RPSBLAST alignment for GI: 254780290 and conserved domain: COG0604

>gnl|CDD|30949 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]. Length = 326
 Score =  284 bits (727), Expect = 3e-77
 Identities = 124/330 (37%), Positives = 183/330 (55%), Gaps = 8/330 (2%)

Query: 7   MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66
           M+ V +  +G   V+ + E P P+P   E+L++V+A GVN  DV+ R+GL PP +    I
Sbjct: 1   MKAVVVEEFGGPEVLKVVEVPEPEPGPGEVLVRVKAAGVNPIDVLVRQGLAPPVRPLPFI 60

Query: 67  LGLEVAGKIVDLGENTTHWNIGDEVCALV---NGGGYAEYCLSHQGHTLPIPKGYNAIQA 123
            G E AG +V +G   T + +GD V AL      GGYAEY +      +P+P G +  +A
Sbjct: 61  PGSEAAGVVVAVGSGVTGFKVGDRVAALGGVGRDGGYAEYVVVPADWLVPLPDGLSFEEA 120

Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183
           A+LP +  T W  LF  A L+ G+TVL+HG + G+G+ AIQLA   GATV     S EK 
Sbjct: 121 AALPLAGLTAWLALFDRAGLKPGETVLVHGAAGGVGSAAIQLAKALGATVVAVVSSSEKL 180

Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243
               +LGA H INY +EDF+E +++ T G+G+D++LD VG +     L  L+  G+L+ I
Sbjct: 181 ELLKELGADHVINYREEDFVEQVRELTGGKGVDVVLDTVGGDTFAASLAALAPGGRLVSI 240

Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303
             L G     +NL P++ KR+T+ G TL  R   A          +++ LL S  + PVI
Sbjct: 241 GALSGGPPVPLNLLPLLGKRLTLRGVTLGSRDPEALAEALA----ELFDLLASGKLKPVI 296

Query: 304 HTVLPLGKVAMA-HDIMEKSEHIGKIILLP 332
             V PL +   A   ++ +    GK++L  
Sbjct: 297 DRVYPLAEAPAAAAHLLLERRTTGKVVLKV 326