RPSBLAST alignment for GI: 254780290 and conserved domain: pfam00107

>gnl|CDD|143884 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase. Length = 131
 Score = 93.5 bits (233), Expect = 7e-20
 Identities = 48/125 (38%), Positives = 70/125 (56%), Gaps = 3/125 (2%)

Query: 157 GIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGI 215
           G+G  A+QLA   GA  V    +SEEK     +LGA H INY  EDF+E +++ T GRG+
Sbjct: 1   GVGLAAVQLAKALGAARVIAVDRSEEKLELAKELGADHVINYRDEDFVERVRELTGGRGV 60

Query: 216 DIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR 274
           D+++D VGA   L Q L LL   G+++++   GG       L  ++ K +TI GS    R
Sbjct: 61  DVVIDCVGAPATLEQALELLRPGGRVVVVGLPGGAP-VPFPLRDLLLKELTILGSLGGGR 119

Query: 275 TDIAK 279
            +  +
Sbjct: 120 EEFEE 124