RPSBLAST alignment for GI: 254780290 and conserved domain: TIGR02818

>gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase. The members of this protein family show dual function. First, they remove formaldehyde, a toxic metabolite, by acting as S-(hydroxymethyl)glutathione dehydrogenase (1.1.1.284). S-(hydroxymethyl)glutathione can form spontaneously from formaldehyde and glutathione, and so this enzyme previously was designated glutathione-dependent formaldehyde dehydrogenase. These same proteins are also designated alcohol dehydrogenase (EC 1.1.1.1) of class III, for activities that do not require glutathione; they tend to show poor activity for ethanol among their various substrate alcohols. Length = 368
 Score = 42.1 bits (99), Expect = 2e-04
 Identities = 89/361 (24%), Positives = 139/361 (38%), Gaps = 84/361 (23%)

Query: 31  PQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP-ILGLEVAGKIVDLGENTTHWNIGD 89
           PQK E+L+++ A GV   D     G    P+   P ILG E AG +  +GE  T   +GD
Sbjct: 24  PQKGEVLVRIVATGVCHTDAFTLSG--ADPEGVFPVILGHEGAGIVEAVGEGVTSVKVGD 81

Query: 90  EVCALVNGG-GYAEYCLS-----------HQGHTLPIPKG-----------YNAIQAASL 126
            V  L     G  ++CLS            QG  L +P G           Y+ +  ++ 
Sbjct: 82  HVIPLYTAECGECKFCLSGKTNLCVAVRETQGKGL-MPDGTSRFSKDGQPIYHYMGCSTF 140

Query: 127 PESFFTVWANL----------------------------FQTANLRSGQTVLIHGGSSGI 158
            E  +TV   +                              TA +  G TV +  G  GI
Sbjct: 141 SE--YTVVPEISLAKINPAAPLEEVCLLGCGVTTGIGAVLNTAKVEEGDTVAVF-GLGGI 197

Query: 159 GTTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHAINYLKED--FLEILQKETQGRGI 215
           G + IQ A    A+ +     +  K     KLGA   +N    D    E++ + T G G+
Sbjct: 198 GLSVIQGARMAKASRIIAIDINPAKFELAKKLGATDCVNPNDYDKPIQEVIVEITDG-GV 256

Query: 216 DIILDMVG-AEYLNQHLTLLSKE-GKLIIISFLGGNIATEINLNP--IISKRITITGST- 270
           D   + +G    +   L    K  G+ III   G     EI+  P  +++ R+   GS  
Sbjct: 257 DYSFECIGNVNVMRAALECCHKGWGESIIIGVAGA--GQEISTRPFQLVTGRVW-RGSAF 313

Query: 271 --LRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKI 328
             ++ RT++    +   ++ +I        +   +   +PL  +  A D+M    H GK 
Sbjct: 314 GGVKGRTELP-GIVEQYMKGEI-------ALDDFVTHTMPLEDINEAFDLM----HEGKS 361

Query: 329 I 329
           I
Sbjct: 362 I 362