RPSBLAST alignment for GI: 254780290 and conserved domain: KOG0025

>gnl|CDD|35248 KOG0025, KOG0025, KOG0025, Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription, Energy production and conversion]. Length = 354
 Score = 70.7 bits (173), Expect = 5e-13
 Identities = 74/344 (21%), Positives = 136/344 (39%), Gaps = 18/344 (5%)

Query: 1   MPICKKMRHVAMSGYGK-SNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYP- 58
             +  + + +  S +G  + V+ L    +P     ++L+K+ A  +N  D+ Q +G+YP 
Sbjct: 14  SQMPARSKALVYSEHGDPAKVLQLKNLELPAVPGSDVLVKMLAAPINPSDINQIQGVYPV 73

Query: 59  -PPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCAL-VNGGGYAEYCLSHQGHTLPIPK 116
            P   A  + G E  G++V +G N   +  GD V  L  N G +    +  +   + + K
Sbjct: 74  RPELPA--VGGNEGVGEVVAVGSNVKGFKPGDWVIPLSANLGTWRTEAVFSESDLIKVDK 131

Query: 117 GYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG----AT 172
                 AA+L  +  T +  L     L  G +V+ +G +SG+G   IQLA   G      
Sbjct: 132 DIPLASAATLSVNPCTAYRMLKDFVQLNKGDSVIQNGANSGVGQAVIQLAKALGIKTINV 191

Query: 173 VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLT 232
           V      EE       LGA   I   +    ++ + +       + L+ VG +   +   
Sbjct: 192 VRDRPNIEELKKQLKSLGATEVITEEELRDRKMKKFKGDNPRPRLALNCVGGKSATEIAR 251

Query: 233 LLSKEGKLIIISFLGG--NIATEINLNPIISKRITITGSTLRRRTDIAKQS-IRDSLQLK 289
            L + G ++     GG       +  + +I K + + G  + R     K    R  +  +
Sbjct: 252 YLERGGTMVT---YGGMSKQPVTVPTSLLIFKDLKLRGFWVTRWKKEHKSPEERKEMIDE 308

Query: 290 IWPLLNSHVIAPVIHTVLPLGKVAMAHD--IMEKSEHIGKIILL 331
           +  L     +       +PL     A D  + +  +   +II+L
Sbjct: 309 LCDLYRRGKLKAPNCEKVPLADHKTALDAALSKFGKSGKQIIVL 352