGLEVAGKIVDLGENT---THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
            GLEV+G +++LGE+       ++GD V ALV+ GGYAE  L+     LP+P+G + + A
Sbjct: 61  FGLEVSGTVLELGEDVPADAGLSVGDPVVALVDSGGYAERVLAPWQQVLPLPEGVDPVAA 120

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A LPE   TV++N+F  A  R G+T+L+HGG+ GIGT AIQ+A   G TV  T  SEEK 
Sbjct: 121 AGLPEVAATVFSNVFMAAAAREGETLLVHGGAGGIGTHAIQVARALGMTVLATVGSEEKA 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
               +LGA   I Y  EDF+  +++ T GRG D+ILD+VGA+YL+ +L  ++  G+++II
Sbjct: 181 RVVEELGAT-PIRYRDEDFVARVEELTDGRGADVILDVVGAKYLDPNLRAVATNGRIVII 239

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
              GG    E+N+  ++ KR  + G+TLR R    K +I  +++  +WPL+ +  + P++
Sbjct: 240 GMQGGATG-ELNVGRLLQKRAAVIGTTLRARPAAEKAAIMAAVREHVWPLVAAGRVRPLV 298

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
               PL +V  AH+  +   H+GK++L
Sbjct: 299 SRTFPLEQVREAHEYFDSGSHVGKVLL 325


>gi|254284430|ref|ZP_04959398.1| alcohol dehydrogenase, zinc-binding [gamma proteobacterium NOR51-B]
 gi|219680633|gb|EED36982.1| alcohol dehydrogenase, zinc-binding [gamma proteobacterium NOR51-B]
          Length = 333

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 187/308 (60%), Gaps = 1/308 (0%)

Query: 23  LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT 82
           L    IP P   E+LI+V   G+NR D++QRKGLYP P +A+P++GLEV+G ++  G++ 
Sbjct: 20  LHTDAIPTPSNGEVLIEVAFAGINRADLLQRKGLYPAPADASPVMGLEVSGIVLATGDDV 79

Query: 83  THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTAN 142
               +GD+VCAL +GGGYA +C++   H + +P+  +  QAA+LPE+  TVW+N+F  A 
Sbjct: 80  DPLKVGDKVCALTHGGGYASHCIARADHCISVPENLSLEQAAALPEALLTVWSNVFVRAG 139

Query: 143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDF 202
             +G+ +L+ GG+SGIGT  IQ+A   G  V + A S+EKC    +LG K  INY  +D 
Sbjct: 140 FSAGERLLMSGGTSGIGTLGIQMAVAMGGEVVSIAGSDEKCEMLRQLGCKAVINYRDQDL 199

Query: 203 LEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISK 262
            E   +      ID++LDMVG ++ +    L + +G+++ I  +GG + ++INL  +  K
Sbjct: 200 REAFDEAGYSGKIDVVLDMVGGDFTSTCFDLAAVDGRIVCIGIMGG-VKSQINLATLFMK 258

Query: 263 RITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS 322
           R+T+TGSTLRR +   K      ++  I PL+    I PVIH   PL     A + M+  
Sbjct: 259 RLTLTGSTLRRLSTEDKTQAFIDIRTHIVPLIAEGRIQPVIHATYPLAAALEAQEAMQTG 318

Query: 323 EHIGKIIL 330
            H GK++L
Sbjct: 319 THTGKLLL 326


>gi|294627738|ref|ZP_06706320.1| quinone reductase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292598090|gb|EFF42245.1| quinone reductase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
          Length = 326

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 126/318 (39%), Positives = 186/318 (58%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G ++ ++  E P P+P   ++L++V A G+NRPD++QR G YPPP  A   LGLE+A
Sbjct: 13  DGKGDADALYATEQPRPRPAPGQVLVRVHAAGINRPDLLQRAGHYPPPPGAPETLGLEIA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G+IV   E    W +GD VCAL+ GGGYA+Y      H LPIP G + + AA+LPE+ FT
Sbjct: 73  GEIV---EPAGRWKVGDRVCALLGGGGYAQYAAVDARHVLPIPAGMDLVHAAALPETIFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
            +ANLF+   L +GQ +L+HG +SGIG TAIQ+A   GA V  TA+S  K     +LGA 
Sbjct: 130 AYANLFEHGRLAAGQWLLLHGATSGIGVTAIQMAKAAGAHVLATARSASKAAQARELGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+     F+E+ +      G+D+ LDMVGA      L  L+  G+++ I+   G    
Sbjct: 190 VAIDSSIASFVEVAKAHG---GVDVALDMVGAAVFADTLEALNPRGRIVYIASQAGAT-I 245

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  ++ K+  ITGSTLR R    K  +   ++  +WP +    +  ++    PL + 
Sbjct: 246 EVPIPVLMRKQAVITGSTLRPRHADEKARLAAEVERVVWPWIEQGKLRVLLDKRFPLSEA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E+  H+GK++L
Sbjct: 306 AAAHRYLEQGSHLGKVVL 323


>gi|78046400|ref|YP_362575.1| putative quinone oxidoreductase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78034830|emb|CAJ22475.1| putative quinone oxidoreductase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 325

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 126/318 (39%), Positives = 185/318 (58%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G +  ++  E P P+P   ++LI+V A G+NRPD++QR G YPPP  A   LGLE+A
Sbjct: 13  DGKGDAEALYATEQPRPRPAPGQVLIRVHAAGINRPDLLQRTGHYPPPPGAPETLGLEIA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G+IV   E    W +G+ VCAL+ GGGYA+Y      H LPIP G + + AA+LPE+ FT
Sbjct: 73  GEIV---EPAGRWKVGERVCALLAGGGYAQYAAVDARHVLPIPAGMDLVHAAALPETIFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
            +ANLF+   L +GQ +L+HG +SGIG TAIQ+A   GA V  TA+S  K     +LGA 
Sbjct: 130 AYANLFEHGRLAAGQWLLLHGATSGIGVTAIQMAKAAGAHVLATARSASKAAQARELGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+     F+E+ +      G+D+ LDMVGA      L  L+  G+++ I+   G    
Sbjct: 190 VAIDSTTASFVEVAKAHG---GVDVALDMVGAAVFADTLEALNPRGRIVYIASQAGAT-I 245

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  ++ K+  ITGSTLR R    K  +   ++  +WP +    +  ++    PL + 
Sbjct: 246 EVPIPVLMRKQAVITGSTLRPRNADEKARLAAEVERVVWPWIEQGKLRVLLDKCFPLSEA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E+  H+GK++L
Sbjct: 306 AAAHRYLEQGSHLGKVVL 323


>gi|213965729|ref|ZP_03393922.1| quinone oxidoreductase [Corynebacterium amycolatum SK46]
 gi|213951680|gb|EEB63069.1| quinone oxidoreductase [Corynebacterium amycolatum SK46]
          Length = 322

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 130/324 (40%), Positives = 196/324 (60%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +  +       +  A++P P  +  ++L+KV+A GVNR D++Q  G YPPPK     
Sbjct: 1   MKAIIQTDLSNPRALEWADAPEPTLEDGQVLVKVKAAGVNRADLLQAAGHYPPPKGVTDT 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE AG I ++  ++  W +GDEVC L++GG YAE      G  LP+  GY+  +AAS+
Sbjct: 61  LGLECAGVIEEVKGDSQGWKVGDEVCCLLSGGAYAEKVAVPAGQILPLSHGYSFTEAASI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
            E   TV++N+   A L+ G  +L+HGG+ GIGT AIQ+A   GA V  TA S EK   C
Sbjct: 121 VEVACTVFSNVVMIAGLKEGDLLLVHGGAGGIGTFAIQMAKRLGARVAVTAGSAEKLAKC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY +EDF EI+  E    G ++ILD++GA+YL++++  L+K+G L+II   
Sbjct: 181 KELGADILINYKEEDFAEIVAAEG---GANVILDIMGAKYLDRNVKALAKDGHLVIIGMQ 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E+N+  ++SKR +IT + LR R    K  I ++ +  IWP+L    + P IH V
Sbjct: 238 GG-VKGELNIGRLLSKRGSITATGLRYRDLADKARIVNATEDTIWPMLADGTVTPQIHEV 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           + +   A AH++++     GKI+L
Sbjct: 297 MDMRDAAKAHELLDSGAVSGKIVL 320


>gi|295688065|ref|YP_003591758.1| NAD(P)H quinone oxidoreductase [Caulobacter segnis ATCC 21756]
 gi|295429968|gb|ADG09140.1| NAD(P)H quinone oxidoreductase, PIG3 family [Caulobacter segnis
           ATCC 21756]
          Length = 325

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 195/318 (61%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G +  +    +  P+P   +ILIKV A GVNRPD++QR G YPPP  A   LGLEVA
Sbjct: 12  GGKGAAEALKAVTANRPEPGPGQILIKVAAAGVNRPDLLQRMGFYPPPPGAPETLGLEVA 71

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G++V        W +GD+VCAL+ GGGYAEY +    H LPIP   + I AA+LPE+ FT
Sbjct: 72  GEVV---VGAGRWKVGDKVCALLGGGGYAEYAVVDARHALPIPGDLDLIHAAALPETVFT 128

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
           V+AN+F+   L++G+T+L+HGG+SGIGTTAI +A   GA V  T +  +K    L+LGA 
Sbjct: 129 VFANVFEHGALKAGETLLVHGGTSGIGTTAIAMAKAAGAKVIATGRGADKKAKALELGAD 188

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+   EDF E+++      G D+ILDMVGA Y  ++L  L+  G+++ I+ LGG+   
Sbjct: 189 IAIDAKTEDFAEVVKAAG---GADVILDMVGASYFEKNLDALNTGGRIVYIASLGGST-L 244

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  I+ KR  ITGSTLR R    K  +   ++   WP + +  + P++    PL   
Sbjct: 245 EVPVMKIMQKRAVITGSTLRPRPADEKARLAAEVERVAWPWVAAGKLKPIVDATFPLALA 304

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E  EH+GK++L
Sbjct: 305 AKAHAHLEAGEHVGKVVL 322


>gi|325926528|ref|ZP_08187844.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Xanthomonas
           perforans 91-118]
 gi|325928131|ref|ZP_08189341.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Xanthomonas
           perforans 91-118]
 gi|325541501|gb|EGD13033.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Xanthomonas
           perforans 91-118]
 gi|325543036|gb|EGD14483.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Xanthomonas
           perforans 91-118]
          Length = 325

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 126/318 (39%), Positives = 186/318 (58%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G ++ ++  E P P+P   ++LI+V A G+NRPD++QR G YPPP  A   LGLE+A
Sbjct: 13  DGKGDADALYATEQPRPRPAPGQVLIRVHAAGINRPDLLQRAGHYPPPPGAPETLGLEIA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G+IV   E    W +G+ VCAL+ GGGYA+Y      H LPIP G + + AA+LPE+ FT
Sbjct: 73  GEIV---EPAGRWKVGERVCALLGGGGYAQYAAVDARHVLPIPAGMDLVHAAALPETIFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
            +ANLF+   L +GQ +L+HG +SGIG TAIQ+A   GA V  TA+S  K     +LGA 
Sbjct: 130 AYANLFEHGWLAAGQWLLLHGATSGIGVTAIQMAKAAGAHVLATARSASKAAQARELGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+     F+E+ +      G+D+ LDMVGA      L  L+  G+++ I+   G    
Sbjct: 190 VAIDSTTASFVEVAKAHG---GVDVALDMVGAAVFADTLEALNPRGRIVYIASQAGAT-I 245

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  ++ K+  ITGSTLR R    K  +   ++  +WP +    +  ++    PL + 
Sbjct: 246 EVPIPVLMRKQAVITGSTLRPRNADEKARLAAEVERVVWPWIEQGKLRVLLDKCFPLSEA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E+  H+GK++L
Sbjct: 306 AAAHRYLEQGSHLGKVVL 323


>gi|226303752|ref|YP_002763710.1| oxidoreductase [Rhodococcus erythropolis PR4]
 gi|226182867|dbj|BAH30971.1| putative oxidoreductase [Rhodococcus erythropolis PR4]
          Length = 329

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 135/327 (41%), Positives = 195/327 (59%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G   VM  A+ P P+  +  +L++V A  VNR D++QR+G YPPP  A+ I
Sbjct: 1   MYAITIDQPGGPEVMKWAQQPDPELPRGHVLVEVAATAVNRADLLQRQGFYPPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G IV+LGE+ T W++GDEVCAL+ GGGYAE         LP+P G +   AASL
Sbjct: 61  LGLECSGVIVELGEDVTGWSVGDEVCALLAGGGYAEKVAVPATQLLPVPAGVDLRVAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+     LR GQ +L+HGG  GIGT AIQ+    GA V  TA SE+K   C
Sbjct: 121 PEVACTVWSNVVMRGGLRRGQVLLVHGGGGGIGTHAIQVGKALGARVAVTAGSEDKLNRC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY   DF+  L + T   G D++LD +GA YL +++  L+ +G ++II   
Sbjct: 181 RELGADILINYRDSDFVASLAEATDNHGADVVLDNMGASYLGRNVDALAMDGHVVIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDI---AKQSIRDSLQLKIWPLLNSHVIAPVI 303
           GG    E+++  ++ KR  IT + LR R       K  I   ++ K+WPL+    + P++
Sbjct: 241 GGR-KGEVDIAKLMGKRGNITSTGLRGRPLTGPGGKADIVADVRAKLWPLIADGSVQPIV 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            T LP+ +  +AH +++  E +GK+IL
Sbjct: 300 STELPITEAPLAHQLLDSPETVGKVIL 326


>gi|109898484|ref|YP_661739.1| zinc-binding alcohol dehydrogenase [Pseudoalteromonas atlantica
           T6c]
 gi|109700765|gb|ABG40685.1| Alcohol dehydrogenase, zinc-binding protein [Pseudoalteromonas
           atlantica T6c]
          Length = 327

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 197/317 (62%), Gaps = 8/317 (2%)

Query: 18  SNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVD 77
           ++ +F+ ++  P  ++ ++L+KV + G+NR D +QR+G YP P+  +PILGLEV+G+IV 
Sbjct: 12  TDTLFVNDTTKPTLKQGQVLVKVHSFGINRADTLQRQGKYPAPRGESPILGLEVSGEIVS 71

Query: 78  LG----ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTV 133
           LG      ++ W IGDEV ALV GGGYA+Y   +  H +P PK  +   AA + E F T 
Sbjct: 72  LGISADNESSRWQIGDEVFALVAGGGYAQYVAVNSEHLMPKPKNVDMPSAAGIAEVFLTA 131

Query: 134 WANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKH 193
           + +LFQ   L++GQ VLIH G+S +G  AIQLA   G  V  TA +E+K   C K GA  
Sbjct: 132 YQSLFQVGGLKTGQRVLIHAGASAVGLAAIQLAKADGCHVSVTASTEKKLAVCEKYGADR 191

Query: 194 AINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATE 253
            INY  ++F E  +   QG G+D+I+D V  +YLN++L +L+ +G ++ ++ L G  A +
Sbjct: 192 LINYKTQNFAECFE---QG-GVDVIIDFVAGDYLNRNLKILNADGTIVYLAMLAGRYADK 247

Query: 254 INLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA 313
           +++  +++KR TITGSTLR R+D  K  +      +     ++  + PVI T   +  +A
Sbjct: 248 VDMALMLAKRATITGSTLRSRSDEYKSVLIHDFCHRFLADFDNGALRPVIDTQYNVKDIA 307

Query: 314 MAHDIMEKSEHIGKIIL 330
           + H+ +E+++ +GK+++
Sbjct: 308 LTHERLERNDTMGKLVV 324


>gi|118470180|ref|YP_890576.1| quinone oxidoreductase [Mycobacterium smegmatis str. MC2 155]
 gi|118171467|gb|ABK72363.1| quinone oxidoreductase [Mycobacterium smegmatis str. MC2 155]
          Length = 325

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 126/303 (41%), Positives = 185/303 (61%), Gaps = 6/303 (1%)

Query: 31  PQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDE 90
           P   E+LIKV   G+NR D++Q  G YPPP  A+ ++GLEV+G +  LG+  + W++G  
Sbjct: 22  PANGEVLIKVHTAGINRADLLQAAGKYPPPPGASEVIGLEVSGTVEALGDGVSGWSVGQP 81

Query: 91  VCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVL 150
           VCAL+ GGGYAEY        LP+P G +   AA LPE   TVW+N+  TA L +G  +L
Sbjct: 82  VCALLAGGGYAEYVAVPAPQVLPVPDGVSLRDAAGLPEVACTVWSNVVMTAGLTAGHLLL 141

Query: 151 IHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKET 210
           +HGG+SGIGT AIQ+A   GA V  TA SEEK   C  LGA   INY +EDF+E L++ET
Sbjct: 142 VHGGASGIGTHAIQVAKAMGARVAVTAGSEEKLGICRDLGADITINYREEDFVERLRRET 201

Query: 211 QGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGST 270
              G D+ILD++GA YL++++  L+  G+L+II   GG +  E+N+  ++ KR  +  ++
Sbjct: 202 D--GADVILDIMGAAYLDRNVDALATGGRLVIIGMQGG-VKAELNIGKLLGKRAGVIATS 258

Query: 271 LRRR---TDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGK 327
           LR R       K  I  +++  +WP++    + P+I   LP+      HD++   +  GK
Sbjct: 259 LRPRPVDGPGGKGEIVRAVRENVWPMIADGRVKPIIGAELPIENAQQGHDLLASGKVTGK 318

Query: 328 IIL 330
           ++L
Sbjct: 319 VLL 321


>gi|111021101|ref|YP_704073.1| NADPH:quinone reductase [Rhodococcus jostii RHA1]
 gi|110820631|gb|ABG95915.1| probable NADPH:quinone reductase [Rhodococcus jostii RHA1]
          Length = 331

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 129/327 (39%), Positives = 199/327 (60%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G   VM  AE P P+     +L+ V A  VNR D++QR+G YPPP  A+ +
Sbjct: 1   MYAITIDQPGGPEVMKWAEQPDPELPPGHVLLDVAATAVNRADLLQRQGFYPPPPGASDV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I +LGE  + W++GD+VCAL+ GGGYAE         LP+P+G + + AASL
Sbjct: 61  LGLECSGTIAELGEGVSGWSVGDQVCALLAGGGYAEKVAVPASQLLPLPEGVDLLVAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+   A L  G  +L+HGG  GIGT AIQ+    GA V  TA SEEK   C
Sbjct: 121 PEVACTVWSNVVMGAGLSRGDVLLVHGGGGGIGTHAIQVGVALGARVAVTAGSEEKLARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   +NY + DF++ ++K T G G D+ILD +G  YL++++ +L+ +G+L++I   
Sbjct: 181 RELGADILVNYREADFVDEIRKATDGHGADVILDNMGGSYLDRNVDVLAADGRLVVIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDI---AKQSIRDSLQLKIWPLLNSHVIAPVI 303
           GG    E++L  ++SKR  +T + LR R +     K  I   ++ ++WPL+    + P++
Sbjct: 241 GGR-KGELDLGKLLSKRGHVTAAGLRGRAESGHEGKADIVADVRKRLWPLIAEGAVHPIV 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
              LP+ +    H++++ ++ +GK+IL
Sbjct: 300 AAELPITEAPRGHELLDSADTVGKVIL 326


>gi|197106668|ref|YP_002132045.1| alcohol dehydrogenase zinc-containing [Phenylobacterium zucineum
           HLK1]
 gi|196480088|gb|ACG79616.1| alcohol dehydrogenase zinc-containing [Phenylobacterium zucineum
           HLK1]
          Length = 326

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 136/318 (42%), Positives = 190/318 (59%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G +  +    +P+PQP   EILI+V A GVNRPD++QR G YPPP  A   LGLE A
Sbjct: 13  GGKGPAAALKPVRAPVPQPNAGEILIRVRAAGVNRPDIVQRNGFYPPPPGAPDTLGLEAA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G++V        W  GD VCAL+ GGGYAEY +    H LPIP+G +  +AA LPE+ FT
Sbjct: 73  GEVV---AGAGRWKAGDRVCALLGGGGYAEYAVCDARHALPIPEGLSFEEAAGLPETVFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
           V+AN+F+   L+SG+T+L+HG +SGIGTTAIQ+A   GA V  TA+   K     +LGA 
Sbjct: 130 VFANVFEHGALKSGETLLLHGATSGIGTTAIQMAKAAGARVIATARGAAKAETARRLGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+   EDF  + +      G+D++LDMVG +Y  ++L  L   G+++ I+ L G   T
Sbjct: 190 IAIDAAAEDFGAVAKAAG---GVDVVLDMVGGDYFAKNLEALKTGGRIVYIASLAGAEIT 246

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
            + +  I+ KR  ITGSTLR R    K  +   ++  +WP + +  + P +    PL + 
Sbjct: 247 -VPIFRIMQKRAVITGSTLRPRDADEKARLAAEVERIVWPWIAAGKVKPQVDRTFPLAEA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E   H+GK+IL
Sbjct: 306 AAAHAHLESGGHVGKVIL 323


>gi|163796343|ref|ZP_02190304.1| NADPH/quinone reductase and related Zn-dependent oxidoreductase
           [alpha proteobacterium BAL199]
 gi|159178485|gb|EDP63027.1| NADPH/quinone reductase and related Zn-dependent oxidoreductase
           [alpha proteobacterium BAL199]
          Length = 344

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 195/318 (61%), Gaps = 13/318 (4%)

