RPSBLAST alignment for GI: 254780290 and conserved domain: cd08293

>gnl|CDD|176253 cd08293, PTGR2, Prostaglandin reductase. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 345
 Score = 52.8 bits (127), Expect = 1e-07
 Identities = 31/108 (28%), Positives = 52/108 (48%), Gaps = 7/108 (6%)

Query: 147 QTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLK-LGAKHAINYLKEDFLE 204
           QT+++ G +   G+ A Q+    G + V     S+EKC      LG   AINY  ++  E
Sbjct: 156 QTMVVSGAAGACGSLAGQIGRLLGCSRVVGICGSDEKCQLLKSELGFDAAINYKTDNVAE 215

Query: 205 ILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252
            L +E    G+D+  D VG E  +  ++ +++   +I    L G I+ 
Sbjct: 216 RL-RELCPEGVDVYFDNVGGEISDTVISQMNENSHII----LCGQISQ 258