RPSBLAST alignment for GI: 254780290 and conserved domain: cd08247

>gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast. This group contains members identified in targeting of yeast membrane proteins ATPase. AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast, identified as a multicopy suppressor of pma1 mutants which cause temperature sensitive growth arrest due to the inability of ATPase to target to the cell surface. This family is homologous to the medium chain family of dehydrogenases and reductases. Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 352
 Score = 88.9 bits (221), Expect = 2e-18
 Identities = 65/221 (29%), Positives = 94/221 (42%), Gaps = 27/221 (12%)

Query: 25  ESPIP-QPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI-LGLEVAGKIVDLGENT 82
           + P+P   +  EI++KV A  +N  D+      Y          LG + +G IV +G N 
Sbjct: 19  KLPLPNCYKDNEIVVKVHAAALNPVDLKLYNS-YTFHFKVKEKGLGRDYSGVIVKVGSNV 77

Query: 83  -THWNIGDEVCAL---VNG--GGYAEYCL-----SHQGHTLPIPKGYNAIQAASLPESFF 131
            + W +GDEVC +     G  G  ++Y L       +  T   P+  +  +AA+ P    
Sbjct: 78  ASEWKVGDEVCGIYPHPYGGQGTLSQYLLVDPKKDKKSIT-RKPENISLEEAAAWPLVLG 136

Query: 132 TVWANLFQT-ANLRSGQTVLIHGGSSGIGTTAIQLASYFGA--TVYTTA--KSEEKCLAC 186
           T +  L      L     VL+ GGS+ +G  AIQLA       TV  T   +S E     
Sbjct: 137 TAYQILEDLGQKLGPDSKVLVLGGSTSVGRFAIQLAKNHYNIGTVVGTCSSRSAEL---N 193

Query: 187 LKLGAKHAINYLKED----FLEILQKETQGRGIDIILDMVG 223
            KLGA H I+Y           +L+        D+ILD VG
Sbjct: 194 KKLGADHFIDYDAHSGVKLLKPVLENVKGQGKFDLILDCVG 234