Query: 23  LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI------- 75
           +   P+PQP ++EILI+V A G+NR D+ QR+G + PP  A+ +LGLEV+G +       
Sbjct: 19  MGSRPVPQPGRDEILIRVVAAGINRADLAQRQGRHAPPPGASDVLGLEVSGIVEAVGPED 78

Query: 76  -VDLGENTT--HWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
            +D+G  +       GD VCAL+ GGGYA+Y ++ +   LP+P   + ++AA+LPE+ FT
Sbjct: 79  PLDIGPASRIPAPQPGDRVCALLAGGGYADYVIASRQCVLPVPGDLDMVEAAALPEAAFT 138

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
           VW N+     L   + VL+H G+SG+GT A+QLA      ++ TA +E K  AC+ LGA+
Sbjct: 139 VWDNMVTRGELDIPKAVLVHAGASGVGTLALQLARTLDCRIFATAGTEAKRAACVSLGAE 198

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            A +Y  ED+    +   Q  G DI+LD+VGA +L ++L +++ EG+LI I F+GG  A 
Sbjct: 199 RAFDYRTEDWAA--EINAQCGGADIVLDLVGASHLAKNLEVMAPEGRLITIGFVGGATA- 255

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           ++++  +  KR+T+TGS LR R  + K +I +++   +WP +    I P+IHT   L  V
Sbjct: 256 DLDMRAVARKRLTLTGSLLRGRNAVQKSAIAEAVYAGLWPKIARREIEPIIHTTFALEDV 315

Query: 313 AMAHDIMEKSEHIGKIIL 330
             AH ++     IGK++L
Sbjct: 316 DQAHTLLAGDSVIGKLVL 333


>gi|325920941|ref|ZP_08182830.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Xanthomonas
           gardneri ATCC 19865]
 gi|325548561|gb|EGD19526.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Xanthomonas
           gardneri ATCC 19865]
          Length = 325

 Score =  248 bits (634), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 188/318 (59%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G ++ ++++  P P+P    +LI+V A G+NRPD++QR G YPPP  A   LGLE+A
Sbjct: 13  DGKGDADALYVSVQPRPRPAPGHVLIRVHAAGINRPDLLQRAGHYPPPPGAPETLGLEIA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           GKIV   E    W +GD VCAL+ GGGYA+Y      H LPIP G + + AA+LPE+ FT
Sbjct: 73  GKIV---EPAGRWKVGDRVCALLGGGGYAQYAAVDARHVLPIPAGMDLVHAAALPETIFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
            +ANLF+   L +G+ +L+HG +SGIG TAIQ+A   GA V  TA+S  K     +LGA 
Sbjct: 130 AYANLFEHGRLAAGEWLLLHGATSGIGVTAIQMAKAAGARVLATARSAGKAAQARELGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+   E F+ + +      G+D+ LDMVGA      L  L+  G+++ I+   G+   
Sbjct: 190 VAIDSTTESFVAVAKAHG---GVDVSLDMVGAAVFADTLEALNPRGRIVYIASQAGST-I 245

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  ++ K+  +TGSTLR R+   K  +   ++  +WP +    +  ++    PL + 
Sbjct: 246 EVPIPLLMRKQAILTGSTLRPRSADEKARLAAEVERVVWPWIAQGKLRVLLDKRFPLSEA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E+  H+GK++L
Sbjct: 306 AAAHRYLEQGSHLGKVVL 323


>gi|118465136|ref|YP_879534.1| quinone oxidoreductase [Mycobacterium avium 104]
 gi|254773300|ref|ZP_05214816.1| quinone oxidoreductase [Mycobacterium avium subsp. avium ATCC
           25291]
 gi|118166423|gb|ABK67320.1| quinone oxidoreductase [Mycobacterium avium 104]
          Length = 326

 Score =  248 bits (634), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 127/288 (44%), Positives = 180/288 (62%), Gaps = 6/288 (2%)

Query: 46  NRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCL 105
           NR DV+Q  G YPPP  A+  +G+EV+G I ++G+  T W++G EVCAL+ GGGYAEY  
Sbjct: 40  NRADVLQAAGKYPPPPGASETIGMEVSGVIAEVGDGVTEWSVGQEVCALLAGGGYAEYVA 99

Query: 106 SHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQL 165
              G  LPIP G + + AA LPE   TVW+NL   A LR+GQ +L+HGG+SGIG+ AIQ+
Sbjct: 100 VPAGQLLPIPAGVDLVDAAGLPEVACTVWSNLVLIAGLRNGQLLLVHGGASGIGSHAIQV 159

Query: 166 ASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAE 225
           A   GA V  TA S EK   C +LGA   INY  EDF+  L  ET   G D+ILD++GA 
Sbjct: 160 ARALGARVAVTAGSAEKLGFCRELGADITINYRDEDFVARLADETG--GADVILDIMGAA 217

Query: 226 YLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR---TDIAKQSI 282
           YL++++  L+ +G+L+II   GG +  E+N+  +++KR  + G+TLR R      +K  I
Sbjct: 218 YLDRNIDALATDGQLVIIGMQGG-VKAELNIGKLLAKRARVIGTTLRGRPVSGPNSKTEI 276

Query: 283 RDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             ++   +WP++    + P+I   LP+ +   AH  +  SE  GKI+L
Sbjct: 277 VQAVTASVWPMIADGRVRPIIGARLPIQQAGDAHRRLVASEVTGKIVL 324


>gi|227539582|ref|ZP_03969631.1| possible NADPH:quinone reductase [Sphingobacterium spiritivorum
           ATCC 33300]
 gi|227240495|gb|EEI90510.1| possible NADPH:quinone reductase [Sphingobacterium spiritivorum
           ATCC 33300]
          Length = 322

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 134/325 (41%), Positives = 200/325 (61%), Gaps = 6/325 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNA-NP 65
           M+ V +S +G   V+   E P+P     E+LI+V+A G+NRPDV QRKG YP P      
Sbjct: 1   MKAVVISSFGDPEVLKTEERPVPAVGDHEVLIRVKAAGINRPDVFQRKGNYPAPAGVVAD 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLE++G I   G     W  GDEV AL+ GGGYAEY +   G  +  P+  +  +AA+
Sbjct: 61  IPGLEISGVIEATGSMAGSWKTGDEVLALIAGGGYAEYAVVDAGSCMLKPQNLSYEEAAA 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           +PE+ FTVW NLF+   L+ G+ VLIHGGS GIG+ AIQLA+  GA VY TA ++EKC  
Sbjct: 121 IPETVFTVWHNLFERGQLKKGERVLIHGGSGGIGSAAIQLAALSGAQVYATAGNKEKCEF 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C  LGA  AINY +EDF E+L++     G+D+ILD +G +Y N+++ +L+ +G+L+ I+ 
Sbjct: 181 CESLGAVRAINYHEEDFEEVLKES----GVDVILDCIGGDYFNKNIAILNPDGRLVYINA 236

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           + G    ++N+  ++ KR+++TGSTLR R    K  +  S+   ++P + S    P++  
Sbjct: 237 MEG-AKVQLNILQMMQKRLSVTGSTLRARDKDFKAELTRSVVRHVFPFIESKAFKPMLFK 295

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
                +   AH +ME+   +GK++L
Sbjct: 296 SFDFTQAEQAHRLMEEGHFLGKLVL 320


>gi|152964278|ref|YP_001360062.1| quinone oxidoreductase PIG3 [Kineococcus radiotolerans SRS30216]
 gi|151358795|gb|ABS01798.1| Quinone oxidoreductase putative PIG3 [Kineococcus radiotolerans
           SRS30216]
          Length = 329

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 200/325 (61%), Gaps = 3/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V +   G   V+   + P P     E++++V A GVNR DV QR G YP P  A   
Sbjct: 1   MRAVIVDRPGGPEVLVPTDLPDPVAGPGEVVVRVAAAGVNRADVAQRLGKYPSPPGAPQN 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G +   G       +G+EVCAL+ GGGYAE  +   G  LP+P+G   ++AA+L
Sbjct: 61  PGLEVSGWVESAGPGVAR-AVGEEVCALLGGGGYAERVVVPAGQLLPVPQGVGLVEAAAL 119

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F  A LR G+ +L+HGGSSGIGT AIQLA   GA V  TA S +K   C
Sbjct: 120 PEVACTVWSNVFTLAGLRPGELLLVHGGSSGIGTMAIQLARQIGARVAVTAGSADKLERC 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA+  +NY  +DF+E + +  +  G D++LD+VGA YL ++L +L+  G+L++I+  
Sbjct: 180 AELGAQVLVNYRDDDFVERV-RAFEPAGADVVLDLVGAPYLARNLDVLATGGRLVVIATQ 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E++L  ++ KRI++  + LR R    K  I  S++  +WPL+    + PV+H  
Sbjct: 239 GGTHA-ELDLGLLMRKRISLHATGLRYRPAEEKAGIVASVRDHVWPLVADGAVRPVVHAT 297

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
            PL + A AH++ME S H+GK++L+
Sbjct: 298 FPLAEAARAHEVMEGSSHVGKLLLV 322


>gi|225020136|ref|ZP_03709328.1| hypothetical protein CORMATOL_00132 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224947101|gb|EEG28310.1| hypothetical protein CORMATOL_00132 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 323

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 192/313 (61%), Gaps = 8/313 (2%)

Query: 18  SNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVD 77
              + LAE P PQ +  E+L+KV A GVNR D++Q  G YPPP   + I+GLE AG+IVD
Sbjct: 9   DKTLELAEVPTPQLRAGEVLVKVHATGVNRADLLQAAGYYPPPPGESEIMGLECAGEIVD 68

Query: 78  LGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANL 137
            G+  T   +G++V  L+ GGGYAEY     G  LPIP+GY+  QAA++ E   TVW+NL
Sbjct: 69  TGD--TDRQVGEKVACLLAGGGYAEYVAVPAGQLLPIPEGYSYEQAAAVVEVAATVWSNL 126

Query: 138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINY 197
                L +GQTVLIHGG+ GIGT AIQLA + GA V  TA S EK  AC +LGA   INY
Sbjct: 127 GMLTGLAAGQTVLIHGGAGGIGTFAIQLAKHLGAQVAVTAGSVEKLEACRRLGADILINY 186

Query: 198 LKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLN 257
            +E+F ++L+        D ILD++GA+YL+Q++T L+ +G ++II   GG +  E+N+ 
Sbjct: 187 REENFADVLKNRC-----DRILDIIGAKYLDQNVTALAPDGHMVIIGMQGG-VKGELNIG 240

Query: 258 PIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHD 317
            +++KR TI+ + LR R+   K  I       +WPLL    I   +H  LPL   A AH+
Sbjct: 241 KLLAKRGTISATALRARSHADKARIVTDTIEHVWPLLADGTITHQLHATLPLADAARAHE 300

Query: 318 IMEKSEHIGKIIL 330
           ++      G ++L
Sbjct: 301 LLRSGAVTGTLVL 313


>gi|145221781|ref|YP_001132459.1| alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]
 gi|145214267|gb|ABP43671.1| Alcohol dehydrogenase, zinc-binding domain protein [Mycobacterium
           gilvum PYR-GCK]
          Length = 324

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 131/308 (42%), Positives = 185/308 (60%), Gaps = 5/308 (1%)

Query: 27  PIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWN 86
           P P P   E+LI+V A GVNR D++Q  G YPPP  A+ I+GLE +G I  +G+  T W+
Sbjct: 14  PDPTPGPGEVLIRVHAAGVNRADLLQAAGKYPPPPGASEIIGLEASGTIAAVGDGVTEWS 73

Query: 87  IGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSG 146
            G  VCAL+ GGGYAEY     G  LP+P G     AA LPE   TVW+NL  TA LR+ 
Sbjct: 74  EGQRVCALLAGGGYAEYVAVPAGQVLPVPDGVPLDHAAGLPEVACTVWSNLVMTARLRAP 133

Query: 147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEIL 206
           + +LIHGG+SGIGT AIQ+A      V  TA S  K   C +LGA+  I+Y  EDF+E+L
Sbjct: 134 ELLLIHGGASGIGTHAIQVARALNCRVAVTAGSRNKLDLCAELGAEITIDYHHEDFVEVL 193

Query: 207 Q-KETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRIT 265
           +  ++   G D+ILD++GA YL++++  L+  G+L+II   GG  A EINL  +++KR +
Sbjct: 194 RGADSDHPGADVILDIMGASYLDRNIDALATGGRLVIIGMQGGTKA-EINLGKLLAKRGS 252

Query: 266 ITGSTLRRRTDIAKQS---IRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS 322
           +  + LR R    + S   I   +   +WPL+    + PVI    P+ +   AH+++   
Sbjct: 253 VMATALRSRPVTGRGSKSVIVSEVIENVWPLVADGQVRPVIGAEFPISEAQAAHELLASG 312

Query: 323 EHIGKIIL 330
           +  GK+IL
Sbjct: 313 DVSGKVIL 320


>gi|300773734|ref|ZP_07083603.1| NADPH:quinone reductase [Sphingobacterium spiritivorum ATCC 33861]
 gi|300759905|gb|EFK56732.1| NADPH:quinone reductase [Sphingobacterium spiritivorum ATCC 33861]
          Length = 322

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 200/325 (61%), Gaps = 6/325 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN-ANP 65
           M+ V +S  G   V+ + + P+P    +E+LI+V+A G+NRPDV QRKG YP P      
Sbjct: 1   MKAVVISSSGGPEVLKVEDRPVPVVGDQEVLIRVKAAGINRPDVFQRKGNYPAPAGVVAD 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLE++G I   G     W  GDEV AL+ GGGYAEY +   G  +  P+  +  +AA+
Sbjct: 61  IPGLEISGVIEATGSMAGSWKAGDEVLALIAGGGYAEYAVVDAGSCMLKPENLSYEEAAA 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+ FTVW NLF+   L+ G+ VLIHGGS GIG+TAIQLA+  GA VY TA S EKC  
Sbjct: 121 LPETVFTVWHNLFERGQLKKGERVLIHGGSGGIGSTAIQLAALSGAEVYATAGSREKCEF 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C  LGA  AINY +EDF E+L++     G+D+ILD +G +Y N+++ +L+ +G+L+ I+ 
Sbjct: 181 CESLGAVRAINYHEEDFEEVLKES----GVDVILDCIGGDYFNKNIAILNPDGRLVYINA 236

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
           + G    ++N+  ++ KR+ ITGSTLR R    K  +  S+   ++P + S    P++  
Sbjct: 237 MEG-AKVQLNILQMMQKRLAITGSTLRARDKSFKAELTASVVGNVFPFIESKAFKPMLFK 295

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
                +   AH +ME+   +GK++L
Sbjct: 296 SFDFTQAEQAHRLMEEGHFLGKLVL 320


>gi|322420878|ref|YP_004200101.1| NAD(P)H quinone oxidoreductase, PIG3 family [Geobacter sp. M18]
 gi|320127265|gb|ADW14825.1| NAD(P)H quinone oxidoreductase, PIG3 family [Geobacter sp. M18]
          Length = 329

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 193/327 (59%), Gaps = 5/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V M G+G   V+ + E   P P++ E+LIKV A  +NRPD++QR+G YPPP   + I
Sbjct: 1   MKAVLMEGFGGVEVLKVGEVDKPTPKENEVLIKVYATSINRPDLVQREGKYPPPPGDSEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEV+G +  LG   T W +GD V +LV GGGYAEY +++  H +PIP+  +  +AA +
Sbjct: 61  LGLEVSGVVEALGAGVTGWKVGDRVVSLVGGGGYAEYAVAYANHLMPIPESVSFEEAACI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG--ATVYTTAKSEEKCL 184
            ES+ T + N+F    L+ G+T ++HGG  G+ T AIQL       + +  TA S EK  
Sbjct: 121 CESYITAFLNVFMIGGLQDGETAILHGGGGGVNTAAIQLCKALAPKSKLIVTA-SPEKIE 179

Query: 185 ACLKLGAKHAINYLKE-DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
               LGA   IN+ +  DF E++++ T  +G+D+ILD VGA+YL  ++  L  +G+L+II
Sbjct: 180 RVKALGADLVINFRETPDFSEVVKEFTNKKGVDVILDHVGAKYLAPNMNSLGYKGRLVII 239

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             + G I  E+NL  ++ KR  I GS LR R    K  I      +  P      I P+I
Sbjct: 240 GVISG-IKAELNLALMMVKRQQIIGSVLRSRPVSEKGEIAAEFVRRAMPKFADRTIVPII 298

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             V P+ +V  AH +ME+ +H GKI+L
Sbjct: 299 EKVFPIDQVVEAHRMMEEDKHFGKIVL 325


>gi|315446481|ref|YP_004079360.1| NAD(P)H quinone oxidoreductase, PIG3 family [Mycobacterium sp.
           Spyr1]
 gi|315264784|gb|ADU01526.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Mycobacterium
           sp. Spyr1]
          Length = 328

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 131/308 (42%), Positives = 185/308 (60%), Gaps = 5/308 (1%)

Query: 27  PIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWN 86
           P P P   E+LI+V A GVNR D++Q  G YPPP  A+ I+GLE +G I  +G+  T W+
Sbjct: 18  PDPTPGPGEVLIRVHAAGVNRADLLQAAGKYPPPPGASEIIGLEASGTIAAVGDGVTEWS 77

Query: 87  IGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSG 146
            G  VCAL+ GGGYAEY     G  LP+P G     AA LPE   TVW+NL  TA LR+ 
Sbjct: 78  EGQRVCALLAGGGYAEYVAVPAGQVLPVPDGVPLDHAAGLPEVACTVWSNLVMTARLRAP 137

Query: 147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEIL 206
           + +LIHGG+SGIGT AIQ+A      V  TA S  K   C +LGA+  I+Y  EDF+E+L
Sbjct: 138 ELLLIHGGASGIGTHAIQVARALNCRVAVTAGSRNKLDLCAELGAEITIDYHHEDFVEVL 197

Query: 207 QK-ETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRIT 265
           +  ++   G D+ILD++GA YL++++  L+  G+L+II   GG  A EINL  +++KR +
Sbjct: 198 RDADSDHPGADVILDIMGASYLDRNIDALATGGRLVIIGMQGGTKA-EINLGKLLAKRGS 256

Query: 266 ITGSTLRRRTDIAKQS---IRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS 322
           +  + LR R    + S   I   +   +WPL+    + PVI    P+ +   AH+++   
Sbjct: 257 VMATALRSRPVTGRGSKSVIVSEVIENVWPLVADGQVRPVIGAEFPISEAQAAHELLASG 316

Query: 323 EHIGKIIL 330
           +  GK+IL
Sbjct: 317 DVSGKVIL 324


>gi|229591699|ref|YP_002873818.1| putative zinc-binding dehydrogenase [Pseudomonas fluorescens SBW25]
 gi|229363565|emb|CAY50844.1| putative zinc-binding dehydrogenase [Pseudomonas fluorescens SBW25]
          Length = 326

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 129/324 (39%), Positives = 196/324 (60%), Gaps = 2/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V     G   V+ + E P+P+    E+LI+V A GVNRPD+MQR G  P P     +
Sbjct: 1   MKAVIACEPGGPEVLQVVERPVPELHAGEVLIRVTAAGVNRPDLMQRNG-SPIPSGVTDV 59

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE AG +V +G     + IGD V AL++GGGYAEYC++   H LP+P G +   AA +
Sbjct: 60  LGLEAAGIVVVVGTGVDEFAIGDRVMALLSGGGYAEYCVAQAAHCLPVPAGLSLHDAAGV 119

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+ F VW NLF+   LRSG T LIHG +SG+G+ A+Q A   GA V  TA   +K    
Sbjct: 120 PEAAFAVWHNLFELGRLRSGDTALIHGAASGVGSFAVQCAHAAGARVIATAGGPQKVAML 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LG   A++   EDF++ +   T+GRG+D++LD VG  Y+ ++L  ++  G+ + +SFL
Sbjct: 180 QALGVWRAVDRHAEDFVDAVNDCTEGRGVDVVLDNVGGPYVARNLAAMAMGGRHVSLSFL 239

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G    E++L  ++ K +++T STLR ++   K  +   ++ ++ P L S ++ P +H  
Sbjct: 240 QG-ARIELDLQVLMRKNLSLTSSTLRPKSHAEKARLAVCIRSRLLPWLASGLVRPQVHAQ 298

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LPL + A AH ++E + +IGK++L
Sbjct: 299 LPLAQAADAHRLLEANANIGKVVL 322


>gi|229492471|ref|ZP_04386274.1| quinone oxidoreductase [Rhodococcus erythropolis SK121]
 gi|229320457|gb|EEN86275.1| quinone oxidoreductase [Rhodococcus erythropolis SK121]
          Length = 329

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 134/327 (40%), Positives = 193/327 (59%), Gaps = 4/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G   VM  A+ P P+  +  +L++V A  VNR D++QR+G YPPP  A+ I
Sbjct: 1   MYAITIDQPGGPEVMKWAQQPDPELPRGHVLVEVAATAVNRADLLQRQGFYPPPPGASDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G I +LGE+ T W++GDEVCAL+ GGGYAE         LP+P G +   AASL
Sbjct: 61  LGLECSGVITELGEDVTGWSVGDEVCALLAGGGYAEKVAVPATQLLPVPAGVDLRVAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+     LR GQ +L+HGG  GIGT AIQ+    GA V  TA SE+K   C
Sbjct: 121 PEVACTVWSNVVMRGGLRRGQVLLVHGGGGGIGTHAIQVGKALGARVAVTAGSEDKLNRC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY   DF+  L + T   G D++LD +GA YL +++  L+ +G + II   
Sbjct: 181 RELGADILINYRDSDFVASLAEATDNHGADVVLDNMGASYLGRNVDALAMDGHVAIIGMQ 240

