RPSBLAST alignment for GI: 254780290 and conserved domain: cd08271

>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 325
 Score =  174 bits (443), Expect = 3e-44
 Identities = 82/240 (34%), Positives = 123/240 (51%), Gaps = 5/240 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+   +   G +  + L E  IP P   E+L+KV A G+N  D        P     + +
Sbjct: 1   MKAWVLPKPGAALQLTLEEIEIPGPGAGEVLVKVHAAGLNPVDWKVIAWGPPAWSYPH-V 59

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVC---ALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
            G++ AG +V +G   T W +GD V    +L  GG +AEY +      LP+P   +  +A
Sbjct: 60  PGVDGAGVVVAVGAKVTGWKVGDRVAYHASLARGGSFAEYTVVDARAVLPLPDSLSFEEA 119

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A+LP +  T +  LF+   + +G+T+LI GG+ G+G+ A+QLA   G  V TT  S+   
Sbjct: 120 AALPCAGLTAYQALFKKLRIEAGRTILITGGAGGVGSFAVQLAKRAGLRVITTC-SKRNF 178

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
                LGA H I+Y  ED  E +++ T GRG+D +LD VG E        L+  G L+ I
Sbjct: 179 EYVKSLGADHVIDYNDEDVCERIKEITGGRGVDAVLDTVGGETAAALAPTLAFNGHLVCI 238