RPSBLAST alignment for GI: 254780290 and conserved domain: PRK10754

>gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional. Length = 327
 Score =  102 bits (255), Expect = 2e-22
 Identities = 77/262 (29%), Positives = 122/262 (46%), Gaps = 27/262 (10%)

Query: 8   RHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPIL 67
           + +    +G   V+   E     P + E+ ++ +AIG+N  D   R GLYPPP   +  L
Sbjct: 3   KRIEFHKHGGPEVLQAVEFTPADPAENEVQVENKAIGINYIDTYIRSGLYPPPSLPSG-L 61

Query: 68  GLEVAGKIVDLGENTTHWNIGDEVC-ALVNGGGYAEYCLSHQGHTLP------IPKGYNA 120
           G E AG +  +G    H  +GD V  A    G Y+        H +P      +P   + 
Sbjct: 62  GTEAAGVVSKVGSGVKHIKVGDRVVYAQSALGAYSSV------HNVPADKAAILPDAISF 115

Query: 121 IQAASLPESFF---TVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTA 177
            QAA+   SF    TV+  L +T  ++  +  L H  + G+G  A Q A   GA +  T 
Sbjct: 116 EQAAA---SFLKGLTVYYLLRKTYEIKPDEQFLFHAAAGGVGLIACQWAKALGAKLIGTV 172

Query: 178 KSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKE 237
            S +K     K GA   INY +E+ +E +++ T G+ + ++ D VG +     L  L + 
Sbjct: 173 GSAQKAQRAKKAGAWQVINYREENIVERVKEITGGKKVRVVYDSVGKDTWEASLDCLQRR 232

Query: 238 GKLIIISFLGGNIA---TEINL 256
           G  +++SF  GN +   T +NL
Sbjct: 233 G--LMVSF--GNASGPVTGVNL 250