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDI---AKQSIRDSLQLKIWPLLNSHVIAPVI 303
           GG    E+++  ++ KR  IT + LR R       K  I   ++ K+WPL+    + P++
Sbjct: 241 GGR-KGEVDIAKLMGKRGNITSTGLRGRPLTGPGGKADIVADVRAKLWPLIADGSVQPIV 299

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            T LP+ +  +AH +++  E +GK+IL
Sbjct: 300 STELPITEAPLAHQLLDSPETVGKVIL 326


>gi|305679721|ref|ZP_07402531.1| NAD(P)H quinone oxidoreductase, PIG3 family [Corynebacterium
           matruchotii ATCC 14266]
 gi|305660341|gb|EFM49838.1| NAD(P)H quinone oxidoreductase, PIG3 family [Corynebacterium
           matruchotii ATCC 14266]
          Length = 323

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 191/313 (61%), Gaps = 8/313 (2%)

Query: 18  SNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVD 77
              + LAE P PQ +  E+L+KV A GVNR D++Q  G YPPP   + I+GLE AG+IVD
Sbjct: 9   DKTLELAEVPTPQLRAGEVLVKVHATGVNRADLLQAAGYYPPPPGESEIMGLECAGEIVD 68

Query: 78  LGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANL 137
            G+  T   +G++V  L+ GGGYAEY     G  LPIP+GY+  QAA++ E   TVW+NL
Sbjct: 69  TGD--TDRQVGEKVACLLAGGGYAEYVAVPAGQLLPIPEGYSYEQAAAVVEVAATVWSNL 126

Query: 138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINY 197
                L +GQTVLIHGG+ GIGT AIQLA + GA V  TA S EK  AC +LGA   INY
Sbjct: 127 GMLTGLAAGQTVLIHGGAGGIGTFAIQLAKHLGAQVAVTAGSVEKLEACRRLGADILINY 186

Query: 198 LKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLN 257
            +E+F + L+        D ILD++GA+YL+Q++T L+ +G ++II   GG +  E+N+ 
Sbjct: 187 REENFADALKNRC-----DRILDIIGAKYLDQNVTALAPDGHMVIIGMQGG-VKGELNIG 240

Query: 258 PIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHD 317
            +++KR TI+ + LR R+   K  I       +WPLL    I   +H  LPL   A AH+
Sbjct: 241 KLLAKRGTISATALRARSHADKARIVTDTIKHVWPLLADGTITHQLHATLPLADAARAHE 300

Query: 318 IMEKSEHIGKIIL 330
           ++      G ++L
Sbjct: 301 LLRSGAVTGTLVL 313


>gi|188993008|ref|YP_001905018.1| Putative quinone oxidoreductase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167734768|emb|CAP52978.1| Putative quinone oxidoreductase [Xanthomonas campestris pv.
           campestris]
          Length = 325

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 127/318 (39%), Positives = 183/318 (57%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
           +G G ++ +   E   PQP   ++LI+V A G+NRPD++QR G YPPP  A   LGLEVA
Sbjct: 13  NGKGDADALHAVEQARPQPGPGQVLIRVHAAGINRPDLLQRGGHYPPPPGAPETLGLEVA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G +V        W +GD VCAL+ GGGYA+Y +    H LP+P G   +QAA+LPE+ FT
Sbjct: 73  GDVV---VAAGRWKVGDRVCALLGGGGYAQYAVVDARHVLPVPDGMTLVQAAALPETIFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
            +ANLF+   L +G+ +L+HG +SGIG TAIQLA   GA V  TA+S  K     +LGA 
Sbjct: 130 AYANLFEHGRLAAGEWLLLHGATSGIGVTAIQLAKVAGAHVLATARSAGKAAQARELGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+   E F+   +      G+D+ LDMVGA      L  L+  G+++ I+   G    
Sbjct: 190 VAIDSTTESFVAAAKAHA---GVDVALDMVGASVFADTLEALNPRGRIVYIASQAGAT-L 245

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  ++ K+  ITGSTLR R    K  +   ++  +WP +    +  +I    PL + 
Sbjct: 246 EVPIPLLMRKQAIITGSTLRPRNADEKARLAAEVERVVWPWIAQGKVRVLIDQCFPLAEA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E+  H+GK++L
Sbjct: 306 AAAHRYLEQGSHLGKVVL 323


>gi|332306460|ref|YP_004434311.1| NAD(P)H quinone oxidoreductase, PIG3 family [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173789|gb|AEE23043.1| NAD(P)H quinone oxidoreductase, PIG3 family [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 327

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 123/317 (38%), Positives = 199/317 (62%), Gaps = 8/317 (2%)

Query: 18  SNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVD 77
           ++ +F+ ++  P  ++ ++L+KV + G+NR D +QR+G YP P+  + ILGLEV+G++V+
Sbjct: 12  ADTLFVNDTTKPTLKQGQVLVKVHSFGINRADTLQRQGKYPAPRGESSILGLEVSGEVVE 71

Query: 78  LGE----NTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTV 133
           + E      + W +GD+V ALV GGGYA+Y   +  H +P PK  +   AA + E F T 
Sbjct: 72  IAEAEETTASRWQLGDKVFALVAGGGYAQYVAVNASHLMPKPKNVDMPSAAGIAEVFLTA 131

Query: 134 WANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKH 193
           + +LFQ   L+SGQ VLIH G+S +G  AIQLA   G  V  TA SE+K   C K GA  
Sbjct: 132 YQSLFQVGGLKSGQRVLIHAGASAVGLAAIQLAKADGCHVSVTASSEKKLTECEKYGADR 191

Query: 194 AINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATE 253
            INY  ++F E  +   QG G+D+I+D V  +Y+N++L +L+ +GK++ ++ L G  A +
Sbjct: 192 LINYKTQNFAECFE---QG-GVDVIIDFVAGDYVNRNLKILNNDGKIVYLAMLAGRFADK 247

Query: 254 INLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVA 313
           +++  ++SKR TITGSTLR R+D  K S+      K +  L S  + PVI T   + ++ 
Sbjct: 248 LDMALMLSKRATITGSTLRSRSDEYKSSLISDFCQKFFADLESGALRPVIDTQYSINEIG 307

Query: 314 MAHDIMEKSEHIGKIIL 330
           + H+ +E+++ +GK+++
Sbjct: 308 LTHERLERNDTMGKLVV 324


>gi|226941086|ref|YP_002796160.1| quinone oxidoreductase [Laribacter hongkongensis HLHK9]
 gi|226716013|gb|ACO75151.1| Probable quinone oxidoreductase [Laribacter hongkongensis HLHK9]
          Length = 328

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 199/324 (61%), Gaps = 4/324 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V  S  G ++ + L + PIP+P   ++ ++V A GVNR DVMQR+G YPPP  A+ I
Sbjct: 1   MKAVVQSCPGAADTLSLGDMPIPEPGPGQLRLRVRAAGVNRADVMQREGHYPPPPGASAI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEVAG+I  +G   T +  G+ + ALV+GGGYAE+ L      + +P G   ++AASL
Sbjct: 61  LGLEVAGEIDAIGAGVTGFVPGERIAALVSGGGYAEFALVSASLAMRLPAGMGFVEAASL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE++ T W NL +  +L  GQ VLIH G+SG+G  AIQLA   GATV TTA S+ KC  C
Sbjct: 121 PEAWMTAWLNLRELGDLHVGQRVLIHAGASGVGAAAIQLARLSGATVLTTAGSDGKCAFC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA  AINY   D    ++   +   +D+ILD VG   L  +L  L+++GKL++I+F+
Sbjct: 181 ESLGASLAINYRTTDVAGAVRAAGK---VDLILDPVGGATLGPNLACLNQDGKLVLIAFM 237

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  A E++L  ++ KR+T+ GSTLR R  + K  +   +Q  + P + +  +   +   
Sbjct: 238 AGRSA-ELDLGQLLMKRLTVIGSTLRNRDPVTKARLAARVQDTVIPAIVAGDVRATVDRT 296

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL +VA AH  +E +++ GK++L
Sbjct: 297 FPLAEVAAAHRYLESNQNRGKVVL 320


>gi|297625353|ref|YP_003687116.1| NADPH:quinone reductase and related Zn-dependent oxidoreductases
           [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
 gi|296921118|emb|CBL55665.1| NADPH:quinone reductase and related Zn-dependent oxidoreductases
           [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
          Length = 323

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 134/325 (41%), Positives = 198/325 (60%), Gaps = 3/325 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G  +VM  AE PIP P   E+L++ +A GVNR DV+QR+G YPPP     I
Sbjct: 1   MHAITVDEPGGVDVMSWAEVPIPDPGPGEVLVRTQAAGVNRGDVLQRQGHYPPPAGITDI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           +G+E  G I  LG+      +G++V ALV+GG YAE+ +   G  L +P G + + AA L
Sbjct: 61  MGMEALGVIEKLGDGVEGHQVGEQVLALVSGGAYAEFFVVPAGQLLKLPAGIDPLAAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
            E   TV +N F   +L +G+TVLIHGG+ GIGT AIQ A   GA V  TA S +K   C
Sbjct: 121 VEVAATVVSN-FDRVHLSAGETVLIHGGAGGIGTLAIQYAKALGAHVIVTAGSAKKLAYC 179

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            KLGA    +Y  +D+   +   TQ RG+D+ILD+VGA+YL  ++  L+ +G+L+II   
Sbjct: 180 RKLGADEGFDY-HDDWEPQVMMATQDRGVDVILDIVGAKYLEANVRCLADDGRLVIIGMQ 238

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G   T +N+  +++KR T+T ++LR R+  +K +I   ++  IWPLL+S  I P   T 
Sbjct: 239 KGTKGT-LNIAVLLNKRGTVTATSLRFRSLASKAAICRRVEEAIWPLLSSGAIKPGNQTQ 297

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           +P+   + AH+++E  ++ GKIIL+
Sbjct: 298 VPMAHASKAHELLESGDNTGKIILV 322


>gi|21230216|ref|NP_636133.1| quinone reductase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66769794|ref|YP_244556.1| quinone reductase [Xanthomonas campestris pv. campestris str. 8004]
 gi|21111756|gb|AAM40057.1| quinone reductase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66575126|gb|AAY50536.1| quinone reductase [Xanthomonas campestris pv. campestris str. 8004]
          Length = 325

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 127/318 (39%), Positives = 184/318 (57%), Gaps = 7/318 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
           +G G ++ +   E   PQP   ++LI+V A G+NRPD++QR G YPPP  A   LGLEVA
Sbjct: 13  NGKGDADALHAVEQARPQPAPGQVLIRVHAAGINRPDLLQRGGHYPPPPGAPETLGLEVA 72

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G++V        W +GD VCAL+ GGGYA+Y      H LP+P+G   +QAA+LPE+ FT
Sbjct: 73  GEVV---VAAGRWKVGDRVCALLGGGGYAQYAAVDARHVLPVPEGMTLVQAAALPETIFT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAK 192
            +ANLF+   L +G+ +L+HG +SGIG TAIQLA   GA V  TA+S  K     +LGA 
Sbjct: 130 AYANLFEHGRLAAGEWLLLHGATSGIGVTAIQLAKAAGAHVLATARSAGKAAQARELGAD 189

Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            AI+   E F+   +      G+D+ LDMVGA      L  L+  G+++ I+   G    
Sbjct: 190 VAIDSTTESFVAAAKAHA---GVDVALDMVGASVFADTLEALNPGGRIVYIASQAGAT-L 245

Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312
           E+ +  ++ K+  ITGSTLR R    K  +   ++  +WP +    +  +I    PL + 
Sbjct: 246 EVPIPLLMRKQAIITGSTLRPRNADEKARLAAEVERVVWPWIAQGKVRVLIDQCFPLAEA 305

Query: 313 AMAHDIMEKSEHIGKIIL 330
           A AH  +E+  H+GK++L
Sbjct: 306 AAAHRYLEQGSHLGKVVL 323


>gi|111020089|ref|YP_703061.1| NADPH:quinone reductase [Rhodococcus jostii RHA1]
 gi|110819619|gb|ABG94903.1| probable NADPH:quinone reductase [Rhodococcus jostii RHA1]
          Length = 333

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 186/315 (59%), Gaps = 9/315 (2%)

Query: 21  MFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGE 80
           M + + P P P   E+L++V A G+NR D+MQR+GLYPPP     I+G+E +G +V +G 
Sbjct: 22  MNIEQVPTPTPAAGEVLLEVAAAGINRADLMQRQGLYPPPPGITDIMGMEASGTVVAVGA 81

Query: 81  NTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQT 140
               +  GDEVCAL+ GG YAEY +      LPIP G + + AA+LPE   TVW+ +   
Sbjct: 82  GVDGFRPGDEVCALIAGGAYAEYVVVPAAQLLPIPDGLSLVDAAALPEVASTVWSTIVMD 141

Query: 141 ANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKE 200
           A L++G+T+L+HGG SGIGT AIQ+    GATV  T  SE K   C +LGA   INY ++
Sbjct: 142 AGLKAGETLLVHGGGSGIGTHAIQVGKALGATVAVTVGSEAKAQRCRELGADIVINYREQ 201

Query: 201 DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPII 260
           +F   L  +     +D+ILD++G +Y+  ++  L+  G+L+II   GG +  E+N+  +I
Sbjct: 202 NFASELAGQ-----VDVILDIMGGQYVPGNVDALAIGGRLVIIGMQGG-LTGELNVGALI 255

Query: 261 SKRITITGSTLRRRTDI---AKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHD 317
            KR  + G  +R R      +K  I  ++  K WPL+   ++ PVI   LPL        
Sbjct: 256 GKRARVIGLNVRNRPLTGPGSKAEIIAAVAEKEWPLVTQGLVRPVISAKLPLADAERGQA 315

Query: 318 IMEKSEHIGKIILLP 332
           +++  + +GK++LLP
Sbjct: 316 MLDSKDSVGKVLLLP 330


>gi|227552162|ref|ZP_03982211.1| possible NADPH:quinone reductase [Enterococcus faecium TX1330]
 gi|257886673|ref|ZP_05666326.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium
           1,141,733]
 gi|257895248|ref|ZP_05674901.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium Com12]
 gi|257897870|ref|ZP_05677523.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium Com15]
 gi|227178744|gb|EEI59716.1| possible NADPH:quinone reductase [Enterococcus faecium TX1330]
 gi|257822727|gb|EEV49659.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium
           1,141,733]
 gi|257831813|gb|EEV58234.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium Com12]
 gi|257835782|gb|EEV60856.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium Com15]
          Length = 327

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 196/327 (59%), Gaps = 7/327 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKG--LYPPPKNAN 64
           MR +++   G  +V+   E P+P+P++ E+LIKV    VNR D+M+R+   L PP     
Sbjct: 1   MRAISIKHPGSVDVLEQIEVPVPEPKQGELLIKVHTAAVNRTDIMKRESVSLKPP----Y 56

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           PILG+EVAG++V+   + + +  G +V  LVN GGYAEY +      + +P   + + AA
Sbjct: 57  PILGVEVAGEVVENKSDISTFTTGTKVYGLVNLGGYAEYAVMPADRAILLPDTLDYVSAA 116

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKC 183
            + E F T +  L+    L+ G+TVLIH G+SG+GT AIQLA     A +  TA SEEK 
Sbjct: 117 GISEVFLTAYQTLYWLGKLQEGETVLIHAGASGVGTAAIQLARQLSHAKIIVTAGSEEKL 176

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             C +LGA   INY K+DF E ++K T GRG+D+ILD +GA Y  ++L  ++ +G+ ++I
Sbjct: 177 AFCKELGADELINYKKQDFQEEVRKITDGRGVDVILDFIGASYWEKNLASIAVDGRWVLI 236

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             LGG I  EI+L  +I KR+ + G+ L  R+D  K  +  +   K+ P L +  I P+I
Sbjct: 237 GMLGGTIVPEIDLGVLIGKRVQLLGTLLTPRSDQYKAELAQTFMEKVGPFLENGKIRPII 296

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                  +V  AH+ ME +++IGKIIL
Sbjct: 297 DRTFQFSEVKQAHEYMEANKNIGKIIL 323


>gi|293378120|ref|ZP_06624289.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           PC4.1]
 gi|292642984|gb|EFF61125.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           PC4.1]
          Length = 327

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 196/327 (59%), Gaps = 7/327 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKG--LYPPPKNAN 64
           MR +++   G  +V+   E P+P+P++ E+LIKV    VNR D+M+R+   L PP     
Sbjct: 1   MRAISIKHPGSVDVLEQIEVPVPEPKQGELLIKVYTAAVNRTDIMKRESVSLKPP----Y 56

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           PILG+EVAG++V+   + + +  G +V  LVN GGYAEY +      + +P   + + AA
Sbjct: 57  PILGVEVAGEVVENKSDISTFTTGTKVYGLVNLGGYAEYAVMPADRAILLPDTLDYVSAA 116

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKC 183
            + E F T +  L+    L+ G+TVLIH G+SG+GT AIQLA     A +  TA SEEK 
Sbjct: 117 GISEVFLTAYQTLYWLGKLQEGETVLIHAGASGVGTAAIQLARQLSHAKIIVTAGSEEKL 176

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             C +LGA   INY K+DF E ++K T GRG+D+ILD +GA Y  ++L  ++ +G+ ++I
Sbjct: 177 AFCKELGADELINYKKQDFQEEVRKITDGRGVDVILDFIGASYWEKNLASIAVDGRWVLI 236

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             LGG I  EI+L  +I KR+ + G+ L  R+D  K  +  +   K+ P L +  I P+I
Sbjct: 237 GMLGGTIVPEIDLGVLIGKRVQLLGTLLTPRSDQYKAELAQTFMEKVGPFLENGKIRPII 296

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                  +V  AH+ ME +++IGKIIL
Sbjct: 297 DRTFQFSEVKQAHEYMEANKNIGKIIL 323


>gi|288922663|ref|ZP_06416838.1| NAD(P)H quinone oxidoreductase, PIG3 family [Frankia sp. EUN1f]
 gi|288345987|gb|EFC80341.1| NAD(P)H quinone oxidoreductase, PIG3 family [Frankia sp. EUN1f]
          Length = 316

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 129/313 (41%), Positives = 188/313 (60%), Gaps = 4/313 (1%)

Query: 21  MFLAESP-IPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLG 79
           M  AE P +P P   E+ + V A  VNR D++QR+G YPPP   + I+GLE +G++  +G
Sbjct: 1   MTWAEVPDLPPPGPGEVTLDVVATAVNRADLLQRQGFYPPPPGESDIIGLECSGRVAVVG 60

Query: 80  ENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQ 139
                +  GDEVCAL+ GGGYA       G  LP+P G + + AA LPE   TV++ +F+
Sbjct: 61  PGVDGFAPGDEVCALLAGGGYATRVNVPAGQLLPLPAGVSLVHAAGLPEVACTVYSTVFE 120

Query: 140 TANLRSGQTVLIHGGSSGIGTTAIQLASYF--GATVYTTAKSEEKCLACLKLGAKHAINY 197
            A L  G+  L+HGG+SGIGT AIQ        A +  TA S EK   C +LGA   I+Y
Sbjct: 121 RAELADGEVFLVHGGASGIGTFAIQAVRALRPAAVIAATAGSAEKLARCRELGANITISY 180

Query: 198 LKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLN 257
             EDF+  +++ET G G D+ILD +GA YL ++++LL+ +G+L++I   GG   T +NL+
Sbjct: 181 RDEDFVARVREETGGHGADVILDNMGASYLERNVSLLAPDGRLVVIGLQGGTKGT-LNLS 239

Query: 258 PIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHD 317
            ++ KR ++   +LR R    K  I   ++  +WPL+    I PVI  VLP+  V  AH 
Sbjct: 240 ALLPKRGSVHALSLRNRPGGQKARIVAGVRQHVWPLVAEGRIQPVIDRVLPISDVRAAHR 299

Query: 318 IMEKSEHIGKIIL 330
           ++E+  H+GK+IL
Sbjct: 300 VVEELGHVGKVIL 312


>gi|159040464|ref|YP_001539717.1| quinone oxidoreductase putative PIG3 [Salinispora arenicola
           CNS-205]
 gi|157919299|gb|ABW00727.1| Quinone oxidoreductase putative PIG3 [Salinispora arenicola
           CNS-205]
          Length = 325

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 198/315 (62%), Gaps = 2/315 (0%)

Query: 16  GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKI 75
           G  +++  +E P P+P   E+++ V A GVNR D++QR+G YPPP  A+P  GLE +G I
Sbjct: 10  GGPDMLVWSEVPDPEPGPGEVIVDVRASGVNRGDILQRQGHYPPPPGASPYPGLECSGTI 69

Query: 76  VDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWA 135
             + ++   W +G +VCAL+ GGGYAE      G  LP+P G + + +A+LPE   TVW+
Sbjct: 70  SAIADDVRGWTVGQQVCALLAGGGYAERVAVPAGQLLPVPDGVDLVDSAALPEVACTVWS 129

Query: 136 NLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAI 195
           N+ + A L +G+T+L+HGG SGIGT AIQL S  GATV  TA+   K     KLGA H I
Sbjct: 130 NVVRLARLTAGETLLVHGGGSGIGTFAIQLGSALGATVAATARL-PKHDRLRKLGAAHTI 188

