RPSBLAST alignment for GI: 254780290 and conserved domain: cd08252

>gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members. This group contains a structure identified as an arginate lyase. Other members are identified quinone reductases, alginate lyases, and other proteins related to the zinc-dependent dehydrogenases/reductases. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 336
 Score =  116 bits (294), Expect = 7e-27
 Identities = 96/346 (27%), Positives = 157/346 (45%), Gaps = 33/346 (9%)

Query: 7   MRHVAMSGYGKS---NVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNA 63
           M+ +  +        + +   E P P P   ++L++VEA+ VN  D   R G  P P   
Sbjct: 1   MKAIGFTQPLPITDPDSLIDIELPKPVPGGRDLLVRVEAVSVNPVDTKVRAGGAPVPGQP 60

Query: 64  NPILGLEVAGKIVDLGENTTHWNIGDEVC---ALVNGGGYAEYCLSHQGHTLPIPKGYNA 120
             ILG + +G +  +G   T + +GDEV     +   G  AEY L  +      PK  + 
Sbjct: 61  K-ILGWDASGVVEAVGSEVTLFKVGDEVYYAGDITRPGSNAEYQLVDERIVGHKPKSLSF 119

Query: 121 IQAASLPESFFTVWANLF-----QTANLRSGQTVLIHGGSSGIGTTAIQLAS-YFGATVY 174
            +AA+LP +  T W  LF            G+T+LI GG+ G+G+ AIQLA    G TV 
Sbjct: 120 AEAAALPLTSLTAWEALFDRLGISEDAENEGKTLLIIGGAGGVGSIAIQLAKQLTGLTVI 179

Query: 175 TTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRG-IDIILDMVG-AEYLNQHLT 232
            TA   E      +LGA H IN+  +D  E  Q E  G   +D I  +    ++ +    
Sbjct: 180 ATASRPESIAWVKELGADHVINH-HQDLAE--QLEALGIEPVDYIFCLTDTDQHWDAMAE 236

Query: 233 LLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR-----TDIAKQSIRDSLQ 287
           L++ +G + +I     +    ++L P+ SK  +     +  R      D+ +Q   + L 
Sbjct: 237 LIAPQGHICLIV----DPQEPLDLGPLKSKSASFHWEFMFTRSMFQTPDMIEQ--HEILN 290

Query: 288 LKIWPLLNSHVIAPVIHTVL-PLG--KVAMAHDIMEKSEHIGKIIL 330
            ++  LL++  +   +   L P+    +  AH ++E  + IGKI+L
Sbjct: 291 -EVADLLDAGKLKTTLTETLGPINAENLREAHALLESGKTIGKIVL 335