RPSBLAST alignment for GI: 254780290 and conserved domain: PLN03154

>gnl|CDD|178699 PLN03154, PLN03154, putative allyl alcohol dehydrogenase; Provisional. Length = 348
 Score = 59.1 bits (143), Expect = 1e-09
 Identities = 63/229 (27%), Positives = 96/229 (41%), Gaps = 32/229 (13%)

Query: 58  PPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKG 117
           PP      I G  V+ K+VD   +  ++  GD +  +    G+ EY L        I   
Sbjct: 72  PPFVPGQRIEGFGVS-KVVD--SDDPNFKPGDLISGIT---GWEEYSL--------IRSS 117

Query: 118 YNAIQAASL----PESF---------FTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQ 164
            N ++   L    P S+         FT +A  ++  + + G +V +   S  +G    Q
Sbjct: 118 DNQLRKIQLQDDIPLSYHLGLLGMAGFTAYAGFYEVCSPKKGDSVFVSAASGAVGQLVGQ 177

Query: 165 LASYFGATVYTTAKSEEKC-LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG 223
           LA   G  V  +A S +K  L   KLG   A NY +E  L+   K     GIDI  D VG
Sbjct: 178 LAKLHGCYVVGSAGSSQKVDLLKNKLGFDEAFNYKEEPDLDAALKRYFPEGIDIYFDNVG 237

Query: 224 AEYLNQHLTLLSKEGKLIIISFLGGNIATEI----NLNPIISKRITITG 268
            + L+  L  +   G++ +   +  N  +      NL  +ISKRI + G
Sbjct: 238 GDMLDAALLNMKIHGRIAVCGMVSLNSLSASQGIHNLYNLISKRIRMQG 286