Query: 196 NYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEIN 255
           +Y ++DF+E +++ T  RG D+ILD++GA YL ++L  L+  G+L++I   GG  A E++
Sbjct: 189 DYREQDFVEEVRQVTDSRGADVILDIIGAAYLERNLAALATGGRLMVIGMQGGRKA-ELD 247

Query: 256 LNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315
           L  ++ KR  +  + LR      K  I   ++ ++WPL+    I P++   LPL   A A
Sbjct: 248 LAGLLVKRAAVAATALRPLPLAEKAEIVRGVREQVWPLIAGGRIRPIVDRRLPLTDAAEA 307

Query: 316 HDIMEKSEHIGKIIL 330
           H ++E SEH+GK++L
Sbjct: 308 HRLVESSEHVGKVLL 322


>gi|95928223|ref|ZP_01310971.1| Alcohol dehydrogenase, zinc-binding [Desulfuromonas acetoxidans DSM
           684]
 gi|95135494|gb|EAT17145.1| Alcohol dehydrogenase, zinc-binding [Desulfuromonas acetoxidans DSM
           684]
          Length = 338

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 192/327 (58%), Gaps = 3/327 (0%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           +M+ V +  +G  +V+ + E   P P+++E+LIKV A  +NRPD++QR G YPPP   + 
Sbjct: 8   RMKAVLLDDFGGLDVLKVGEVDKPSPKEKEVLIKVVATSINRPDLVQRAGKYPPPPGDSE 67

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           ILGLEVAG I +LG   + W +GD V ALV GGGYAEY +++  H +PIP   +  +AA 
Sbjct: 68  ILGLEVAGVIEELGSEASGWQVGDRVMALVGGGGYAEYAVAYDNHVMPIPDSMSFEEAAC 127

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCL 184
           + ES+ T + N+F   +L+ GQT ++HGG  G+ T AIQLA      T      S EK  
Sbjct: 128 VCESYITAFLNVFMIGDLQDGQTAILHGGGGGVNTAAIQLAKALTPNTKLIVTASPEKLD 187

Query: 185 ACLKLGAKHAINYLKE-DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
              +LGA   I+Y +  DF   +++ T  +G+D+ILD VGA+YL  ++  L+ +GKL+II
Sbjct: 188 RVKELGADLVIDYTQTPDFAPQVKEFTNKKGVDVILDHVGAKYLAPNMNSLAYKGKLVII 247

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             + G I  E+NL  ++ KR  I GS LR R    K  I      +  P      I P+I
Sbjct: 248 GIISG-IKAELNLALMMVKRQQIIGSVLRSRPVSEKGEIISEFTKRALPHFAKRDIVPII 306

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             V  + ++  AH +ME+ +H GKI+L
Sbjct: 307 EKVFTIDEIVDAHGMMEEDKHFGKIVL 333


>gi|257892883|ref|ZP_05672536.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium
           1,231,408]
 gi|257829262|gb|EEV55869.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium
           1,231,408]
          Length = 327

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 195/327 (59%), Gaps = 7/327 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKG--LYPPPKNAN 64
           MR +++   G  +V+   E P+P+P++ E+LIKV    VNR D+M+R+   L PP     
Sbjct: 1   MRAISIKHPGSVDVLEQIEVPVPEPKQGELLIKVHTAAVNRTDIMKRESVSLKPP----Y 56

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           PILG+EVAG++V+   + + +  G +V  LVN GGYAEY +      + +P   + + AA
Sbjct: 57  PILGVEVAGEVVENKSDISTFTTGTKVYGLVNLGGYAEYAVMPADRAILLPDTLDYVSAA 116

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKC 183
            + E F T +  L+    L+ G+TVLIH G+SG+GT AIQLA     A +  TA SEEK 
Sbjct: 117 GISEVFLTAYQTLYWLGKLQEGETVLIHAGASGVGTAAIQLARQLSHAKIIVTAGSEEKL 176

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             C +LGA   INY K+DF E ++K T GRG+D+ILD +GA Y  ++L  ++ +G+ ++I
Sbjct: 177 AFCKELGADELINYKKQDFQEEVRKITDGRGVDVILDFIGASYWEKNLASIAVDGRWVLI 236

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             LGG I  EI+L  +I KR+ + G+ L  R+D  K  +  +   K  P L +  I P+I
Sbjct: 237 GMLGGTIVPEIDLGVLIGKRVQLLGTLLTPRSDQYKAELAQTFMEKAGPFLENGKIRPII 296

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                  +V  AH+ ME +++IGKIIL
Sbjct: 297 DRTFQFSEVKQAHEYMEANKNIGKIIL 323


>gi|221110639|ref|XP_002161450.1| PREDICTED: similar to tumor protein p53 inducible protein 3 [Hydra
           magnipapillata]
          Length = 358

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 134/328 (40%), Positives = 197/328 (60%), Gaps = 2/328 (0%)

Query: 5   KKMRHVAMSGYGKSNVMFLAESPIPQ-PQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNA 63
           K MR V +  YG    M++++  IP  P  + ILI+V A GVNR D +QRKGLY PP   
Sbjct: 20  KNMRAVQLKEYGGVENMYVSDVSIPDLPSSDYILIRVAAAGVNRADTIQRKGLYMPPSGE 79

Query: 64  NPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           + ILGLEV+G +  +GEN T +++GDEV AL+ GGGYAEY + HQ   + IPKG + + A
Sbjct: 80  SDILGLEVSGIVEKVGENVTAFSVGDEVMALLGGGGYAEYVVVHQCQVMNIPKGIDLVSA 139

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYF-GATVYTTAKSEEK 182
           AS+PE + T +  +   A ++  ++VLIH   SG+GT AIQLA    G  +  TA +EEK
Sbjct: 140 ASIPEVWLTAYQLINLVAKIQPNESVLIHAAGSGVGTAAIQLAKQIPGCFIIATAGTEEK 199

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
                +LGA   INY    F E++++ T G G+++ILD VG  + +Q+L +LS EG+ ++
Sbjct: 200 IEKAKQLGADVVINYKTTVFSEVVKEVTNGIGVNVILDPVGGSFWHQNLAVLSVEGRWVV 259

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302
              LGG       L+ ++ KR ++  STLR R+   K+ + +           SHV  P+
Sbjct: 260 YGLLGGGCIEGTILSQLLMKRGSLLTSTLRTRSIEYKKFLVEGFVQSSMDKFTSHVFTPI 319

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           I +V+ L +V  AH+ ME + + GKI+L
Sbjct: 320 IDSVMSLDQVKEAHERMEANINSGKILL 347


>gi|255325755|ref|ZP_05366849.1| NADPH:quinone reductase [Corynebacterium tuberculostearicum SK141]
 gi|255297166|gb|EET76489.1| NADPH:quinone reductase [Corynebacterium tuberculostearicum SK141]
          Length = 318

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 141/324 (43%), Positives = 192/324 (59%), Gaps = 8/324 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +  +       + L E  +PQ +  E+L+KV+A GVNR D++Q  G YPPP  A+ I
Sbjct: 1   MKAIVQTDPQDRRSLELHEVDVPQLRLGEVLVKVQAAGVNRGDILQTMGAYPPPPGASEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE AG I D G+  T+W +G EV  L+ GGGYAEY    QG  LP+PKG +  + A++
Sbjct: 61  LGLEAAGTIADAGD--TNWEVGTEVGCLLAGGGYAEYVAVPQGQLLPVPKGLSVEETAAV 118

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
            E   TVW+NL   A L  GQ VLIHGG  GIGT AIQ+A   GA V  TA S+EK   C
Sbjct: 119 VEVGCTVWSNLGIEAGLHEGQRVLIHGGGGGIGTFAIQVAKALGAEVAVTAGSQEKLERC 178

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY ++DF+E L+        D+ILD++GA+YL +++  L+K+GKLIII   
Sbjct: 179 RELGADILINYKEQDFVEELKGSC-----DVILDIIGAKYLEKNMKCLAKDGKLIIIGMQ 233

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A EINL  ++ KR+T+ G+TLR R    K  I       +WP+L    +   +H  
Sbjct: 234 GGTKA-EINLGAMLPKRLTVQGTTLRARDLEDKAQIVAGTVENVWPMLEDGRVKHALHAT 292

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL   A AH  ++  E  G ++L
Sbjct: 293 YPLADAAQAHTALDSGEVTGTLVL 316


>gi|163839377|ref|YP_001623782.1| putative quinone oxidoreductase [Renibacterium salmoninarum ATCC
           33209]
 gi|162952853|gb|ABY22368.1| putative quinone oxidoreductase [Renibacterium salmoninarum ATCC
           33209]
          Length = 335

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 135/324 (41%), Positives = 195/324 (60%), Gaps = 7/324 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + +S +G   V+ L+E P P   + E+LI V A+G+NR DV Q +G YPPP  A+  
Sbjct: 17  MKAITLSQFGGPEVLELSEVPDPVAAEGEVLIDVVAVGLNRADVQQCRGFYPPPDGASEY 76

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEV+G+I   G   T    G EV  L+ GGGYAE      G  +P+P G   + AA L
Sbjct: 77  LGLEVSGRIAQSGHGFTR---GQEVVGLLAGGGYAEQIAVPAGQVIPVPDGVELVDAAGL 133

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TV++N+   A L +G+T+L+HGG+ GIG  AIQL   +GA V  TA S EKC   
Sbjct: 134 PEVAATVYSNVVMAAGLSAGETLLVHGGAGGIGAMAIQLGKAWGARVIATAGSAEKCATV 193

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           L LGA  AINY ++DF+E+     Q RG ++ILD++G  YL++++  L+  G+L+II   
Sbjct: 194 LALGADEAINYREQDFVEVAH---QYRGANVILDVMGGSYLSRNMDALALNGRLVIIGLQ 250

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G  A E+NL  ++ KR ++ G+TLR R    K +I   +Q ++WPL+   V+ P   T 
Sbjct: 251 DGATA-ELNLGALMGKRASVIGTTLRARPVAEKSAIMSRVQAEVWPLVARGVVKPNSDTT 309

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL + + AH+  +  +H GKI+L
Sbjct: 310 FPLAQASEAHEYFDSGKHQGKILL 333


>gi|291286053|ref|YP_003502869.1| NAD(P)H quinone oxidoreductase, PIG3 family [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290883213|gb|ADD66913.1| NAD(P)H quinone oxidoreductase, PIG3 family [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 330

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 128/326 (39%), Positives = 188/326 (57%), Gaps = 3/326 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V M  +G ++V+++ E+  P P   ++LIKV A  +NRPD++QR+G YPPPK  + I
Sbjct: 1   MKAVLMKEFGSADVLYIGEAEKPVPAANQVLIKVAATSINRPDIVQREGNYPPPKGDSEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEVAG I ++G +   W  GD+V  LV GGGYAEY +++  H + IP+  +  +AA +
Sbjct: 61  LGLEVAGVIEEVGADVKDWQTGDKVMTLVGGGGYAEYAVAYACHLMKIPETMSFEEAACV 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLA 185
            ES+ T ++N+F        QT + HGG  G+ T AIQL++     + Y    + EK   
Sbjct: 121 CESYITAFSNVFMIGGFEDVQTAIFHGGGGGVNTAAIQLSNALTPNSKYIVTAAPEKMDT 180

Query: 186 CLKLGAKHAINYLKE-DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
             +LGA   I+Y    DF E +++ T  +G+D+ILD VGA+YL  +++ L   GKL+II 
Sbjct: 181 VKELGASLVIDYTTTPDFSEAVKEYTAKKGVDLILDHVGAKYLKPNMSSLGYMGKLVIIG 240

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
            + G I  E+NL  ++ KR  I GS LR R    K  I      +  P      I P+IH
Sbjct: 241 VISG-IKAELNLALMMVKRQQIIGSVLRSRPVEMKGEIVAEFTRRALPKFTDRSIVPMIH 299

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
            + P+ + A AH  ME   H GKI+L
Sbjct: 300 KIFPMDEAAQAHKTMEDDSHFGKIVL 325


>gi|257883897|ref|ZP_05663550.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium
           1,231,501]
 gi|257819735|gb|EEV46883.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium
           1,231,501]
          Length = 327

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 195/327 (59%), Gaps = 7/327 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKG--LYPPPKNAN 64
           MR +++   G  +V+   E P+P+P++ E+LIKV    VNR D+M+R+   L PP     
Sbjct: 1   MRAISIKHPGSVDVLEQIEVPVPEPKQGELLIKVHTAAVNRTDIMKRESVSLKPP----Y 56

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           PILG+EVAG++V+   + + +  G +V  LVN GGYAEY +      + +P   + + AA
Sbjct: 57  PILGVEVAGEVVENKSDISTFTPGTKVYGLVNLGGYAEYAVMPADRAILLPDTLDYVSAA 116

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKC 183
            + E F T +  L+    L+ G+TVLIH G+SG+GT AIQLA     A +  TA SEEK 
Sbjct: 117 GISEVFLTAYQTLYWLGKLQEGETVLIHAGASGVGTAAIQLARQLSHAKIIVTAGSEEKL 176

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             C +LGA   INY K+DF E ++K T+GRG+D+ILD +GA Y  ++L  ++ +G+ ++I
Sbjct: 177 AFCKELGADELINYKKQDFQEEVRKITEGRGVDVILDFIGASYWEKNLASIAVDGRWVLI 236

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             LGG I  EI+L  +I KR+ + G+ L  R+D  K  +  +   K  P L +  I P+I
Sbjct: 237 GMLGGTIVPEIDLGVLIGKRVQLLGTLLTPRSDQYKAELAQTFMQKAGPFLENGKIRPII 296

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                   V  AH+ ME +++IGKIIL
Sbjct: 297 DRTFQFSAVKQAHEYMEANKNIGKIIL 323


>gi|197119676|ref|YP_002140103.1| zinc-dependent oxidoreductase [Geobacter bemidjiensis Bem]
 gi|197089036|gb|ACH40307.1| zinc-dependent oxidoreductase [Geobacter bemidjiensis Bem]
          Length = 329

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 192/327 (58%), Gaps = 5/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V M G+G   V+ L E   P P++ E+L+KV A  +NRPD++QR+G YPPP   + I
Sbjct: 1   MKAVLMEGFGGVEVLKLGEVDRPVPKEGEVLVKVYATSINRPDLVQREGKYPPPPGDSEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEVAG I +LG   T W  GD V +LV GGGYAEY +++  H +P+P+  +  +AA +
Sbjct: 61  LGLEVAGIIEELGPGVTGWKKGDRVVSLVGGGGYAEYAVAYACHLMPVPETVSFEEAACI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG--ATVYTTAKSEEKCL 184
            ES+ T + N+F    L+ G+T ++HGG  G+ T AIQL       + +  TA S EK  
Sbjct: 121 CESYITAFLNVFMIGGLKDGETAILHGGGGGVNTAAIQLCKALAPKSKLIVTA-SPEKLE 179

Query: 185 ACLKLGAKHAINYLKE-DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
              +LGA   IN+ +  DF E +++ T  +G+D+ILD VGA+YL  ++  L  +G+L+II
Sbjct: 180 RVKQLGADLVINFKETPDFSEAVKEFTNKKGVDVILDHVGAKYLAPNMNSLGYKGRLVII 239

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             + G I  E+NL  ++ KR  I GS LR R    K  I      +  P      I P+I
Sbjct: 240 GVISG-IKAELNLALMMVKRQQIIGSVLRSRPVSEKGEIAAEFVRRAMPKFADRTIVPII 298

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
               P+ +V  AH +ME+ +H GKI+L
Sbjct: 299 EKAFPIDQVVEAHRMMEQDKHFGKIVL 325


>gi|261208799|ref|ZP_05923236.1| zinc-containing alcohol dehydrogenase superfamily [Enterococcus
           faecium TC 6]
 gi|289566410|ref|ZP_06446837.1| alcohol dehydrogenase, zinc-containing [Enterococcus faecium
           D344SRF]
 gi|294614461|ref|ZP_06694377.1| alcohol dehydrogenase, zinc-containing [Enterococcus faecium E1636]
 gi|260077301|gb|EEW65021.1| zinc-containing alcohol dehydrogenase superfamily [Enterococcus
           faecium TC 6]
 gi|289161785|gb|EFD09658.1| alcohol dehydrogenase, zinc-containing [Enterococcus faecium
           D344SRF]
 gi|291592769|gb|EFF24362.1| alcohol dehydrogenase, zinc-containing [Enterococcus faecium E1636]
          Length = 327

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 195/327 (59%), Gaps = 7/327 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKG--LYPPPKNAN 64
           MR +++   G  +V+   E P+P+P++ E+LIKV    VNR D+M+R+   L PP     
Sbjct: 1   MRAISIKHPGSVDVLEQIEVPVPKPKQGELLIKVHTAAVNRTDIMKRESVSLKPP----Y 56

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           PILG+EVAG++V+   + + +  G +V  LVN GGYAEY +      + +P   + + AA
Sbjct: 57  PILGVEVAGEVVENKSDISTFTPGTKVYGLVNLGGYAEYAVMPADRAILLPDTLDYVSAA 116

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKC 183
            + E F T +  L+    L+ G+TVLIH G+SG+GT AIQLA     A +  TA SEEK 
Sbjct: 117 GISEVFLTAYQTLYWLGKLQEGETVLIHAGASGVGTAAIQLARQLSHAKIIVTAGSEEKL 176

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             C +LGA   INY K+DF E ++K T+GRG+D+ILD +GA Y  ++L  ++ +G+ ++I
Sbjct: 177 AFCKELGADELINYKKQDFQEEVRKITEGRGVDVILDFIGASYWEKNLASIAVDGRWVLI 236

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             LGG I  EI+L  +I KR+ + G+ L  R+D  K  +  +   K  P L +  I P+I
Sbjct: 237 GMLGGTIVPEIDLGVLIGKRVQLLGTLLTPRSDQYKAELAQTFMQKAGPFLENGKIQPII 296

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                   V  AH+ ME +++IGKIIL
Sbjct: 297 DRTFQFSAVKQAHEYMEANKNIGKIIL 323


>gi|69245037|ref|ZP_00603195.1| Zinc-containing alcohol dehydrogenase superfamily [Enterococcus
           faecium DO]
 gi|257881917|ref|ZP_05661570.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium
           1,231,502]
 gi|257890093|ref|ZP_05669746.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium
           1,231,410]
 gi|258615665|ref|ZP_05713435.1| quinone oxidoreductase putative PIG3 [Enterococcus faecium DO]
 gi|260558711|ref|ZP_05830900.1| zinc-containing alcohol dehydrogenase superfamily [Enterococcus
           faecium C68]
 gi|293563209|ref|ZP_06677662.1| quinone oxidoreductase [Enterococcus faecium E1162]
 gi|293567496|ref|ZP_06678842.1| quinone oxidoreductase [Enterococcus faecium E1071]
 gi|293573062|ref|ZP_06684002.1| quinone oxidoreductase [Enterococcus faecium E980]
 gi|294622386|ref|ZP_06701415.1| quinone oxidoreductase [Enterococcus faecium U0317]
 gi|314937342|ref|ZP_07844682.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           TX0133a04]
 gi|314940962|ref|ZP_07847865.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           TX0133C]
 gi|314949051|ref|ZP_07852413.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           TX0082]
 gi|314953455|ref|ZP_07856371.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           TX0133A]
 gi|314994144|ref|ZP_07859451.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           TX0133B]
 gi|314995954|ref|ZP_07861034.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           TX0133a01]
 gi|68196038|gb|EAN10470.1| Zinc-containing alcohol dehydrogenase superfamily [Enterococcus
           faecium DO]
 gi|257817575|gb|EEV44903.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium
           1,231,502]
 gi|257826453|gb|EEV53079.1| zinc-containing alcohol dehydrogenase [Enterococcus faecium
           1,231,410]
 gi|260075170|gb|EEW63483.1| zinc-containing alcohol dehydrogenase superfamily [Enterococcus
           faecium C68]
 gi|291589805|gb|EFF21607.1| quinone oxidoreductase [Enterococcus faecium E1071]
 gi|291598146|gb|EFF29249.1| quinone oxidoreductase [Enterococcus faecium U0317]
 gi|291604804|gb|EFF34285.1| quinone oxidoreductase [Enterococcus faecium E1162]
 gi|291606855|gb|EFF36237.1| quinone oxidoreductase [Enterococcus faecium E980]
 gi|313589830|gb|EFR68675.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           TX0133a01]
 gi|313591411|gb|EFR70256.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           TX0133B]
 gi|313594488|gb|EFR73333.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           TX0133A]
 gi|313600194|gb|EFR79037.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           TX0133C]
 gi|313643293|gb|EFS07873.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           TX0133a04]
 gi|313644528|gb|EFS09108.1| NAD(P)H quinone oxidoreductase, PIG3 family [Enterococcus faecium
           TX0082]
          Length = 327

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 195/327 (59%), Gaps = 7/327 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKG--LYPPPKNAN 64
           MR +++   G  +V+   E P+P+P++ E+LIKV    VNR D+M+R+   L PP     
Sbjct: 1   MRAISIKHPGSVDVLEQIEVPVPKPKQGELLIKVHTAAVNRTDIMKRESVSLKPP----Y 56

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           PILG+EVAG++V+   + + +  G +V  LVN GGYAEY +      + +P   + + AA
Sbjct: 57  PILGVEVAGEVVENKSDISTFTPGTKVYGLVNLGGYAEYAVMPADRAILLPDTLDYVSAA 116

