RPSBLAST alignment for GI: 254780290 and conserved domain: PRK05396

>gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated. Length = 341
 Score = 82.6 bits (205), Expect = 1e-16
 Identities = 94/350 (26%), Positives = 152/350 (43%), Gaps = 68/350 (19%)

Query: 23  LAESPIPQPQKEEILIKVEAIGVNRPDVMQRK------GLYPPPKNANPILGLEVAGKIV 76
           L + P+P+P   ++LIKV+   +   DV             P P     ++G E  G++V
Sbjct: 15  LTDVPVPEPGPNDVLIKVKKTAICGTDVHIYNWDEWAQKTIPVPM----VVGHEFVGEVV 70

Query: 77  DLGENTTHWNIGDEVCA---LVNGGGYAEYCLSHQGH----TLPIPKGYNAIQA----AS 125
           ++G   T + +GD V     +V   G+   C + + H    T  +  G N   A      
Sbjct: 71  EVGSEVTGFKVGDRVSGEGHIV--CGHCRNCRAGRRHLCRNTKGV--GVNRPGAFAEYLV 126

Query: 126 LPESFFTVW----------ANLFQ-------TA---NLRSGQTVLIHGGSSG-IGTTAIQ 164
           +P   F VW          A +F        TA   +L  G+ VLI G  +G IG  A  
Sbjct: 127 IPA--FNVWKIPDDIPDDLAAIFDPFGNAVHTALSFDL-VGEDVLITG--AGPIGIMAAA 181

Query: 165 LASYFGAT-VYTTAKSEEKC-LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMV 222
           +A + GA  V  T  +E +  LA  K+GA  A+N  KED  +++ +     G D+ L+M 
Sbjct: 182 VAKHVGARHVVITDVNEYRLELA-RKMGATRAVNVAKEDLRDVMAELGMTEGFDVGLEMS 240

Query: 223 GA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQS 281
           GA     Q L  ++  G++ ++    G++A  I+ N +I K +TI G   R   +   + 
Sbjct: 241 GAPSAFRQMLDNMNHGGRIAMLGIPPGDMA--IDWNKVIFKGLTIKGIYGREMFETWYKM 298

Query: 282 IRDSLQLKIWPLLNSHV-IAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330
                      LL S + ++P+I    P+       + M +S   GK+IL
Sbjct: 299 SA---------LLQSGLDLSPIITHRFPIDDFQKGFEAM-RSGQSGKVIL 338