RPSBLAST alignment for GI: 254780290 and conserved domain: cd08232

>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase. L-idonate 5-dehydrogenase (L-ido 5-DH ) catalyzes the conversion of L-lodonate to 5-ketogluconate in the metabolism of L-Idonate to 6-P-gluconate. In E. coli, this GntII pathway is a subsidiary pathway to the canonical GntI system, which also phosphorylates and transports gluconate. L-ido 5-DH is found in an operon with a regulator indR, transporter idnT, 5-keto-D-gluconate 5-reductase, and Gnt kinase. L-ido 5-DH is a zinc-dependent alcohol dehydrogenase-like protein. The alcohol dehydrogenase ADH-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH. This group is also called the medium chain dehydrogenases/reductase family (MDR) which displays a broad range of activities and are distinguished from the smaller short chain dehydrogenases(~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal GroES-like catalytic domain. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 339
 Score = 56.5 bits (137), Expect = 1e-08
 Identities = 82/350 (23%), Positives = 139/350 (39%), Gaps = 65/350 (18%)

Query: 23  LAESPIPQPQKEEILIKVEAIGVNRPDV-MQRKGLYPPPKNANP-ILGLEVAGKIVDLGE 80
           + E P P+P   E+ ++V A G+   D+   + G +   +   P +LG EV+G +  +G 
Sbjct: 11  VEERPAPEPGPGEVRVRVAAGGICGSDLHYYQHGGFGTVRLREPMVLGHEVSGVVEAVGP 70

Query: 81  NTTHWNIGDEVCALVNG---GGYAEYCLSHQ----------G------HT---------- 111
             T    G  V   VN     G  +YC + +          G      H           
Sbjct: 71  GVTGLAPGQRVA--VNPSRPCGTCDYCRAGRPNLCLNMRFLGSAMRFPHVQGGFREYLVV 128

Query: 112 -----LPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSG-IGTTAIQL 165
                +P+P G  +++ A+L E        + +  +L  G+ VL+ G  +G IG   +  
Sbjct: 129 DASQCVPLPDGL-SLRRAALAEPLAVALHAVNRAGDLA-GKRVLVTG--AGPIGALVVAA 184

Query: 166 ASYFGATVYTTAKSEEKCLA-CLKLGAKHAINYLKEDFLEILQKETQGRG-IDIILDMVG 223
           A   GA         +  LA    +GA   +N L  D L         +G  D++ +  G
Sbjct: 185 ARRAGAAEIVATDLADAPLAVARAMGADETVN-LARDPLAAYA---ADKGDFDVVFEASG 240

Query: 224 AEY-LNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSI 282
           A   L   L ++   G ++ +  LGG     + LN +++K + + GS  R   + A +++
Sbjct: 241 APAALASALRVVRPGGTVVQVGMLGG--PVPLPLNALVAKELDLRGS-FRFDDEFA-EAV 296

Query: 283 RDSLQLKIWPLLNSHVI--APVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
           R         LL +  I   P+I  V PL + A A  +        K+ L
Sbjct: 297 R---------LLAAGRIDVRPLITAVFPLEEAAEAFALAADRTRSVKVQL 337