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKC 183
            + E F T +  L+    L+ G+TVLIH G+SG+GT AIQLA     A +  TA SEEK 
Sbjct: 117 GISEVFLTAYQTLYWLGKLQEGETVLIHAGASGVGTAAIQLARQLSHAKIIVTAGSEEKL 176

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             C +LGA   INY K+DF E ++K T+GRG+D+ILD +GA Y  ++L  ++ +G+ ++I
Sbjct: 177 AFCKELGADELINYKKQDFQEEVRKITEGRGVDVILDFIGASYWEKNLASIAVDGRWVLI 236

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             LGG I  EI+L  +I KR+ + G+ L  R+D  K  +  +   K  P L +  I P+I
Sbjct: 237 GMLGGTIVPEIDLGVLIGKRVQLLGTLLTPRSDQYKAELAQTFMQKAGPFLENGKIRPII 296

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                   V  AH+ ME +++IGKIIL
Sbjct: 297 DRTFQFSAVKQAHEYMEANKNIGKIIL 323


>gi|311741128|ref|ZP_07714953.1| NADPH:quinone reductase [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|311303930|gb|EFQ80008.1| NADPH:quinone reductase [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 318

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 138/324 (42%), Positives = 193/324 (59%), Gaps = 8/324 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +  +   +   + L E  +P+ +  E+L+KV+A GVNR D++Q  G YPPP  A+ I
Sbjct: 1   MKAIVQTDPQERRSLELREVEVPKLRSGEVLVKVQAAGVNRGDILQTMGAYPPPPGASEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE AG I D G+  T+W +G EV  L+ GGGYAEY    QG  LP+P+G++  + A++
Sbjct: 61  LGLEAAGTIADAGD--TNWEVGTEVGCLLAGGGYAEYVAVPQGQLLPVPEGFSVEETAAV 118

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
            E   TVW+NL   A L  GQ +LIHGG  G+GT AIQ+A   GA V  TA S+EK   C
Sbjct: 119 VEVGCTVWSNLGIEAGLHEGQRILIHGGGGGVGTFAIQVAKALGAEVAVTAGSQEKLDRC 178

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY + DF+E L+        D+ILD++GA+YL +++  L+K+GKLIII   
Sbjct: 179 RELGADILINYKEHDFVEELKGSC-----DVILDIIGAKYLEKNMKCLAKDGKLIIIGMQ 233

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A EINL  ++ KR+TI G+TLR R    K  I       +WP+L    +   +H  
Sbjct: 234 GGTKA-EINLGAMLPKRLTIQGTTLRARDLEDKAQIVAGTVENVWPMLEDGRVKHALHAT 292

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            PL   A AH  ++  E  G ++L
Sbjct: 293 YPLADAAQAHTALDSGEVTGTLVL 316


>gi|167644879|ref|YP_001682542.1| PIG3 family NAD(P)H quinone oxidoreductase [Caulobacter sp. K31]
 gi|167347309|gb|ABZ70044.1| NAD(P)H quinone oxidoreductase, PIG3 family [Caulobacter sp. K31]
          Length = 328

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 192/311 (61%), Gaps = 13/311 (4%)

Query: 25  ESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTH 84
           E P P P   EILI+V A GVNRPD++QR G YPPP  A   LGLEVAG++V     +  
Sbjct: 26  ERPTPGPG--EILIRVRAAGVNRPDLLQRLGYYPPPPGAPATLGLEVAGEVV---VGSGR 80

Query: 85  WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKG----YNAIQAASLPESFFTVWANLFQT 140
           W  GD+VCAL+ GGGYA+Y +    H LPIP      ++   AA+LPE+ FTV+AN+F+ 
Sbjct: 81  WKEGDKVCALLGGGGYAQYAVVDARHALPIPANSEGEFDFAHAAALPETVFTVFANVFEH 140

Query: 141 ANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKE 200
             L+ G+T+LIHGG+SGIGTTAI +A   GA V  T +  +K    L LGA  A++   E
Sbjct: 141 GALKLGETLLIHGGTSGIGTTAIAMAKAHGARVIATGRGADKKAQALALGADIAVDAKTE 200

Query: 201 DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPII 260
           DF  I +      G+D++LDMVGA Y +++L  L+  G+++ I+ L G +  E+ +  I+
Sbjct: 201 DFAAIAKAAG---GVDVVLDMVGASYFDKNLDALNTGGRIVYIAALAGPV-LEVPVMKIM 256

Query: 261 SKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIME 320
            KR  ITGSTLR R+   K  +   ++  +WP + +  + PVI    PL + A AH  +E
Sbjct: 257 QKRAVITGSTLRPRSADEKARLAAEIERVVWPWIAAGKLKPVIDATFPLAEAAKAHAHLE 316

Query: 321 KSEHIGKIILL 331
             EH+GK++LL
Sbjct: 317 AGEHVGKVVLL 327


>gi|253699571|ref|YP_003020760.1| NAD(P)H quinone oxidoreductase, PIG3 family [Geobacter sp. M21]
 gi|251774421|gb|ACT17002.1| NAD(P)H quinone oxidoreductase, PIG3 family [Geobacter sp. M21]
          Length = 329

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 133/327 (40%), Positives = 191/327 (58%), Gaps = 5/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V M G+G   V+ L E   P P++ E+L+KV A  +NRPD++QR+G YPPP   + I
Sbjct: 1   MKAVLMEGFGGVEVLKLGEVDRPVPKEGEVLVKVHATSINRPDLVQREGKYPPPPGDSEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEVAG I +LG   T W  GD V +LV GGGYAEY +++  H +PIP+  +  +AA +
Sbjct: 61  LGLEVAGVIEELGPGVTGWKKGDRVVSLVGGGGYAEYAVAYGCHLMPIPETVSFEEAACI 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG--ATVYTTAKSEEKCL 184
            ES+ T + N+F    L+ G+T ++HGG  G+ T AIQL       + +  TA S EK  
Sbjct: 121 CESYITAFLNVFMIGGLQDGETAILHGGGGGVNTAAIQLCKALAPKSKLIVTA-SPEKLE 179

Query: 185 ACLKLGAKHAINYLKE-DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
              +LGA   IN+ +  DF E ++  T  +G+D+ILD VGA+YL  ++  L  +G+L+II
Sbjct: 180 RVKQLGADLVINFKETPDFSEAVKGFTNKKGVDVILDHVGAKYLAPNMNSLGYKGRLVII 239

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             + G I  E+NL  ++ KR  I GS LR R    K  I      +  P      I P+I
Sbjct: 240 GVISG-IKAELNLALMMVKRQQIIGSVLRSRPVSEKGEIAAEFVRRAMPKFADRTIVPII 298

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
               P+ +V  AH +ME+ +H GKI+L
Sbjct: 299 EKAFPIEEVVEAHRMMEQDKHFGKIVL 325


>gi|262200311|ref|YP_003271519.1| NAD(P)H quinone oxidoreductase, PIG3 family [Gordonia bronchialis
           DSM 43247]
 gi|262083658|gb|ACY19626.1| NAD(P)H quinone oxidoreductase, PIG3 family [Gordonia bronchialis
           DSM 43247]
          Length = 317

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 184/304 (60%), Gaps = 17/304 (5%)

Query: 35  EILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCAL 94
           E+++ V A GVNR D++QRKG+YPPP  A   +GLEV+G+I  LG   + W +GDEVCAL
Sbjct: 20  EVIVDVVAAGVNRADLLQRKGMYPPPPGAPDTMGLEVSGRISALGPQVSGWAVGDEVCAL 79

Query: 95  VNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGG 154
           + GGGYAE         LP+P G + + AA LPE   TV +NLF TA+LR G+ +LIHGG
Sbjct: 80  LAGGGYAEQVAVPATQLLPVPLGVDLVSAAGLPEVACTVVSNLFGTADLRPGELLLIHGG 139

Query: 155 SSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRG 214
           SSGIGT AIQ+A      V  TA+++ K   C  LGA   I+Y  +DF E++   T   G
Sbjct: 140 SSGIGTHAIQVAHALEVQVAVTARTQAKLARCAALGADILIDYSTQDFTEVI---TNSGG 196

Query: 215 IDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR 274
            D+ILD++GA+YL  ++  L   G+L+II   GG  A E+ +  +++KR ++ G+TLR R
Sbjct: 197 ADVILDIIGAKYLRPNIDSLRTGGRLVIIGMQGGAKA-ELPIGLLLAKRASVHGTTLRSR 255

Query: 275 --------TDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIG 326
                    DI  Q+ R +     WPL+++  + P+I T   L     AH  ++  + IG
Sbjct: 256 PTTGPGGKADIVAQTRRIT-----WPLIDAGKVVPIIDTTFSLDDAEAAHAHLDSGDAIG 310

Query: 327 KIIL 330
           K++L
Sbjct: 311 KVLL 314


>gi|260841570|ref|XP_002613985.1| hypothetical protein BRAFLDRAFT_57258 [Branchiostoma floridae]
 gi|229299375|gb|EEN69994.1| hypothetical protein BRAFLDRAFT_57258 [Branchiostoma floridae]
          Length = 338

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/328 (40%), Positives = 190/328 (57%), Gaps = 4/328 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +   G  + + +   P P+PQ  E+L+KV A  VNR D +QRKGLYPPPK A+ I
Sbjct: 1   MQAVVLQQPGGPDNLSVGRVPKPRPQAGEVLLKVYATAVNRADTLQRKGLYPPPKGASDI 60

Query: 67  LGLEVAGKIVDLGENTT-HWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           LGLE AGK+ DLG +    W  GD V AL+ GGG AE+    + H + IP G +  +AA+
Sbjct: 61  LGLEAAGKVDDLGPDCRGRWKHGDRVMALLPGGGNAEFVTVDEDHLMAIPAGMSYQEAAA 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           +PE + T +  L     L+ G+TVLIH G SG+GT A QL+   GA    TA + EK   
Sbjct: 121 IPEVWLTAYQLLHFVGGLQEGETVLIHAGGSGVGTAATQLSRLAGARPIITAGTPEKLQR 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
              LGA  A NY + +F + +  ET G+G+D+ILD VGA +  Q++  L+ EG+ ++   
Sbjct: 181 ATDLGAVAAFNYKEGEFAQKVLDETNGKGVDVILDCVGASFWQQNVRCLALEGRWVLYGL 240

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHV---IAPV 302
           LGG       L+ ++ KRI + G+TLR R+   K S+  S   +  P   S     + P+
Sbjct: 241 LGGGSIDGDILSQVLRKRINLLGTTLRARSKQYKASLVKSFSERALPHFTSGGPIHLRPI 300

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           I  V+PL  ++ AH  ME +++ GKI+L
Sbjct: 301 IDRVVPLQDISKAHSCMEDNKNTGKIVL 328


>gi|325003572|ref|ZP_08124684.1| quinone oxidoreductase [Pseudonocardia sp. P1]
          Length = 330

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 190/327 (58%), Gaps = 5/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ + ++ YG    M   E P P P   E+++ V A  VNR D++Q +G YP P  A+ I
Sbjct: 1   MKAITLAEYGGPEQMAWEEVPDPVPGAGEVVLDVVASAVNRADLLQVQGNYPVPPGASQI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE +G+I  LGE  T WN+GDEVCAL+ GGGYA+         LP+P+G +   A  L
Sbjct: 61  LGLECSGRISALGEGVTGWNVGDEVCALLAGGGYAQKVAVPAAQLLPVPEGVSLEDAGGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F    L  G+T L+ GGSSGIGT AIQ+A+ FGA V  TA   ++   C
Sbjct: 121 PEVACTVWSNVFMEGRLAEGETFLVQGGSSGIGTHAIQVATAFGARVAATAGHADRLEFC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA   I+Y  +D  E L+K T G G D+ILD +GA+ L  +L+ L+K+G+L+II   
Sbjct: 181 RGLGADITIDY-HDDIAEELKKATDGHGADVILDNMGAKGLANNLSALAKDGRLMIIGMQ 239

Query: 247 GGNIATEINLNPIISKRITITGSTLRRR---TDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
           GG +  EIN+  +++KR  ++   LR R      +K  I + ++ ++WPL  +  + PV+
Sbjct: 240 GG-VKAEINIGALLAKRGHVSAMGLRGRPVEGPHSKAEIVEQVRDQVWPLFPAGRVRPVV 298

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                +   A AH  +      GK+IL
Sbjct: 299 FERYSMADAADAHRRLADGGVTGKLIL 325


>gi|271961747|ref|YP_003335943.1| hypothetical protein Sros_0146 [Streptosporangium roseum DSM 43021]
 gi|270504922|gb|ACZ83200.1| conserved hypothetical protein [Streptosporangium roseum DSM 43021]
          Length = 318

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 136/325 (41%), Positives = 196/325 (60%), Gaps = 8/325 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M  + +   G   V+   E P P+P   ++LI V A  VNR DVMQR+GLY PP  A P 
Sbjct: 1   MHAIVIDKPGGPEVLTWREVPEPRPGPGDVLIDVAASAVNRADVMQRQGLYGPPPGAPPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE +G + ++G +   +  GD V AL+ GGGYAE         + +P+G + ++AA+L
Sbjct: 61  PGLECSGVVAEVGSDVEDFKPGDRVSALLAGGGYAERVAVPWQQVMRVPEGVDLVEAAAL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TVW+N+F TA LR G+T+L+HGG+SGIGT A+QLA  FG+ V  TA S EK   C
Sbjct: 121 PEVACTVWSNVFMTARLRKGETLLVHGGASGIGTLAVQLAKAFGSHVVVTAGSAEKIARC 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
           ++LGA   INY +EDF E ++        D+ILD+VG  YL  ++  L   G+L++I   
Sbjct: 181 VELGADEGINYREEDFAERVRA-------DVILDIVGGRYLPGNVKALKTGGRLVVIGMQ 233

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG+   E++L  ++ KR ++ G+TLR R    K  I   +   +WPL+ +  I PVIH  
Sbjct: 234 GGS-KGELDLGALLVKRASVHGTTLRSRPVDEKGVIVRGVVENVWPLVEAGAIRPVIHAR 292

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           +P+   A AH I+E  +H+GKI+L+
Sbjct: 293 VPMSDAAQAHRILESGDHVGKILLV 317


>gi|254822480|ref|ZP_05227481.1| quinone oxidoreductase [Mycobacterium intracellulare ATCC 13950]
          Length = 325

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 174/288 (60%), Gaps = 7/288 (2%)

Query: 46  NRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCL 105
           NR DV+Q  G YPPP  A+ I+G+EV+G I ++G+  T W+ G EVCAL+ GGGYAEY  
Sbjct: 40  NRADVLQAAGKYPPPPGASEIIGMEVSGVITEVGDGVTEWSAGQEVCALLAGGGYAEYVA 99

Query: 106 SHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQL 165
              G  LPIP G + + AA LPE   TVW+N+   A L  GQ +L HGG+SGIG+ AIQ+
Sbjct: 100 VPAGQVLPIPSGVDLVDAAGLPEVACTVWSNVVLIAGLSRGQLLLAHGGASGIGSHAIQI 159

Query: 166 ASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAE 225
           A   GA V  TA S EK   C  LGA   INY  EDF+  LQ+     G D+ILD++GA 
Sbjct: 160 ARALGARVAVTAGSAEKLDFCRDLGADITINYHDEDFVARLQESG---GADVILDIMGAA 216

Query: 226 YLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDS 285
           YL++++  L+ +G+L+II   GG +  E+N+  +++KR  + G+TLR R      S  D 
Sbjct: 217 YLDRNIDALASDGQLVIIGMQGG-VKGELNIGKLLAKRARVIGTTLRGRPATGPNSKSDI 275

Query: 286 LQ---LKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +Q     +WP++    + P+I   LP+ +   AH  +   +  GKI+L
Sbjct: 276 VQAVTASVWPMVADGRVRPIIGARLPIQQAGDAHQRLVDGKVTGKIVL 323


>gi|308176306|ref|YP_003915712.1| NADPH:quinone reductase [Arthrobacter arilaitensis Re117]
 gi|307743769|emb|CBT74741.1| putative NADPH:quinone reductase [Arthrobacter arilaitensis Re117]
          Length = 329

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 138/324 (42%), Positives = 197/324 (60%), Gaps = 1/324 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+    +G G   ++ L + P+P     E+LIKVEA G+NR DV QRKG+YPPP  A+ I
Sbjct: 5   MKAYIYNGSGGPEILELVDRPVPSLASGEVLIKVEAFGLNRADVQQRKGVYPPPPGASDI 64

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G+IV++G+  + W  G  V AL+  GGYA+Y        + +P+  + I AA+L
Sbjct: 65  PGLEVSGRIVEIGDGVSGWKTGARVAALLAAGGYAQYVNVPAELLIEVPQSVSDIDAAAL 124

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE   TV +NLF    L  GQT+L+HGG+ GIG+ AIQLA   GA V  TA S +K   C
Sbjct: 125 PEVAATVVSNLFVEGELAQGQTLLLHGGAGGIGSMAIQLAKAAGARVIVTASSAQKLEYC 184

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
             LGA+  INY +EDF E +++ TQG+G D+ILD+VGA+YL Q+L  L+  G+L++I   
Sbjct: 185 CALGAEEGINYREEDFAERVKEITQGQGADLILDVVGAKYLAQNLKSLAVGGRLVVIGLQ 244

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG  A E NL  +++KR  I G+TLR R    K+ I      ++ PLL    +A  +   
Sbjct: 245 GGAKA-EANLGLLLAKRAQIIGTTLRARPVHEKEEIIRQTITRVIPLLEKGQLALNVTKT 303

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
               +V+ AH+  +  +H GKI++
Sbjct: 304 FDYSEVSSAHEYFDSGKHTGKIVI 327


>gi|209518618|ref|ZP_03267437.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp. H160]
 gi|209500982|gb|EEA01019.1| NAD(P)H quinone oxidoreductase, PIG3 family [Burkholderia sp. H160]
          Length = 350

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 187/319 (58%), Gaps = 4/319 (1%)

Query: 12  MSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEV 71
           +S  G   V+  +E P+P+    ++LI+V   GVNR DV QR+    P    + + GLEV
Sbjct: 29  ISAAGGPEVLVPSELPVPECASTDVLIRVVCAGVNRHDVNQRR--RGPDNVHSSVPGLEV 86

Query: 72  AGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFF 131
           +G +V +G + T+  IGDEVCALVNGGGYAEY ++  G  LP+P   +   AA+LPE+ F
Sbjct: 87  SGVVVRIGADVTNVKIGDEVCALVNGGGYAEYAIADAGQVLPVPPTISLRDAAALPEALF 146

Query: 132 TVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGA 191
           T   N F  A L +G++VLIHGG+SG+G+ AIQL S  G  VY T  ++EKC     LGA
Sbjct: 147 TTVHNFFNVAKLAAGESVLIHGGTSGVGSLAIQLLSARGHAVYATCGTDEKCSMAEALGA 206

Query: 192 KHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIA 251
             A NY    F E +   T G+G+D+ILDM GA Y  Q++  L++ G+++ +S  GGN  
Sbjct: 207 VKAFNYRTVGFAEAVLTATGGKGVDVILDMAGAGYGRQNVEALARRGRVVHLS-PGGNAD 265

Query: 252 TEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGK 311
               L  ++ K   +TGS LR   +  K  I   +   +WPL+ +  I P I   LPL +
Sbjct: 266 LTFPLRELMRKEAVVTGSLLRPLPNEEKADIARWIHAHVWPLIGT-AIKPTITQRLPLTQ 324

Query: 312 VAMAHDIMEKSEHIGKIIL 330
              AH+ +E+ +  GKI+L
Sbjct: 325 ACTAHEALERGDVAGKILL 343


>gi|291280387|ref|YP_003497222.1| alcohol dehydrogenase zinc-binding [Deferribacter desulfuricans
           SSM1]
 gi|290755089|dbj|BAI81466.1| alcohol dehydrogenase, zinc-binding [Deferribacter desulfuricans
           SSM1]
          Length = 339

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 129/326 (39%), Positives = 187/326 (57%), Gaps = 3/326 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V   G+G  +V+ + ++ IP+P++ ++LIKV A  +NRPD++QR+G YPPP   + I
Sbjct: 10  MKAVICDGFGGVDVLKIIDTDIPKPKENQVLIKVAATSINRPDLVQREGKYPPPPGESEI 69

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEVAG I ++G N   W  GD V ALV GGGYAEY +++  H +PIP      +AA +
Sbjct: 70  LGLEVAGIIEEVGSNVKGWKKGDRVAALVGGGGYAEYAVAYADHLIPIPDSMTFEEAACI 129

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK-SEEKCLA 185
            ES+ T + N+     L+     + HGG  G+ T AIQ+       V      S EK   
Sbjct: 130 CESYITAFLNVILLGELKDNNYAIFHGGGGGVNTAAIQITRAIRNDVKIIVTVSPEKMEK 189

Query: 186 CLKLGAKHAINYLKE-DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
             +LG    INY +  DF +I+++ T  RG+D+ILD +GA YL  ++  L+  G+L+II 
Sbjct: 190 VKELGVDLLINYKEHPDFSQIIREFTNKRGVDVILDHIGAAYLEPNIKSLAYGGRLVIIG 249

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
              G I  EINL  ++ KR  I GS LR R    K  I  +   ++ P      I P+I+
Sbjct: 250 VTSG-IKAEINLGLVMVKRHKIIGSVLRSRPVEEKAEIIKAFNEQVMPKFADRTIVPIIY 308

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
            V PL +V +AH  ME+ +H GKI+L
Sbjct: 309 KVFPLEEVKLAHQTMEEDKHFGKIVL 334


>gi|326382345|ref|ZP_08204037.1| NADPH:quinone reductase [Gordonia neofelifaecis NRRL B-59395]
 gi|326199075|gb|EGD56257.1| NADPH:quinone reductase [Gordonia neofelifaecis NRRL B-59395]
          Length = 336

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 130/333 (39%), Positives = 196/333 (58%), Gaps = 12/333 (3%)

Query: 3   ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62
           +   M  VA+   G    + +A  P P P   E+L+ V A GVNR D++QR+GLYPPP  
Sbjct: 10  VPDSMEAVAV---GDDQSLSMARVPTPAPGSGEVLVHVAAAGVNRADLLQRRGLYPPPPG 66

Query: 63  ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQ 122
            + ++GLEV+G +  LG+      +G  VCAL+ GGGYAEY +      LP+P+G + ++
Sbjct: 67  ISDVMGLEVSGTVAALGDGADEALLGRAVCALIAGGGYAEYVVVPAAQLLPVPEGVSLVE 126

Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182
           AA+LPE   TVW+ +   A L +G+T+L+HGG  GIGT AIQ+    GATV  T  SE K
Sbjct: 127 AAALPEVASTVWSTIVMDAGLEAGETLLVHGGGGGIGTHAIQVGKALGATVVVTVGSEGK 186

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
              C +LGA   INY ++DF      E  GR +D+ILD +G  YL++++  L+  G+L+I
Sbjct: 187 AKRCRELGADVVINYREQDF----AAELAGR-VDVILDNMGGSYLSRNVDALAVGGRLVI 241

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRT---DIAKQSIRDSLQLKIWPLLNSHVI 299
           I   GG +  E+N+  +I KR  + G  +R R      +K  I  ++    WPL+   +I
Sbjct: 242 IGMQGG-LTGEVNVGALIGKRARVIGLNVRNRPLDGPGSKAEIVAAVAADEWPLVERGLI 300

Query: 300 APVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
            PV+ TVLPL +      +++ ++ +GK++L+P
Sbjct: 301 RPVVSTVLPLAEAERGQALLDSADSVGKVLLVP 333


>gi|293553984|ref|ZP_06674587.1| putative glucose/ribitol dehydrogenase [Enterococcus faecium E1039]
 gi|291601867|gb|EFF32116.1| putative glucose/ribitol dehydrogenase [Enterococcus faecium E1039]
          Length = 327

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 130/327 (39%), Positives = 194/327 (59%), Gaps = 7/327 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKG--LYPPPKNAN 64
           MR +++   G  +V+   E P+P+P++ E+LIKV    VNR D+M+R+   L PP     
Sbjct: 1   MRAISIKHPGSVDVLEQIEVPVPKPKQGELLIKVHTAAVNRTDIMKRESVSLKPP----Y 56

Query: 65  PILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA 124
           PILG+EVAG++V+   + + +  G +V  LVN GGYAEY +      + +P   + + AA
Sbjct: 57  PILGVEVAGEVVENKSDISIFTPGTKVYGLVNLGGYAEYAVMPADRAILLPDTLDYVSAA 116

Query: 125 SLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKC 183
            + E F T +  L+    L+ G+TVLIH G+SG+GT AIQLA     A +  TA SEEK 
Sbjct: 117 GISEVFLTAYQTLYWLGKLQEGETVLIHAGASGVGTAAIQLARQLSHAKIIVTAGSEEKL 176

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             C +L A   INY K+DF E ++K T+GRG+D+ILD +GA Y  ++L  ++ +G+ ++I
Sbjct: 177 AFCKELAADELINYKKQDFQEEVRKITEGRGVDVILDFIGASYWEKNLASIAVDGRWVLI 236

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             LGG I  EI+L  +I KR+ + G+ L  R+D  K  +  +   K  P L +  I P+I
Sbjct: 237 GMLGGTIVPEIDLGVLIGKRVQLLGTLLTPRSDQYKAELAQTFMQKAGPFLENGKIRPII 296

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                   V  AH+ ME +++IGKIIL
Sbjct: 297 DRTFQFSAVKQAHEYMEANKNIGKIIL 323


>gi|111225933|ref|YP_716727.1| putative quinone oxidoreductase [Frankia alni ACN14a]
 gi|111153465|emb|CAJ65223.1| putative quinone oxidoreductase [Frankia alni ACN14a]
          Length = 311

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 184/304 (60%), Gaps = 3/304 (0%)

Query: 29  PQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIG 88
           P P   E+ + V A  VNR D++QR+GLYPPP   + I+G+E +G++  +G   +   +G
Sbjct: 5   PDPGPGEVTLDVVATAVNRADLLQRQGLYPPPPGESEIIGMECSGRVAAVGPEVSGVEVG 64

Query: 89  DEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQT 148
            EVCAL+ GGGYA       G  LPIP G + ++AA LPE   TV++ +F  A+LR G+ 
Sbjct: 65  TEVCALLGGGGYATRVNVPAGQLLPIPAGVDLVEAAGLPEVAATVYSTVFGIADLRDGEV 124

Query: 149 VLIHGGSSGIGTTAIQLASYF--GATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEIL 206
             +HGG+SGIGT AIQ        A + TTA +  K     +LGA  A++Y   DF+E++
Sbjct: 125 FCVHGGASGIGTFAIQAVRALRPDAVIATTAGTAAKLARVRELGADVAVSYRDSDFVEVI 184

Query: 207 QKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITI 266
           +K T+G G D+ILD +GA YL ++++LL+  G+L++I   GG +  E++L  +++KR ++
Sbjct: 185 RKATEGHGADVILDNMGAAYLPRNVSLLAVGGRLVVIGLQGG-VKGELSLGALLTKRASV 243

Query: 267 TGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIG 326
             ++LR R    K  I   ++ + WP +    I PVI  VLP+ +V  AH  +    H+G
Sbjct: 244 HAASLRARPAAEKAEIIAGVRAEFWPAVERGAIRPVIDRVLPITEVVGAHSHVADLGHVG 303

Query: 327 KIIL 330
           K+IL
Sbjct: 304 KVIL 307


>gi|300857538|ref|YP_003782521.1| hypothetical protein cpfrc_00121 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300684992|gb|ADK27914.1| hypothetical protein cpfrc_00121 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302205277|gb|ADL09619.1| Putative quinone oxidoreductase [Corynebacterium pseudotuberculosis
           C231]
 gi|302329830|gb|ADL20024.1| NADPH:quinone reductase [Corynebacterium pseudotuberculosis 1002]
 gi|308275517|gb|ADO25416.1| NADPH:quinone reductase [Corynebacterium pseudotuberculosis I19]
          Length = 319

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 132/303 (43%), Positives = 184/303 (60%), Gaps = 8/303 (2%)

Query: 29  PQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIG 88
           PQ +    LI+V+A GVNR D++Q  G YPPP   + ILGLE AG + D G+  T W  G
Sbjct: 20  PQLESGCALIRVKASGVNRADLLQAAGHYPPPPGESKILGLECAGVVEDPGD--TSWKKG 77

Query: 89  DEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQT 148
           D+V  L+ GGGYAE  +  +G  +PIP GY+  QAA++ E   TVW+N+     L+   T
Sbjct: 78  DKVACLLAGGGYAELAVVPEGQLMPIPAGYSFAQAAAIVEVACTVWSNIGMLTGLKPEHT 137

Query: 149 VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQK 208
           +LIHGG+ GIGT AIQ+A + GATV  TA S EK   C +LGA   INY ++DF EIL+ 
Sbjct: 138 ILIHGGAGGIGTFAIQMAKHIGATVAVTAGSTEKLEVCRELGADILINYREQDFAEILKN 197

Query: 209 ETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITG 268
           +      D ILD++GA+YL+Q++  L+ +G  + I   GG +  E+N+  ++SKR TI+ 
Sbjct: 198 KC-----DRILDIMGAKYLDQNVRALAMDGHQVTIGMQGG-VKGELNIGRLLSKRGTISA 251

Query: 269 STLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKI 328
           + LR R    K  I       IWPLL S  I+  IH  LPL +   AH++++  E  G +
Sbjct: 252 TALRARDRADKARIVADTVKNIWPLLESGRISHRIHATLPLSQAQKAHELLDSGEVSGTL 311

Query: 329 ILL 331
           +LL
Sbjct: 312 VLL 314


>gi|38232802|ref|NP_938569.1| putative quinone oxidoreductase [Corynebacterium diphtheriae NCTC
           13129]
 gi|38199060|emb|CAE48681.1| Putative quinone oxidoreductase [Corynebacterium diphtheriae]
          Length = 315

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 134/306 (43%), Positives = 189/306 (61%), Gaps = 8/306 (2%)

Query: 25  ESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTH 84
           ++P P  Q  E+L++V+A GVNR D++Q  G YPPP   + I+GLE AG IVD G  TT 
Sbjct: 16  DAPTPTLQPGEVLVQVKAAGVNRADLLQAAGHYPPPPGESEIIGLECAGVIVDAG--TTS 73

Query: 85  WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLR 144
            N+GD+V  L+ GGGYAEY    +G  +PIP+GY+  +AA++ E   TVW+N+     L+
Sbjct: 74  RNVGDKVACLLAGGGYAEYVAVPEGQLMPIPEGYSFAEAAAVVEVAATVWSNIGMLTGLK 133

Query: 145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLE 204
                LIHGG+ GIGT AIQLA + GATV  TA S+EK   C +LGA   INY +EDF E
Sbjct: 134 PEHMFLIHGGAGGIGTFAIQLAKHVGATVAVTAGSKEKLETCRELGADILINYREEDFAE 193

Query: 205 ILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRI 264
           +L+ +      D ILD++GA+YL+Q++  L+ +G  + I   GG +  E+N+  ++SKR 
Sbjct: 194 VLKNKC-----DRILDIMGAKYLDQNVRALAMDGHQVTIGMQGG-VKGELNIGRLLSKRG 247

Query: 265 TITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEH 324
           TI+ + LR R    K  I  S    +WPLL    I   IH  LPL +   AH++++  E 
Sbjct: 248 TISATALRARDREDKARIVASTVENVWPLLADGTIRHHIHATLPLEQAQRAHEMLKNGEV 307

Query: 325 IGKIIL 330
            GK++L
Sbjct: 308 TGKLVL 313


>gi|170088967|ref|XP_001875706.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164648966|gb|EDR13208.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 337

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 122/325 (37%), Positives = 193/325 (59%), Gaps = 7/325 (2%)

Query: 13  SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72
            G G    +++ E+ IP  Q  ++L+KV+A G+NR D+ QR+G YPPP  ++ ILG+E +
Sbjct: 10  DGKGPVENLYIGETSIPTLQPGQVLVKVKAFGLNRMDISQREGHYPPPPGSSDILGVEFS 69

Query: 73  GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132
           G + + G + + W +GDEV  LV GG YAEY   +  H L  P     ++AAS+PE+F T
Sbjct: 70  GVVSNAGTDISEWKVGDEVLGLVGGGAYAEYIAVYHTHLLKKPSHLTWVEAASIPENFLT 129

Query: 133 VWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKL-- 189
            +  L     +  G  VLIH G+SG+G +AIQLA  +GA TV  T  ++EK    L L  
Sbjct: 130 AFQALVLVGKVTEGDNVLIHAGASGVGVSAIQLARVYGAHTVTATTSTQEKIDWLLNLPN 189

Query: 190 GAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGN 249
           GA HA NY  EDF  +++K TQ +G+D+++D VG  + +Q++  ++ +G++ +++ L G 
Sbjct: 190 GATHAANYKTEDFAAVVKKVTQNKGVDVVIDFVGQSHFSQNIEAMAVDGRMTMLALLSGA 249

Query: 250 IATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH----VIAPVIHT 305
           +  + NL PI+ KR+ I GSTLR RT   +  +    + +++  + S      +   IH 
Sbjct: 250 VVDKANLAPILYKRLHIEGSTLRSRTLKYQAELIAQFKQEVFGKITSQGGDGPVRTYIHK 309

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
           V P  ++  AH  ME +++ GKII+
Sbjct: 310 VFPWSEIQEAHKEMETNKNAGKIIV 334


>gi|289706868|ref|ZP_06503209.1| NAD(P)H quinone oxidoreductase, PIG3 family [Micrococcus luteus
           SK58]
 gi|289556418|gb|EFD49768.1| NAD(P)H quinone oxidoreductase, PIG3 family [Micrococcus luteus
           SK58]
          Length = 353

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 119/339 (35%), Positives = 193/339 (56%), Gaps = 8/339 (2%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +  +MR V  +G G + V+ +   P+P P   E+L+ V A G+NR D+ QR+G YPPP
Sbjct: 1   MDVPAQMRAVRFTGAGDNGVVRVGHEPVPDPGPGEVLVHVAAAGLNRADIAQREGRYPPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTT-----HWNIGDEVCALVNGGGYAEYCLSHQGHTLPIP 115
           + A+ I GLEV+G +  LG          + +GD VCAL+ GGG+AEY     G  + +P
Sbjct: 61  RGASEIPGLEVSGTVAALGPEAGMPGEGRFAVGDRVCALLAGGGFAEYVAVPAGQLMAVP 120

Query: 116 KGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYT 175
            G   ++AA+LPE   TV + L   A +++G  VL+HG + GIG+ A+Q  +  GA V  
Sbjct: 121 DGVGLVEAAALPEVACTVHSTLVGRAGVQAGDRVLVHGATGGIGSFAVQFLAALGARVLG 180

Query: 176 TAKSEEKCLACLKLGAKHAINYLKED---FLEILQKETQGRGIDIILDMVGAEYLNQHLT 232
           TA   EK     +LGA+H  ++   +   F   +++ T G G D+ILD+VG  YL  +++
Sbjct: 181 TAGGPEKVALGRRLGAEHMFDHRAAESGAFAPWVKEVTDGHGADVILDVVGGPYLAPNVS 240

Query: 233 LLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWP 292
            L+ EG+++ ++  GG +  + N+  ++ KR  +TG+TLR R+ + K  I  + +  +WP
Sbjct: 241 ALAPEGRIVTLAVQGGAVPEDFNIMKLVVKRGWLTGATLRSRSVVDKAGIVAAAERAVWP 300

Query: 293 LLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
           L+ +  I   +    PL + A A D  + +   GK++L+
Sbjct: 301 LVAAGRIDASVGACFPLAEAAEAFDWFDSATRTGKVVLV 339


>gi|148262263|ref|YP_001228969.1| alcohol dehydrogenase [Geobacter uraniireducens Rf4]
 gi|146395763|gb|ABQ24396.1| Alcohol dehydrogenase, zinc-binding domain protein [Geobacter
           uraniireducens Rf4]
          Length = 329

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 193/327 (59%), Gaps = 5/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V + G+G   V+ + E+  P P++ E+L+KV A  VNRPD++QR+G YPPP   + I
Sbjct: 1   MKAVLLEGFGGVEVLKVGEAEKPSPKENEVLVKVMATSVNRPDLVQREGKYPPPPGDSEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEVAG I  LG N + W +GD V +LV GGGYAEY +++  H +PIP   +  +AA +
Sbjct: 61  LGLEVAGVIEQLGSNVSGWRVGDRVLSLVGGGGYAEYAVAYADHLMPIPDTMSFEEAACV 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG--ATVYTTAKSEEKCL 184
            ES+ T + N+F     + GQT ++HGG  G+ T  IQL       + +  TA S EK  
Sbjct: 121 CESYITAFLNIFILGEFKDGQTAILHGGGGGVNTAGIQLCRALAPNSKLIVTA-SPEKME 179

Query: 185 ACLKLGAKHAINYLKE-DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
              ++GA   +N+ +  DF EI+++ T  +G+D+ILD +GA+YL  ++  L+ +GKL++I
Sbjct: 180 RVKEVGADLVVNFRETPDFSEIVKEYTNKKGVDLILDHIGAKYLAPNMNSLAYKGKLVVI 239

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
               G I  E+NL  ++ KR  I GS LR R    K  I      +  P      I P+I
Sbjct: 240 GVTSG-IKAELNLALMMVKRQQIIGSVLRSRPVSEKGEIVAEFTKRALPKFADRTIVPII 298

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             V PL +V  AH +ME+ +H GKI+L
Sbjct: 299 EKVFPLDQVVDAHRMMEEDKHFGKIVL 325


>gi|317051469|ref|YP_004112585.1| NAD(P)H quinone oxidoreductase, PIG3 family [Desulfurispirillum
           indicum S5]
 gi|316946553|gb|ADU66029.1| NAD(P)H quinone oxidoreductase, PIG3 family [Desulfurispirillum
           indicum S5]
          Length = 329

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 129/326 (39%), Positives = 186/326 (57%), Gaps = 3/326 (0%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V M G+G   V+ + ++P P P + ++LIKV A  +NRPD++QR+G YPPP   + I
Sbjct: 1   MRAVLMEGFGGLEVLKVGDAPKPAPAEGQVLIKVMATSINRPDLVQREGNYPPPPGDSEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEVAG I ++G   T + +GD V +LV GGGYA+Y +++  H +PIP   +  QAA +
Sbjct: 61  LGLEVAGTIEEIGPGVTGYQVGDRVMSLVGGGGYAQYAVAYASHLMPIPDSMSFEQAACV 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLA 185
            ES+ T + N+F    LR GQT ++HGG  G+ T AIQL       T      S +K   
Sbjct: 121 CESYITAFLNVFMIGELRDGQTAILHGGGGGVNTAAIQLCKALTPNTKLIVTASTKKQDR 180

Query: 186 CLKLGAKHAINYLKE-DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIIS 244
              LG    +NY +  +F + +++ T  +G+D+ILD VGA+YL+ ++  L+ +G+L+II 
Sbjct: 181 VKDLGVDLVVNYEETPNFADAVKEFTAKKGVDVILDHVGAKYLDPNMKSLAYKGRLVIIG 240

Query: 245 FLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIH 304
              G I  E+NL  ++ KR  I GS LR R    K  I         P      I P+IH
Sbjct: 241 VTSG-IKAELNLALMMVKRQQIIGSVLRSRPVKEKAEIVAEFTRTALPKFADGTIVPMIH 299

Query: 305 TVLPLGKVAMAHDIMEKSEHIGKIIL 330
               L +V  AH  ME+  H GKI+L
Sbjct: 300 RTFSLDEVVEAHRTMEEDHHFGKIVL 325


>gi|322821562|gb|EFZ27849.1| oxidoreductase, putative [Trypanosoma cruzi]
          Length = 337

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 124/331 (37%), Positives = 201/331 (60%), Gaps = 6/331 (1%)

Query: 5   KKMRHVAMSGYGKSNVMFLAE-SPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNA 63
           K MR V M  +G  +VM ++E + +   +  +++I+V A GVNR DV QR+G YPPPK +
Sbjct: 2   KSMRAVTMRAFGDVDVMHISEVTGVSLSRPSDVIIRVMAAGVNRADVSQRQGHYPPPKGS 61

Query: 64  NPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           + ILG+EV+G +  +GEN   +  GD V AL+ GGGYAE  ++H+G  + IP+GY+ ++A
Sbjct: 62  SEILGMEVSGVVEKVGENVKRFKEGDRVMALLTGGGYAEMAVAHEGSVMKIPEGYSFVEA 121

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLAS-YFGATVYTTAKSE-- 180
           A++PE+F T W  L    NL+ GQ +L H G+SG+GT A+QLA  YF AT   T  S   
Sbjct: 122 AAIPEAFLTAWQALKLHGNLQKGQHMLFHAGASGVGTAALQLAEKYFRATAIATCSSGKV 181

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILD-MVGAEYLNQHLTLLSKEGK 239
           E C    K     + +   + F   ++   +G  +++I+D +VG  YL +   +L+++GK
Sbjct: 182 EFCKKFAKFVVDRSPDASGKCFSSKVRDAVKGETVNLIVDPVVGGTYLQEDGEVLAQDGK 241

Query: 240 LIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVI 299
           +++++F+GG   + +++ P   KR ++  S LR +TD  K+++  S + ++ P +    I
Sbjct: 242 VVLLAFMGGAKVS-LDVMPFFRKRASVIFSKLRDQTDEYKEALVRSFEEEVIPYMTRREI 300

Query: 300 APVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            PV+     L +VA AH +ME ++  GKIIL
Sbjct: 301 VPVVQCTYALEEVAAAHKLMENNKSNGKIIL 331


>gi|25026736|ref|NP_736790.1| putative quinone oxidoreductase [Corynebacterium efficiens YS-314]
 gi|259508129|ref|ZP_05751029.1| NADPH:quinone reductase [Corynebacterium efficiens YS-314]
 gi|23492015|dbj|BAC16990.1| putative quinone oxidoreductase [Corynebacterium efficiens YS-314]
 gi|259164218|gb|EEW48772.1| NADPH:quinone reductase [Corynebacterium efficiens YS-314]
          Length = 318

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 132/324 (40%), Positives = 194/324 (59%), Gaps = 8/324 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ +  +    +  + L + P+P  +  E+L++V+A GVNR D++Q +G YP P  A+ I
Sbjct: 1   MKAIVQTEEKNTASLELQDVPVPTLKPGEVLVEVKAAGVNRADLLQTQGNYPVPPGASEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLE AG I D G+  T  + G+EV  L+ GGGYAE+    +G  +PIP+G++ ++AAS+
Sbjct: 61  LGLECAGIIADPGD--TGRSKGEEVACLLTGGGYAEFVAVPEGQLMPIPEGFSFVEAASI 118

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
            E   TVW+N+   A L+ GQT L+HGG+ GIGT A+Q+    GATV  T  S EK   C
Sbjct: 119 VEVACTVWSNIGMLAGLKEGQTFLVHGGAGGIGTFAVQMGKAMGATVAVTTGSPEKLQTC 178

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA   INY +EDF E+L+        D+ILD++GA+YL Q++  L+K+G ++ I   
Sbjct: 179 QQLGADILINYREEDFAEVLKNRA-----DVILDIIGAKYLGQNVKALAKDGHMVTIGLQ 233

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +  E+NL  +++KR TI+ + LR R D  K  I  +    IWP+L    I P I   
Sbjct: 234 GG-VKGELNLGLLLAKRGTISATALRGRDDADKARIVAATVEAIWPMLADGRITPHIDHT 292

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
           LPL   A A   +E     GK++L
Sbjct: 293 LPLADAAKALKALEDGTVTGKLVL 316


>gi|149374460|ref|ZP_01892234.1| Alcohol dehydrogenase, zinc-binding protein [Marinobacter algicola
           DG893]
 gi|149361163|gb|EDM49613.1| Alcohol dehydrogenase, zinc-binding protein [Marinobacter algicola
           DG893]
          Length = 322

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/324 (38%), Positives = 190/324 (58%), Gaps = 7/324 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR + +SG   S   +   S +P+     + I +    +NR D+MQ+ G+YPPP  A+ I
Sbjct: 2   MRAIKISGDTLSWEAYEEPSEVPE---NHVAIDIAWTAINRADLMQKAGVYPPPPGASDI 58

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEV+G +  +GE   H   GDEVCAL+ GGGYA + +      LPIPKGY+  +AA++
Sbjct: 59  LGLEVSGTVSRVGEGVDHLKPGDEVCALLTGGGYATHVVVPAVQVLPIPKGYSLKEAAAI 118

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE F T W NL+  A L+ G+ VL+H  +SG+GT  IQLA+  G  V+ TA   EK   C
Sbjct: 119 PEVFATAWLNLYHEAALKPGEKVLVHAAASGLGTAVIQLATALGNPVFATAGDNEKLETC 178

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            KLGA    N     F++ ++      G+D++LD VG  Y+ +   +L+ +G++I+I  +
Sbjct: 179 RKLGASGVWNRKDGSFVDAIKSWG---GVDMVLDPVGGNYIAEDQKVLNMDGRIILIGLM 235

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
           GG +A E++L  ++ KR  + GSTLR R    K  +  +L   +WPLL++  I PVI + 
Sbjct: 236 GGRMA-EVDLGLMLMKRHRLIGSTLRSRPVADKGDVMSALYKHVWPLLSARQIDPVIDSA 294

Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330
            P+ K   A   + ++ +IGK++L
Sbjct: 295 WPIEKAGEAMAYVAENRNIGKVLL 318


>gi|169628205|ref|YP_001701854.1| putative quinone oxidoreductase [Mycobacterium abscessus ATCC
           19977]
 gi|169240172|emb|CAM61200.1| Putative quinone oxidoreductase [Mycobacterium abscessus]
          Length = 330

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 137/328 (41%), Positives = 195/328 (59%), Gaps = 7/328 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAE-SPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           M  + ++G+G   VM   + + +P P   E+ I V A GVNR DVMQR GLYPPP   + 
Sbjct: 1   MYAITLNGFGDPEVMQWTQVADLPAPGPGEVTIDVVAAGVNRADVMQRLGLYPPPPGVSE 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I GLEV+G I ++G     W  GD VCAL+ GGGYAE         LP+P+G +   AA+
Sbjct: 61  IPGLEVSGHIAEVGPAVQGWVPGDAVCALMAGGGYAERVNVAATQVLPVPRGVSITAAAA 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           LPE+  TVW+N+  T  LRSGQT+LIHGG SGIGT AIQ+    GA V  TA ++ K   
Sbjct: 121 LPETAATVWSNVVMTGGLRSGQTLLIHGGGSGIGTHAIQVGRALGANVAVTAGTQFKLDR 180

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C +LGA   INY ++DF  ++       G ++ILD+VG  YL +++  L++ G L II  
Sbjct: 181 CRELGAHTLINYREQDFPAVVNAAYS--GANVILDIVGGGYLAKNVEALAENGHLTIIGL 238

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDI---AKQSIRDSLQLKIWPLLNSHVIAPV 302
            GG  A E+NL  ++ KR ++  + LRRR +    +K  I   L+  +WPL+    +APV
Sbjct: 239 QGG-AAAELNLGALLFKRGSVHATNLRRRPEQGPGSKAEIIAELRQHLWPLIAEGTVAPV 297

Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           +   +P+   A AH +++  E +GK++L
Sbjct: 298 VSAEVPVTDAAEAHRLLDSPETVGKVLL 325


>gi|300742383|ref|ZP_07072404.1| alcohol dehydrogenase, zinc-containing [Rothia dentocariosa M567]
 gi|300381568|gb|EFJ78130.1| alcohol dehydrogenase, zinc-containing [Rothia dentocariosa M567]
          Length = 336

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 127/335 (37%), Positives = 195/335 (58%), Gaps = 13/335 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR +    +G   V+ L+E PIP P   ++L++V+A G+NR D +QR+G YPPP  A+ +
Sbjct: 1   MRAIVEKEHGDPEVLTLSEVPIPAPAPGQVLVRVQAAGLNRADSLQRRGHYPPPAGASSV 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG +  +GE      +G+ V AL+ GGGYAEY      HTLP+PKG + ++AA +
Sbjct: 61  YGLEIAGVVEAVGEGVDPTLVGERVMALLAGGGYAEYAAVDVRHTLPVPKGMSMVEAACI 120

Query: 127 PESFFTVWANLF----------QTANLRSGQT-VLIHGGSSGIGTTAIQLASYFGATVYT 175
           PE   TV++NL           Q       QT +L+HGG+ G+G  AIQLA   G  V+ 
Sbjct: 121 PEVAATVYSNLVLLCGMSLDPAQNKPAEDEQTSLLVHGGTGGVGMHAIQLARAAGVRVFA 180

Query: 176 TAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLS 235
           T   +EK      LGA H INY  E F +++Q+E+ G G++ ILD+VGA+YL  +L  L+
Sbjct: 181 TVGDDEKAQVVRALGA-HPINYRTESFRQVIQRESAGHGVNYILDVVGAKYLEDNLRSLA 239

Query: 236 KEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLN 295
             G L  I+  GG  A E++L  +++KR+++ G++LR R+   K  I   +   + PLL 
Sbjct: 240 DGGHLATIAVQGGRRA-ELDLGLMLTKRLSVHGTSLRSRSADEKAKIMAGVHENVLPLLE 298

Query: 296 SHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             V++  +    P  + + AH+  +  +H GK++L
Sbjct: 299 RGVLSANLDREFPWWQASQAHEYFDAGQHRGKVVL 333


>gi|194295687|gb|ACF40869.1| quinone oxidoreductase [Streptomyces albus]
          Length = 319

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 132/325 (40%), Positives = 197/325 (60%), Gaps = 8/325 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V++   G   V+   E P P P   E+++ V A  +NR DVMQR GLYP P  A+P 
Sbjct: 1   MKAVSIKEPGGPEVLEWTEVPDPSPAAGEVVVDVVAGALNRADVMQRMGLYPVPAGASPY 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEV+G+I  +G   T W +GDEVCAL+ GGGYA+      G  L +P+G   ++AA L
Sbjct: 61  PGLEVSGRISAVGTGVTGWKVGDEVCALLTGGGYAQKVAVPAGQLLTVPQGIGLVEAAGL 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186
           PE+  TVW+N+  TA L+ G+T L+HGG+ G+GT AIQ+A   GA V TT  S EK    
Sbjct: 121 PEAVATVWSNIVMTAGLKEGETFLVHGGTGGVGTAAIQIAKAIGARVVTTVGSPEKAERA 180

Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246
            +LGA  AI++  +DF       T+    D+ILD+VG  YL  ++  L+ +G+L++I   
Sbjct: 181 RELGADLAIDHRTQDF-------TEHGPYDVILDVVGGSYLAGNVRSLAADGRLVVIGLQ 233

Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306
            G +   +NL  ++ KR+++ G+TLR R+   K +I   +Q K+WPL+ +  +  V+   
Sbjct: 234 DG-LEGRLNLADMVFKRLSVHGTTLRTRSAAQKAAIVAEVQEKVWPLIENGTVKLVVDRT 292

Query: 307 LPLGKVAMAHDIMEKSEHIGKIILL 331
           +P+ + A AH +M+   HIGKI+L+
Sbjct: 293 VPMAEAAEAHRLMDTGRHIGKILLV 317


>gi|71420395|ref|XP_811475.1| oxidoreductase [Trypanosoma cruzi strain CL Brener]
 gi|70876143|gb|EAN89624.1| oxidoreductase, putative [Trypanosoma cruzi]
          Length = 337

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 201/331 (60%), Gaps = 6/331 (1%)

Query: 5   KKMRHVAMSGYGKSNVMFLAE-SPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNA 63
           K MR V M  +G  +VM ++E + +   +  +++I+V A GVNR DV QR+G YPPPK +
Sbjct: 2   KSMRAVTMRAFGDVDVMHISEVTGVSLSRPSDVIIRVMAAGVNRADVSQRQGHYPPPKGS 61

Query: 64  NPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           + ILG+EV+G +  +GEN   +  GD V AL+ GGGYAE  ++H+G  + IP+GY+ ++A
Sbjct: 62  SEILGMEVSGVVEKVGENVKRFKEGDRVMALLTGGGYAEMAVAHEGSVMKIPEGYSFVEA 121

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLAS-YFGATVYTTAKSE-- 180
           A++PE+F T W  L    NL+ GQ +L H G+SG+GT A+QLA  YF AT   T  S   
Sbjct: 122 AAIPEAFLTAWQALKLHGNLQKGQHMLFHAGASGVGTAALQLAEKYFRATAIATCSSGKV 181

Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILD-MVGAEYLNQHLTLLSKEGK 239
           E C    K     + +   + F   ++   +G  +++I+D +VG  YL +   +L+++GK
Sbjct: 182 EFCKRFAKFVVDRSPDASGKCFSSKVRDAVKGETVNLIVDPVVGGTYLQEDGEVLAQDGK 241

Query: 240 LIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVI 299
           +++++F+GG   + +++ P   KR ++  S LR +TD  K+++  S + ++ P +    I
Sbjct: 242 VVLLAFMGGAKVS-LDVMPFFRKRASVIFSKLRDQTDEYKEALVRSFEEEVIPYMTRREI 300

Query: 300 APVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
            PV+     L +VA AH +ME ++  GK+IL
Sbjct: 301 VPVVQCTYALEEVAAAHKLMENNKSNGKVIL 331


>gi|322500757|emb|CBZ35834.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 350

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 131/332 (39%), Positives = 203/332 (61%), Gaps = 12/332 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQP---QKEEILIKVEAIGVNRPDVMQRKGLYPPPKNA 63
           MR V + G+G ++V+ +  S IP+    +  +ILIKV A GVNR D  QRKG YPPPK +
Sbjct: 4   MRAVTLKGFGDTDVLQI--SRIPKAVITRGRDILIKVSAAGVNRADAAQRKGHYPPPKGS 61

Query: 64  NPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           + +LGLEV+G +  +G++   +  GD+V AL+ GGGYAEY ++H+G  + IP+GY+ I+A
Sbjct: 62  SEVLGLEVSGIVEQVGDDVKDFKEGDKVMALLPGGGYAEYAVAHEGSVMHIPQGYSFIEA 121

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLAS-YFGATVYTTAKSEEK 182
           A++PE+F T W  L    + R GQ VLIH G+SG+GT A QL   YF AT  TT+ SE K
Sbjct: 122 AAIPEAFLTAWQALKYHGDCRRGQKVLIHAGASGVGTAAAQLVEKYFQATALTTS-SESK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQ--GRG-IDIILDMV-GAEYLNQHLTLLSKEG 238
              C    + +      E  +    K     G G I+++LD V G  Y+++   +L+K+G
Sbjct: 181 VEVCKNFASINLTRTPDETGMCFSPKVKSLLGEGAINLVLDSVFGGSYISEDAAVLAKDG 240

Query: 239 KLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHV 298
           ++++++F+GG     +N  P++ +R  +  S LR ++D  KQ++ D+ +  + P +N  V
Sbjct: 241 RIVVLAFMGG-ATVHLNCLPLLRQRAHVMFSKLRCQSDDYKQNLVDTFEEAVIPYMNERV 299

Query: 299 IAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           I PV +   PL +VA AH  ++ S+  GKI+L
Sbjct: 300 IVPVANKTYPLEEVAQAHARLDDSKAWGKIVL 331


>gi|322488679|emb|CBZ23926.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 350

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 133/332 (40%), Positives = 204/332 (61%), Gaps = 12/332 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQP---QKEEILIKVEAIGVNRPDVMQRKGLYPPPKNA 63
           MR V + G+G ++++ +  S IP+    +  +ILIKV A GV+R D  QRKG YPPPK +
Sbjct: 4   MRAVTLKGFGDTDMLQI--SRIPKAVITRGRDILIKVSAAGVSRADAAQRKGHYPPPKGS 61

Query: 64  NPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           + +LGLEV+G +  +G++   +  GD+V AL+ GGGYAEY ++H+G  + IPKGY+ I+A
Sbjct: 62  SEVLGLEVSGIVEQVGDDVKLFKEGDKVMALLPGGGYAEYAVAHEGSVMHIPKGYSFIEA 121

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLAS-YFGATVYTTAKSEEK 182
           A++PE+F T W  L    N R GQTVLIH G+SG+GT A QL   YF AT  TT+ SE K
Sbjct: 122 ATIPEAFLTAWQALQYHGNCRKGQTVLIHAGASGVGTVAAQLVEKYFQATAVTTS-SESK 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQ--GRG-IDIILDMV-GAEYLNQHLTLLSKEG 238
              C    + +      E  +    K     G G I+++LD V G  Y+++   +L+K+G
Sbjct: 181 VEVCKNFASINLTRTPDETGMCFSPKVKSLLGEGAINLVLDSVFGGSYISEDAAVLAKDG 240

Query: 239 KLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHV 298
           ++++++F+GG     +N  P++ +R  I  S LR ++D  KQ++ D+ + ++ P +N  V
Sbjct: 241 RIVVLAFMGG-ATVHLNCLPLLRQRAHILFSKLRCQSDDYKQNLVDTFEKEVIPYMNERV 299

Query: 299 IAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           I PV     PL +VA AH  ++ S+  GKI+L
Sbjct: 300 IVPVASKTYPLEEVAQAHMRLDDSKAWGKIVL 331


>gi|227502368|ref|ZP_03932417.1| possible NADPH:quinone reductase [Corynebacterium accolens ATCC
           49725]
 gi|227076922|gb|EEI14885.1| possible NADPH:quinone reductase [Corynebacterium accolens ATCC
           49725]
          Length = 323

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 139/325 (42%), Positives = 193/325 (59%), Gaps = 8/325 (2%)

Query: 6   KMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           +M+ +  +       + L +  +P+ +  E+L+KV+A GVNR D++Q  G YPPP  A+ 
Sbjct: 5   QMKAIVQTDPDTPRSLELQDVDVPELRSGEVLVKVKAAGVNRGDILQTMGAYPPPPGASE 64

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I+GLE AG I D G+  T W  G EV  L+ GGGYAEY    QG  LP+PKG++  + A+
Sbjct: 65  IIGLEAAGVIEDAGD--TDWETGTEVGCLLAGGGYAEYVAVPQGQLLPLPKGFSLEETAA 122

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185
           + E   TVW+NL   A L  GQ VLIHGG  GIGT AIQ+A   GA V  TA S+EK   
Sbjct: 123 VVEVGCTVWSNLGIEAGLHEGQRVLIHGGGGGIGTFAIQVAKALGAEVAVTAGSQEKLDR 182

Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245
           C +LGA   INY ++DF+     E +G   D+ILD++GA+YL +++  L+K+GKLIII  
Sbjct: 183 CRELGADILINYKEQDFV----YEFKGS-CDVILDIIGAKYLEKNMKCLAKDGKLIIIGM 237

Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305
            GG  A +INL P++ KR+TI G+TLR R    K  I       +WP+L    +   +H 
Sbjct: 238 QGGTKA-DINLAPMLPKRLTIQGTTLRARDLDDKAEIVAGTIKNVWPMLEDGRVKHALHG 296

Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330
             PL   A AH  ++  E  G ++L
Sbjct: 297 TYPLADAAQAHTALDSGEVTGTLVL 321


>gi|307543935|ref|YP_003896414.1| oxidoreductase [Halomonas elongata DSM 2581]
 gi|307215959|emb|CBV41229.1| probable oxidoreductase [Halomonas elongata DSM 2581]
          Length = 322

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/307 (40%), Positives = 183/307 (59%), Gaps = 5/307 (1%)

Query: 25  ESP-IPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTT 83
           E+P IP P   E+ +KV    VNR D+MQR G YPPP  A+ +LGLEV+G I +LG++  
Sbjct: 15  ETPAIPGPGAHEVRLKVAWADVNRADLMQRAGHYPPPPGASTVLGLEVSGTITELGDDVR 74

Query: 84  HWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANL 143
             ++G  VCAL+ GGGYAE  +      LP+P+ ++  +AA+LPE F T W NLF    L
Sbjct: 75  GLSVGQPVCALLAGGGYAEEVVVDAHQVLPLPEDFSLREAAALPEVFATAWLNLFMEGAL 134

Query: 144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFL 203
            +G  VL+H G+SG+GT AIQL   FG   + T  SE K  AC +LGA    N  +  F+
Sbjct: 135 GAGDRVLLHAGASGVGTAAIQLCRAFGYPCFVTVGSEAKLAACRELGADAGWNRHEGSFV 194

Query: 204 EILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKR 263
           + +Q+     G D+ILD VGA YL  +  +L+++G+L++I  +GG  A E+++  ++ KR
Sbjct: 195 DAVQRWG---GADMILDPVGASYLADNQRVLNEDGRLVVIGMMGGRQA-ELDMGRMLMKR 250

Query: 264 ITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE 323
             + GSTLR R   AK  I  +L   +WP L +  + P++    P+ +   AHD +    
Sbjct: 251 QRLIGSTLRARPPEAKGRILAALAEHVWPRLAAGELRPLVDRTWPIEEAEAAHDHVRADA 310

Query: 324 HIGKIIL 330
           + GK++L
Sbjct: 311 NTGKVLL 317


>gi|239916909|ref|YP_002956467.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Micrococcus
           luteus NCTC 2665]
 gi|281414636|ref|ZP_06246378.1| putative NAD(P)H quinone oxidoreductase, PIG3 family protein
           [Micrococcus luteus NCTC 2665]
 gi|239838116|gb|ACS29913.1| putative NAD(P)H quinone oxidoreductase, PIG3 family [Micrococcus
           luteus NCTC 2665]
          Length = 353

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 118/339 (34%), Positives = 194/339 (57%), Gaps = 8/339 (2%)

Query: 1   MPICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPP 60
           M +  +M  V  +G G + V+ + + P+P P   E+L++V A G+NR D+ QR+G YPPP
Sbjct: 1   MDVPAQMHAVRFTGAGGNGVVRVGQEPVPDPGPGEVLVQVAAAGLNRADIAQREGRYPPP 60

Query: 61  KNANPILGLEVAGKIVDLGENTT-----HWNIGDEVCALVNGGGYAEYCLSHQGHTLPIP 115
           + A+ I GLEV+G +  LG          + +GD VCAL+ GGG+AEY     G  + +P
Sbjct: 61  RGASEIPGLEVSGTVAALGPEAGMPGEGRFAVGDRVCALLAGGGFAEYVAVPAGQLMAVP 120

Query: 116 KGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYT 175
            G   ++AA+LPE   TV + L   A +++G  VL+HG + GIG+ A+Q  +   A V  
Sbjct: 121 DGVGLVEAAALPEVACTVHSTLVGRAGVQAGDRVLVHGATGGIGSFAVQFLTALAARVLG 180

Query: 176 TAKSEEKCLACLKLGAKHAINYLKED---FLEILQKETQGRGIDIILDMVGAEYLNQHLT 232
           TA   EK     +LGA+H  ++   +   F   +++ T G G D+ILD+VGA YL  +++
Sbjct: 181 TAGGPEKVALGRRLGAEHMFDHRAAESGAFAPWVKEVTDGHGADVILDVVGAPYLAPNVS 240

Query: 233 LLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWP 292
            L+ EG+++ ++  GG +  + N+  ++ KR  +TG+TLR R+ + K  I  + +  +WP
Sbjct: 241 ALAPEGRIVTLAVQGGAVPEDFNIMKLVVKRGWLTGATLRSRSVVDKAGIVAAAERAVWP 300

Query: 293 LLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILL 331
           L+ +  I   +    PL + A A D  + +   GK++L+
Sbjct: 301 LVAAGRIDASVGACFPLAEAAEAFDWFDSATRTGKVVLV 339


>gi|145294327|ref|YP_001137148.1| hypothetical protein cgR_0282 [Corynebacterium glutamicum R]
 gi|140844247|dbj|BAF53246.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 318

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 128/284 (45%), Positives = 178/284 (62%), Gaps = 9/284 (3%)

Query: 23  LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT 82
           L E P+P  +  E+L++V+A GVNR D++Q +G YP P  A+ ILGLE AG IVD G+  
Sbjct: 17  LQEVPVPTLKPGEVLVEVKAAGVNRADLLQTQGNYPVPAGASEILGLECAGVIVDAGD-- 74

Query: 83  THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTAN 142
           T   +G EV  L+ GGGYAEY    +G  +PIP+GY+ ++AAS+ E   TVW+N+   A 
Sbjct: 75  TGQTVGQEVACLLTGGGYAEYVAVPEGQLMPIPEGYSFVEAASIVEVACTVWSNIGMLAG 134

Query: 143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDF 202
           L+   T LIHGG+ GIGT AIQ+    G TV  TA S EK   C  LGA   INY +EDF
Sbjct: 135 LQKEDTFLIHGGAGGIGTFAIQMGKALGVTVAVTAGSTEKLKTCKNLGADILINYKEEDF 194

Query: 203 LEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISK 262
            E+L+ +      D+ILD++GA+YL+Q++  ++K+  +++I   GG +  E+NL  +++K
Sbjct: 195 AEVLKNKA-----DVILDIIGAKYLSQNVKAMAKDAHMVVIGMQGG-VKGELNLGHLLAK 248

Query: 263 RITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI-HT 305
           R TI+ + LR R +  K  I  S    IWPLL S  I P I HT
Sbjct: 249 RGTISATALRGRDEADKARIVSSTVENIWPLLQSKEITPHIDHT 292


>gi|296080973|emb|CBI18605.3| unnamed protein product [Vitis vinifera]
          Length = 270

 Score =  235 bits (600), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 113/269 (42%), Positives = 172/269 (63%), Gaps = 1/269 (0%)

Query: 64  NPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
           NP  GLE +G I  +G+    W +GD+VCAL++GGGYAE   +  G  LP+P G +   A
Sbjct: 3   NPYPGLECSGIIEAVGKAVVRWKVGDQVCALLSGGGYAEKVAAPAGLVLPVPSGVSLKDA 62

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A +PE   TVW+++F  + L +G+T L+HGGSSGIG  AIQ+A + GA V+ TA +EEK 
Sbjct: 63  AGIPEVACTVWSSVFMMSQLSAGETFLVHGGSSGIGIFAIQIAKHIGARVFVTAGNEEKL 122

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             C  LGA   INY  EDF+  +++ET G+G+D+ILD +G  Y  +++  L+ +G+L II
Sbjct: 123 AVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDNIGGAYFQRNIDSLNVDGRLFII 182

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
            F GG +A E+NL+ ++++R+T+  + LR R+   K  I   ++  +WP + +  +  V+
Sbjct: 183 GFQGGTVA-EVNLSGLLARRLTVQAAGLRNRSLENKAVIVSEVEKNVWPAIMAGKVKTVV 241

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIILLP 332
           +   PL   A AH +ME  +H GKI+L+P
Sbjct: 242 YKYFPLTDAAEAHLLMESGKHFGKILLIP 270


>gi|283457281|ref|YP_003361854.1| NADPH:quinone reductase [Rothia mucilaginosa DY-18]
 gi|283133269|dbj|BAI64034.1| NADPH:quinone reductase [Rothia mucilaginosa DY-18]
          Length = 336

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 131/335 (39%), Positives = 193/335 (57%), Gaps = 13/335 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR +  + +G    + ++E P P P+  E+LI+V A G+NR D +QR+G YPPP  A+ I
Sbjct: 1   MRAIIENSHGGPEALTISEVPAPVPRSHEVLIRVHAAGINRADALQRRGFYPPPAGASAI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLEVAG I  +GE  +  N G  V AL+ GGGYA+Y      H LP+P+  +  +AA +
Sbjct: 61  YGLEVAGVIEAVGEGASVENRGTPVMALLAGGGYADYVTVPVDHVLPVPEQLSFAEAAGI 120

Query: 127 PESFFTVWANLFQTANL---------RSGQ--TVLIHGGSSGIGTTAIQLASYFGATVYT 175
           PE   TV++NL  T  +           G+   VL+HGG+ GIG  AIQLA   G  V+ 
Sbjct: 121 PEVAATVYSNLVLTCGMSMNPAENLKEDGEPAVVLVHGGTGGIGVHAIQLALAVGTRVFA 180

Query: 176 TAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLS 235
           T ++EEK      LGA+  I Y +  F E+L  ET GRG D ILD+VG +YL+ +L  L+
Sbjct: 181 TVRTEEKAEYVRSLGAE-PIVYTEHSFREVLLAETGGRGADYILDVVGGKYLDDNLHTLA 239

Query: 236 KEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLN 295
             G L II  +GG  A E+NL  ++S+R+++  ++LR R+D  K  I   ++  + PL+ 
Sbjct: 240 DGGHLCIIGLMGGAKA-EVNLGYMLSRRLSVHATSLRTRSDQQKAEILRGVREHVLPLIE 298

Query: 296 SHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           S  I   +  +  + + A AH+  +  +H GKI+L
Sbjct: 299 SGRIGVGLDRIFDMEEAAAAHEYFDSGQHRGKIVL 333


>gi|71280295|ref|YP_269965.1| oxidoreductase, zinc-binding [Colwellia psychrerythraea 34H]
 gi|71146035|gb|AAZ26508.1| oxidoreductase, zinc-binding [Colwellia psychrerythraea 34H]
          Length = 329

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 120/317 (37%), Positives = 190/317 (59%), Gaps = 7/317 (2%)

Query: 21  MFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGE 80
           +  +++ +P+   +E LIKV AIG+NR D++QR G YP P   + ILGLEV+G+IV  G+
Sbjct: 12  LVFSQTDMPKIVADECLIKVHAIGINRADLLQRAGKYPAPAGESSILGLEVSGEIVQCGD 71

Query: 81  NTTH------WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVW 134
             +       W +GD+V  LV GGGYA+Y          +P+ +   Q A+  E F T +
Sbjct: 72  AVSDNHLAQSWQVGDKVFGLVAGGGYAQYVKVKARQLFCLPEQFTFEQGAACAEVFLTAY 131

Query: 135 ANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHA 194
            +LF  A L +   VLIH G+SG+G+ AIQLA      V  T  SE K  ACL LGA  A
Sbjct: 132 QSLFSIAKLANNSKVLIHAGASGVGSAAIQLAKAKQCYVTVTVGSEVKAQACLALGADCA 191

Query: 195 INYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEI 254
           INY K DF+    KE    G D+I+D+V  EYL++++ + + +G ++ +S LGG   +++
Sbjct: 192 INYQKNDFVA-WSKENVLAGYDVIIDVVSGEYLSKNINVAALDGHIVTLSMLGGRYCSQV 250

Query: 255 NLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAM 314
           ++  +++KR+T++ STLR R++  K  + D+     +  L +  I P+I ++ P  +V  
Sbjct: 251 DIAKLLAKRLTLSASTLRNRSEDYKAQLVDNFSSDFYADLVNGQIKPIIDSIYPWQQVEQ 310

Query: 315 AHDIMEKSEHIGKIILL 331
           AH+ M K++++GK++LL
Sbjct: 311 AHEKMAKNKNVGKLVLL 327


>gi|19551454|ref|NP_599456.1| NADPH:quinone reductase or related Zn-dependent oxidoreductase
           [Corynebacterium glutamicum ATCC 13032]
          Length = 326

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 127/284 (44%), Positives = 178/284 (62%), Gaps = 9/284 (3%)

Query: 23  LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT 82
           L E P+P  +  E+L++V+A GVNR D++Q +G YP P  A+ ILGLE AG IVD G+  
Sbjct: 25  LQEVPVPTLKPGEVLVEVKAAGVNRADLLQTQGNYPVPAGASEILGLECAGVIVDAGD-- 82

Query: 83  THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTAN 142
           T   +G EV  L+ GGGYA+Y    +G  +PIP+GY+ ++AAS+ E   TVW+N+   A 
Sbjct: 83  TGQTVGQEVACLLTGGGYAQYVAVPEGQLMPIPEGYSFVEAASIVEVACTVWSNIGMLAG 142

Query: 143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDF 202
           L+   T LIHGG+ GIGT AIQ+    G TV  TA S EK   C  LGA   INY +EDF
Sbjct: 143 LQKEDTFLIHGGAGGIGTFAIQMGKALGVTVAVTAGSTEKLKTCKNLGADILINYKEEDF 202

Query: 203 LEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISK 262
            E+L+ +      D+ILD++GA+YL+Q++  ++K+  +++I   GG +  E+NL  +++K
Sbjct: 203 AEVLKNKA-----DVILDIIGAKYLSQNVKAMAKDAHMVVIGMQGG-VKGELNLGHLLAK 256

Query: 263 RITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI-HT 305
           R TI+ + LR R +  K  I  S    IWPLL S  I P I HT
Sbjct: 257 RGTISATALRGRDEADKARIVSSTVENIWPLLQSKEITPHIDHT 300


>gi|302689233|ref|XP_003034296.1| hypothetical protein SCHCODRAFT_14755 [Schizophyllum commune H4-8]
 gi|300107991|gb|EFI99393.1| hypothetical protein SCHCODRAFT_14755 [Schizophyllum commune H4-8]
          Length = 335

 Score =  235 bits (599), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 122/334 (36%), Positives = 196/334 (58%), Gaps = 12/334 (3%)

Query: 7   MRHVAM-SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65
           MR V +  G G +  +++ E+P P P   E+L++++A G+NR D++QR+G YPPP  A+ 
Sbjct: 1   MRAVLIKDGKGPAENLYIGEAPKPTPAAGEVLVQIKAFGLNRLDILQRQGNYPPPPGASD 60

Query: 66  ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125
           I+G+E +G +V++G     W  G EV  LV GG YAE+      H  P P+G + +QAA+
Sbjct: 61  IMGVEFSGVVVEIGSGVEMWKEGAEVMGLVGGGAYAEFINVTATHLFPKPEGLSWVQAAA 120

Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEK-- 182
           +PE + T + +L    NL+ G+ VLIH G+SG+G  A QL+  +GA  ++ TA S++K  
Sbjct: 121 IPEVWLTAFQSLITINNLQKGEDVLIHAGASGVGIAATQLSHLYGANRIFVTAGSDDKLA 180

Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242
            L  +  G  H +NY  +DF   +Q+ET GRG+D+ILD VG  +  +++  L+ +G+L +
Sbjct: 181 TLKSMPAGPSHGVNYKTQDFAAEIQRETGGRGVDVILDFVGQSHWQKNIKSLAVDGRLSL 240

Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLL------NS 296
              L G    + +L PI+ KR+ I GSTLR R+   +  +      ++ P +      +S
Sbjct: 241 QGLLSGGKVPDFDLAPILGKRLRIQGSTLRSRSKQYQAELIQRFAHEVMPKMQAEGPISS 300

Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           H I   +  V P  ++  AH  ME  ++IGKI++
Sbjct: 301 HWI--FVTQVFPWTQIQEAHKDMEADKNIGKIVV 332


>gi|62389100|ref|YP_224502.1| quinone oxidoreductase [Corynebacterium glutamicum ATCC 13032]
 gi|21322967|dbj|BAB97596.1| NADPH:quinone reductase and related Zn-dependent oxidoreductases
           [Corynebacterium glutamicum ATCC 13032]
 gi|41324433|emb|CAF18773.1| QUINONE OXIDOREDUCTASE [Corynebacterium glutamicum ATCC 13032]
          Length = 318

 Score =  234 bits (598), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 127/284 (44%), Positives = 178/284 (62%), Gaps = 9/284 (3%)

Query: 23  LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT 82
           L E P+P  +  E+L++V+A GVNR D++Q +G YP P  A+ ILGLE AG IVD G+  
Sbjct: 17  LQEVPVPTLKPGEVLVEVKAAGVNRADLLQTQGNYPVPAGASEILGLECAGVIVDAGD-- 74

Query: 83  THWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTAN 142
           T   +G EV  L+ GGGYA+Y    +G  +PIP+GY+ ++AAS+ E   TVW+N+   A 
Sbjct: 75  TGQTVGQEVACLLTGGGYAQYVAVPEGQLMPIPEGYSFVEAASIVEVACTVWSNIGMLAG 134

Query: 143 LRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDF 202
           L+   T LIHGG+ GIGT AIQ+    G TV  TA S EK   C  LGA   INY +EDF
Sbjct: 135 LQKEDTFLIHGGAGGIGTFAIQMGKALGVTVAVTAGSTEKLKTCKNLGADILINYKEEDF 194

Query: 203 LEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISK 262
            E+L+ +      D+ILD++GA+YL+Q++  ++K+  +++I   GG +  E+NL  +++K
Sbjct: 195 AEVLKNKA-----DVILDIIGAKYLSQNVKAMAKDAHMVVIGMQGG-VKGELNLGHLLAK 248

Query: 263 RITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI-HT 305
           R TI+ + LR R +  K  I  S    IWPLL S  I P I HT
Sbjct: 249 RGTISATALRGRDEADKARIVSSTVENIWPLLQSKEITPHIDHT 292


>gi|315498723|ref|YP_004087527.1| nad(p)h quinone oxidoreductase, pig3 family [Asticcacaulis
           excentricus CB 48]
 gi|315416735|gb|ADU13376.1| NAD(P)H quinone oxidoreductase, PIG3 family [Asticcacaulis
           excentricus CB 48]
          Length = 323

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 115/310 (37%), Positives = 184/310 (59%), Gaps = 4/310 (1%)

Query: 21  MFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGE 80
           +++ +   P+  +  +LI+V   GVNRPD++QR+G YPPP  A+PI+GLEVAG +  +  
Sbjct: 16  LYVGDVSRPEVGRGHVLIRVSHSGVNRPDILQRQGSYPPPPGASPIMGLEVAGTVETVNS 75

Query: 81  NTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQT 140
           +   W +GD VC+LVNGGGYAEY      H LP+P+G +  +AA LPE   TV+ANL + 
Sbjct: 76  DENLWTVGDRVCSLVNGGGYAEYVSVDARHLLPVPRGLSEAEAAGLPEVCLTVYANLMEH 135

Query: 141 ANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKE 200
             L++G+TVL+HG +SGIG+  + +A  FGA V  T +  E+      LGA H I+    
Sbjct: 136 GALQAGETVLVHGTNSGIGSMTVMMAKGFGANVIATVRGAERAAWVKGLGADHVIDTRNT 195

Query: 201 DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPII 260
           DF+  ++      G D++LD++G +Y  +++  L   G+++ +  + GN  TEI L  ++
Sbjct: 196 DFVTPVKDLG---GADVVLDIMGGDYTPKNILCLKHRGRIVQVGMIRGN-KTEIELPRLM 251

Query: 261 SKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIME 320
            K+  +TGS LR R+   K  +  ++  ++WPL+ +  I PV+  V        A   ++
Sbjct: 252 QKQGILTGSMLRPRSADEKARLSAAVAERVWPLIEAGAIRPVLARVFDAADAGAAQAYLD 311

Query: 321 KSEHIGKIIL 330
             +H GK++L
Sbjct: 312 SGQHTGKVVL 321


>gi|313673706|ref|YP_004051817.1| nad(p)h quinone oxidoreductase, pig3 family [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312940462|gb|ADR19654.1| NAD(P)H quinone oxidoreductase, PIG3 family [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 328

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 133/327 (40%), Positives = 192/327 (58%), Gaps = 5/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR V  +G+G  +V+ + + PIP+P++ ++LIKV A  +NRPD++QR+G YPPP   + I
Sbjct: 1   MRAVFCNGFGSIDVLEIRDVPIPEPKENQVLIKVMATSINRPDLVQREGKYPPPPGESEI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
           LGLEVAG I  +G N   W +GD V +LV GGGYAEY +++  H + IP+  +  +AA +
Sbjct: 61  LGLEVAGVIEKIGPNVEGWKVGDRVMSLVGGGGYAEYAVAYANHLIKIPESMSFEEAACV 120

Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG-ATVYTTAKSEEKCLA 185
            ES+ T + N+F    L+ G+T L+HGG  G+ T AIQL       +      + EK   
Sbjct: 121 CESYITAFLNVFMLGELKDGETTLLHGGGGGVNTAAIQLVKALAPKSKIAVTVAPEKMEG 180

Query: 186 CLKLGAKHAINYLKE--DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
             KLGA   INY KE  DF +I+++ T  +G+D+ILD VGA+YL+ ++  L+  G+L+II
Sbjct: 181 VRKLGADLLINY-KETTDFSDIIKEFTNKKGVDVILDHVGAKYLDPNIKSLAYAGRLVII 239

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             + G I  E+N+  ++ KR  I GS LR R    K  I         P      I P+I
Sbjct: 240 GVISG-IKAELNIGLLMVKRHKIIGSVLRSRPVNEKGEIIKEFTKVAIPKFADRTIVPII 298

Query: 304 HTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             V  L +V  AH +ME   H GKI+L
Sbjct: 299 SKVFTLDEVKDAHKMMEDDLHFGKIVL 325


>gi|311112312|ref|YP_003983534.1| NADPH:quinone reductase [Rothia dentocariosa ATCC 17931]
 gi|310943806|gb|ADP40100.1| possible NADPH:quinone reductase [Rothia dentocariosa ATCC 17931]
          Length = 353

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 127/335 (37%), Positives = 192/335 (57%), Gaps = 13/335 (3%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           MR +    +G   V+ L+E PIP P   ++L++V A G+NR D +QR+G YPPP  A+ +
Sbjct: 18  MRAIVEKEHGDPEVLTLSEVPIPAPAPGQVLVRVHAAGLNRADSLQRRGHYPPPAGASSV 77

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126
            GLE+AG +  +GE      +G+ V AL+ GGGYAEY      HTLPIP G + ++AA +
Sbjct: 78  YGLEIAGVVEAVGEGVDPALVGERVMALLAGGGYAEYAAVDVRHTLPIPNGMSMVEAACI 137

Query: 127 PESFFTVWANLF----------QTANLRSGQT-VLIHGGSSGIGTTAIQLASYFGATVYT 175
           PE   TV++NL           Q       QT +L+HGG+ G+G  AIQLA   G  V+ 
Sbjct: 138 PEVAATVYSNLVLLCGMSLDPAQNNPAEDEQTSLLVHGGAGGVGMHAIQLARAAGVRVFA 197

Query: 176 TAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLS 235
           T   +EK      LGA H INY  E F +++Q+E+ G G++ ILD++GA+YL  +L  L+
Sbjct: 198 TVGDDEKAQVVRALGA-HPINYRTESFRQVIQRESAGHGVNYILDVMGAKYLEDNLRSLA 256

Query: 236 KEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLN 295
             G L  I+  GG  A E++L  +++KR+++ G++LR R+   K  I   +   + PLL 
Sbjct: 257 DGGHLATIAVQGGRRA-ELDLGLMLTKRLSVHGTSLRSRSADEKAKIMAGVHENVLPLLE 315

Query: 296 SHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
             V++       P  + A AH+  +  +H GK++L
Sbjct: 316 RGVLSANFDREFPWWQAAQAHEYFDAGQHRGKVVL 350


>gi|296141759|ref|YP_003649002.1| NAD(P)H quinone oxidoreductase, PIG3 family [Tsukamurella
           paurometabola DSM 20162]
 gi|296029893|gb|ADG80663.1| NAD(P)H quinone oxidoreductase, PIG3 family [Tsukamurella
           paurometabola DSM 20162]
          Length = 325

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 134/308 (43%), Positives = 191/308 (62%), Gaps = 9/308 (2%)

Query: 27  PIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWN 86
           P P+P   E+ IKV A  VNR D+MQR+GLYPPP  A+ ILGLEV+G +  +GE  T   
Sbjct: 19  PTPEPGPGEVRIKVAAAAVNRADLMQRRGLYPPPPGASHILGLEVSGIVDSVGEGVTALK 78

Query: 87  IGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSG 146
            GDEVCAL+ GGGYAEY +      LPIP G + + AA+LPE   TV++N+   A L++G
Sbjct: 79  PGDEVCALLAGGGYAEYAVVAATQCLPIPAGVSLVDAAALPEVSCTVYSNVVTEAGLKAG 138

Query: 147 QTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEIL 206
           +T+L+HGG SGIGT  IQL    GATV  T  SE K   C +LGA   INY ++DF E+L
Sbjct: 139 ETLLLHGGGSGIGTHGIQLGKALGATVAVTVGSEYKAQRCRELGADIVINYREQDFAEVL 198

Query: 207 QKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITI 266
             +      D+ILD++GA+YL  ++  L+  G+L+II   GG   T +N+  +++KR  +
Sbjct: 199 DGKA-----DVILDIMGAKYLPGNVRALAPHGRLVIIGMQGGTEGT-LNIAALLAKRGRV 252

Query: 267 TGSTLRRRTDI---AKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSE 323
           + + LR R      +K ++ D +   +WPL+ +  + PVI   LP   V  AH +++  E
Sbjct: 253 SATNLRGRPATGPNSKAAVVDGVVEHVWPLIAAGKVKPVISARLPYTDVEQAHALLDSPE 312

Query: 324 HIGKIILL 331
            IGK++L+
Sbjct: 313 SIGKVLLV 320


>gi|331694099|ref|YP_004330338.1| NAD(P)H quinone oxidoreductase, PIG3 family [Pseudonocardia
           dioxanivorans CB1190]
 gi|326948788|gb|AEA22485.1| NAD(P)H quinone oxidoreductase, PIG3 family [Pseudonocardia
           dioxanivorans CB1190]
          Length = 339

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 133/327 (40%), Positives = 191/327 (58%), Gaps = 5/327 (1%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVE