RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780290|ref|YP_003064703.1| quinone oxidoreductase [Candidatus Liberibacter asiaticus str. psy62] (332 letters) >gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 323 Score = 506 bits (1305), Expect = e-144 Identities = 169/324 (52%), Positives = 223/324 (68%), Gaps = 1/324 (0%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 M+ + + G V+ L E P P P E+LI+V A GVNR D++QR+GLYPPP A+ I Sbjct: 1 MKAIVIKEPGGPEVLELGEVPKPAPGPGEVLIRVAAAGVNRADLLQRQGLYPPPPGASDI 60 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126 LGLEVAG +V +G T W +GD VCAL+ GGGYAEY + G LP+P+G + ++AA+L Sbjct: 61 LGLEVAGVVVAVGPGVTGWKVGDRVCALLAGGGYAEYVVVPAGQLLPVPEGLSLVEAAAL 120 Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186 PE FFT W NLFQ L++G+TVLIHGG+SG+GT AIQLA GA V TA SEEK AC Sbjct: 121 PEVFFTAWQNLFQLGGLKAGETVLIHGGASGVGTAAIQLAKALGARVIATAGSEEKLEAC 180 Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246 LGA AINY EDF E +++ T GRG+D+ILDMVG +YL ++L L+ +G+L++I L Sbjct: 181 RALGADVAINYRTEDFAEEVKEATGGRGVDVILDMVGGDYLARNLRALAPDGRLVLIGLL 240 Query: 247 GGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTV 306 GG A E++L P++ KR+T+TGSTLR R+ K ++ + + +WPL S I PVI V Sbjct: 241 GGAKA-ELDLAPLLRKRLTLTGSTLRSRSLEEKAALAAAFREHVWPLFASGRIRPVIDKV 299 Query: 307 LPLGKVAMAHDIMEKSEHIGKIIL 330 PL + A AH ME +EHIGKI+L Sbjct: 300 FPLEEAAEAHRRMESNEHIGKIVL 323 >gnl|CDD|30949 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]. Length = 326 Score = 284 bits (727), Expect = 3e-77 Identities = 124/330 (37%), Positives = 183/330 (55%), Gaps = 8/330 (2%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 M+ V + +G V+ + E P P+P E+L++V+A GVN DV+ R+GL PP + I Sbjct: 1 MKAVVVEEFGGPEVLKVVEVPEPEPGPGEVLVRVKAAGVNPIDVLVRQGLAPPVRPLPFI 60 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVCALV---NGGGYAEYCLSHQGHTLPIPKGYNAIQA 123 G E AG +V +G T + +GD V AL GGYAEY + +P+P G + +A Sbjct: 61 PGSEAAGVVVAVGSGVTGFKVGDRVAALGGVGRDGGYAEYVVVPADWLVPLPDGLSFEEA 120 Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183 A+LP + T W LF A L+ G+TVL+HG + G+G+ AIQLA GATV S EK Sbjct: 121 AALPLAGLTAWLALFDRAGLKPGETVLVHGAAGGVGSAAIQLAKALGATVVAVVSSSEKL 180 Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243 +LGA H INY +EDF+E +++ T G+G+D++LD VG + L L+ G+L+ I Sbjct: 181 ELLKELGADHVINYREEDFVEQVRELTGGKGVDVVLDTVGGDTFAASLAALAPGGRLVSI 240 Query: 244 SFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVI 303 L G +NL P++ KR+T+ G TL R A +++ LL S + PVI Sbjct: 241 GALSGGPPVPLNLLPLLGKRLTLRGVTLGSRDPEALAEALA----ELFDLLASGKLKPVI 296 Query: 304 HTVLPLGKVAMA-HDIMEKSEHIGKIILLP 332 V PL + A ++ + GK++L Sbjct: 297 DRVYPLAEAPAAAAHLLLERRTTGKVVLKV 326 >gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 323 Score = 251 bits (644), Expect = 2e-67 Identities = 113/333 (33%), Positives = 172/333 (51%), Gaps = 20/333 (6%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKE-EILIKVEAIGVNRPDVMQRKGLY---PPPKN 62 M+ V G + L E P P+P E+ I+VEA GVN PD++ +G Y PP Sbjct: 1 MKAVVCKELGGPEDLVLEEVP-PEPGAPGEVRIRVEAAGVNFPDLLMIQGKYQVKPPL-- 57 Query: 63 ANP-ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAI 121 P + G EVAG + +GE T + +GD V AL GG+AE + P+P G + Sbjct: 58 --PFVPGSEVAGVVEAVGEGVTGFKVGDRVVALTGQGGFAEEVVVPAAAVFPLPDGLSFE 115 Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181 +AA+LP ++ T + L + A L+ G+TVL+ G + G+G A+QLA GA V A SEE Sbjct: 116 EAAALPVTYGTAYHALVRRARLQPGETVLVLGAAGGVGLAAVQLAKALGARVIAAASSEE 175 Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241 K LGA H I+Y D E ++ T GRG+D++ D VG + L L+ G+L+ Sbjct: 176 KLALARALGADHVIDYRDPDLRERVKALTGGRGVDVVYDPVGGDVFEASLRSLAWGGRLL 235 Query: 242 IISFLGGNIATEINLNPIISKRITITG----STLRRRTDIAKQSIRDSLQLKIWPLLNSH 297 +I F G I I N ++ K I++ G + RR ++ + ++ + ++ LL Sbjct: 236 VIGFASGEIPQ-IPANLLLLKNISVVGVYWGAYARREPELLRANLAE-----LFDLLAEG 289 Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330 I P + V PL + A A + + GK++L Sbjct: 290 KIRPHVSAVFPLEQAAEALRALADRKATGKVVL 322 >gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family. This group contains proteins related to the zinc-dependent alcohol dehydrogenases. However, while the group has structural zinc site characteristic of these enzymes, it lacks the consensus site for a catalytic zinc. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 342 Score = 248 bits (635), Expect = 2e-66 Identities = 114/355 (32%), Positives = 180/355 (50%), Gaps = 42/355 (11%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 M+ V + G+G V+ + P P+P +E+L++V+A +N D+ R+G+ I Sbjct: 1 MKAVVIRGHGGPEVLEYGDLPEPEPGPDEVLVRVKAAALNHLDLWVRRGMPGIKLPLPHI 60 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVCALVNGG---GYAEYCLS--------------HQG 109 LG + AG + +G T+ G V ++ G G EYCL+ H Sbjct: 61 LGSDGAGVVEAVGPGVTNVKPGQRV--VIYPGISCGRCEYCLAGRENLCAQYGILGEHVD 118 Query: 110 HT------------LPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSG 157 LPIP + +AA+ P +F T W L A LR G+TVL+HG SG Sbjct: 119 GGYAEYVAVPARNLLPIPDNLSFEEAAAAPLTFLTAWHMLVTRARLRPGETVLVHGAGSG 178 Query: 158 IGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDI 217 +G+ AIQ+A FGATV TA SE+K +LGA + I+Y KEDF+ +++ T RG+D+ Sbjct: 179 VGSAAIQIAKLFGATVIATAGSEDKLERAKELGADYVIDYRKEDFVREVRELTGKRGVDV 238 Query: 218 ILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDI 277 +++ VGA + L L++ G+L+ G A I+L + ++++I GST+ + ++ Sbjct: 239 VVEHVGAATWEKSLKSLARGGRLVTCGATTGYEA-PIDLRHVFWRQLSILGSTMGTKAEL 297 Query: 278 AKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332 + L+ + PVI +V PL + A AH +E E GKI+L P Sbjct: 298 D----------EALRLVFRGKLKPVIDSVFPLEEAAEAHRRLESREQFGKIVLTP 342 >gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 328 Score = 232 bits (594), Expect = 9e-62 Identities = 115/340 (33%), Positives = 164/340 (48%), Gaps = 26/340 (7%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 MR V +G V+ + E P+P P E+LI+VEAIG+NR D M R+G Y P Sbjct: 1 MRAVRFHQFGGPEVLRIEELPVPAPGAGEVLIRVEAIGLNRADAMFRRGAYIEPPPLPAR 60 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVCA-----LVNGGGYAEYCLSHQGHTLPIPKGYNAI 121 LG E AG + +G T + +GD V L G YAEY L + +P G + + Sbjct: 61 LGYEAAGVVEAVGAGVTGFAVGDRVSVIPAADLGQYGTYAEYALVPAAAVVKLPDGLSFV 120 Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181 +AA+L + T + L + A LR G +VLI SS +G AIQ+A+ GATV T ++ E Sbjct: 121 EAAALWMQYLTAYGALVELAGLRPGDSVLITAASSSVGLAAIQIANAAGATVIATTRTSE 180 Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241 K A L LGA H I +ED + + + T G+G+D++ D VG + L+ G L+ Sbjct: 181 KRDALLALGAAHVIVTDEEDLVAEVLRITGGKGVDVVFDPVGGPQFAKLADALAPGGTLV 240 Query: 242 IISFLGGNIATEINLNPIISKRITITGSTL---------RRRTDIAKQSIRDSLQLKIWP 292 + L G + K +T G +L RRR A I D Sbjct: 241 VYGALSGEPTPFPLKAA-LKKSLTFRGYSLDEITLDPEARRR---AIAFILD-------- 288 Query: 293 LLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332 L S + PV+ V P + AH +E + IGKI++ P Sbjct: 289 GLASGALKPVVDRVFPFDDIVEAHRYLESGQQIGKIVVTP 328 >gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR). Zeta-crystallin is a eye lens protein with NADP-dependent quinone reductase activity (QOR). It has been cited as a structural component in mammalian eyes, but also has homology to quinone reductases in unrelated species. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 325 Score = 222 bits (568), Expect = 1e-58 Identities = 103/332 (31%), Positives = 164/332 (49%), Gaps = 13/332 (3%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 MR + +G +V+ L + P+P P E+L++V A GVN D R G YP + Sbjct: 1 MRAIRYHEFGAPDVLRLGDLPVPTPGPGEVLVRVHASGVNPVDTYIRAGAYPGLPPLPYV 60 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVCALVNG------GGYAEYCLSHQGHTLPIPKGYNA 120 G + AG + +GE +GD V L N G AEY + +P+P G + Sbjct: 61 PGSDGAGVVEAVGEGVDGLKVGDRV-WLTNLGWGRRQGTAAEYVVVPADQLVPLPDGVSF 119 Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180 Q A+L T + LF A ++G+TVL+HGGS +G A+QLA + GA V TA S Sbjct: 120 EQGAALGIPALTAYRALFHRAGAKAGETVLVHGGSGAVGHAAVQLARWAGARVIATASSA 179 Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240 E + GA NY ED + + T G+G+D+I++++ L + L +L+ G++ Sbjct: 180 EGAELVRQAGADAVFNYRAEDLADRILAATAGQGVDVIIEVLANVNLAKDLDVLAPGGRI 239 Query: 241 IIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIA 300 ++ G + I +NP+++K +I G L T + + +++ L + Sbjct: 240 VVYG--SGGLRGTIPINPLMAKEASIRGVLLYTATPEERAAAAEAIA----AGLADGALR 293 Query: 301 PVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332 PVI PL + A AH+ +E IGK++L P Sbjct: 294 PVIAREYPLEEAAAAHEAVESGGAIGKVVLDP 325 >gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 326 Score = 218 bits (558), Expect = 1e-57 Identities = 109/340 (32%), Positives = 161/340 (47%), Gaps = 32/340 (9%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 M+ + + +G V L E P PQP ++L++V A GVN D R+G I Sbjct: 1 MKALVLESFGGPEVFELREVPRPQPGPGQVLVRVHASGVNPLDTKIRRGGAAARPPLPAI 60 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVCALVNG-----GGYAEYCLSHQGHTLPIPKGYNAI 121 LG +VAG + +GE T + +GDEV G G AEY + P + Sbjct: 61 LGCDVAGVVEAVGEGVTRFRVGDEVYGCAGGLGGLQGSLAEYAVVDARLLALKPANLSMR 120 Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181 +AA+LP T W L A +++GQTVLIHGG+ G+G A+QLA GA VY TA SE+ Sbjct: 121 EAAALPLVGITAWEGLVDRAAVQAGQTVLIHGGAGGVGHVAVQLAKAAGARVYATASSEK 180 Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241 A LGA I Y +E +E + + T GRG D++ D VG E L+ ++ G+++ Sbjct: 181 AAFAR-SLGADPIIYY-RETVVEYVAEHTGGRGFDVVFDTVGGETLDASFEAVALYGRVV 238 Query: 242 IISFLGGNIATEINLNPIISKRITI----------TGSTLRRRTDIAKQSIRDSLQLKIW 291 I LGG +L P+ + T TG +I +++ R Sbjct: 239 SI--LGG---ATHDLAPLSFRNATYSGVFTLLPLLTGEGRAHHGEILREAAR-------- 285 Query: 292 PLLNSHVIAPVIH-TVLPLGKVAMAHDIMEKSEHIGKIIL 330 L+ + P++ PL + A AH +E GKI++ Sbjct: 286 -LVERGQLRPLLDPRTFPLEEAAAAHARLESGSARGKIVI 324 >gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 309 Score = 214 bits (548), Expect = 2e-56 Identities = 106/329 (32%), Positives = 158/329 (48%), Gaps = 25/329 (7%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPP-PKNANP 65 M+ V + YG V+ LA+ P P+P E+L+KV A GVN D+ R+GL P Sbjct: 1 MKAVRIHEYGGPEVLELADVPTPEPGPGEVLVKVHAAGVNPVDLKIREGLLKAAFPLTLP 60 Query: 66 -ILGLEVAGKIVDLGENTTHWNIGDEVCALVN---GGGYAEYCLSHQGHTLPIPKGYNAI 121 I G +VAG +V +G T + +GDEV + GG YAEY + P + Sbjct: 61 LIPGHDVAGVVVAVGPGVTGFKVGDEVFGMTPFTRGGAYAEYVVVPADELALKPANLSFE 120 Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181 +AA+LP + T W LF+ L++GQTVLIHG + G+G+ A+QLA GA V TA + Sbjct: 121 EAAALPLAGLTAWQALFELGGLKAGQTVLIHGAAGGVGSFAVQLAKARGARVIATASAAN 180 Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241 LGA I+Y K DF ++ G+D +LD VG E L + L L+ G+ Sbjct: 181 ADFL-RSLGADEVIDYTKGDF----ERAAAPGGVDAVLDTVGGETLARSLALVKPGGR-- 233 Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301 ++S G A + + + ++A+ L+ + + P Sbjct: 234 LVSIAGPPPAEQAAKRRGVRAGFVFVEPDGEQLAELAE-------------LVEAGKLRP 280 Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330 V+ V PL A AH+ +E GK++L Sbjct: 281 VVDRVFPLEDAAEAHERLESGHARGKVVL 309 >gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR). Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone and 1,4-naphthoquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 320 Score = 206 bits (527), Expect = 8e-54 Identities = 102/330 (30%), Positives = 155/330 (46%), Gaps = 19/330 (5%) Query: 10 VAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGL 69 V + G V+ + P+P+P E+L++ AIGVN D R GLYP P +LG+ Sbjct: 3 VRIHKTGGPEVLEYEDVPVPEPGPGEVLVRNTAIGVNFIDTYFRSGLYPLPLPF--VLGV 60 Query: 70 EVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPES 129 E AG + +G T + +GD V G YAEY + + +P G + AA+L Sbjct: 61 EGAGVVEAVGPGVTGFKVGDRVAYAGPPGAYAEYRVVPASRLVKLPDGISDETAAALLLQ 120 Query: 130 FFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKL 189 T L +T ++ G TVL+H + G+G Q A GATV T SEEK Sbjct: 121 GLTAHYLLRETYPVKPGDTVLVHAAAGGVGLLLTQWAKALGATVIGTVSSEEKAELARAA 180 Query: 190 GAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGN 249 GA H INY EDF+E +++ T GRG+D++ D VG + L L G ++SF GN Sbjct: 181 GADHVINYRDEDFVERVREITGGRGVDVVYDGVGKDTFEGSLDSLRPRG--TLVSF--GN 236 Query: 250 I---ATEINLNPIISKRITITGSTL----RRRTDIAKQSIRDSLQLKIWPLLNSHVIAPV 302 +L + + +T +L R ++ ++ ++ + S + Sbjct: 237 ASGPVPPFDLLRLSKGSLFLTRPSLFHYIATREELLARAAE------LFDAVASGKLKVE 290 Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332 I PL A AH +E + GK++L+P Sbjct: 291 IGKRYPLADAAQAHRDLESRKTTGKLLLIP 320 >gnl|CDD|36412 KOG1198, KOG1198, KOG1198, Zinc-binding oxidoreductase [Energy production and conversion, General function prediction only]. Length = 347 Score = 201 bits (512), Expect = 2e-52 Identities = 112/343 (32%), Positives = 169/343 (49%), Gaps = 16/343 (4%) Query: 3 ICKKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKN 62 + K R +S G V+F E PIP+P+ E+LIKV A+ +N D+ R G Y P Sbjct: 2 VKKIRRVSLVSPPGGGEVLFSEEVPIPEPEDGEVLIKVVAVALNPIDLKIRNGYYSPIPL 61 Query: 63 AN------PILGLEVAGKIVDLGENTT-HWNIGDEVCALVNGGGYAEYCLSHQGHTLPIP 115 G V G + +G++ W GD V A ++ GG AEY + + + IP Sbjct: 62 GREFPGIIGRDGSGVVGAVESVGDDVVGGWVHGDAVVAFLSSGGLAEYVVVPEKLLVKIP 121 Query: 116 KGYNAIQAASLPESFFTVWANLFQTA------NLRSGQTVLIHGGSSGIGTTAIQLASYF 169 + + +AA+LP + T + LFQ A L G++VL+ GGS G+GT AIQLA + Sbjct: 122 ESLSFEEAAALPLAALTALSALFQLAPGKRSKKLSKGKSVLVLGGSGGVGTAAIQLAKHA 181 Query: 170 GATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQ 229 GA TA S+EK KLGA ++Y E+ +E+++K T G+D++LD VG L + Sbjct: 182 GAIKVVTACSKEKLELVKKLGADEVVDYKDENVVELIKKYTGK-GVDVVLDCVGGSTLTK 240 Query: 230 HLTLLSKEGKLIIISFLGGNIATEINLNPIIS-KRITITGSTLRRRTDIAKQSIRDSLQL 288 L+ L K G I +G +A + S I + L+ + + L Sbjct: 241 SLSCLLKGGGGAYIGLVGDELANYKLDDLWQSANGIKLYSLGLKGVNYRWLYFVPSAEYL 300 Query: 289 K-IWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330 K + L+ I PVI +V P + A + +EKS GK++L Sbjct: 301 KALVELIEKGKIKPVIDSVYPFSQAKEAFEKLEKSHATGKVVL 343 >gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 337 Score = 199 bits (508), Expect = 1e-51 Identities = 100/341 (29%), Positives = 167/341 (48%), Gaps = 20/341 (5%) Query: 8 RHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPIL 67 R V ++G+G + + + + +P+P E+ ++VEA G+N D+M R+GLY + Sbjct: 1 RAVVLTGFGGLDKLKVEKEALPEPSSGEVRVRVEACGLNFADLMARQGLYDSAPKPPFVP 60 Query: 68 GLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLP 127 G E AG + +GE + +GD V L GGYAE P+P G + +AA+ P Sbjct: 61 GFECAGTVEAVGEGVKDFKVGDRVMGLTRFGGYAEVVNVPADQVFPLPDGMSFEEAAAFP 120 Query: 128 ESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLAS-YFGATVYTTAKSEEKCLAC 186 ++ T + LF+ NLR GQ+VL+H + G+G A QL TV TA S K A Sbjct: 121 VNYLTAYYALFELGNLRPGQSVLVHSAAGGVGLAAGQLCKTVPNVTVVGTA-SASKHEAL 179 Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF- 245 + G H I+Y +D++E ++K + G+DI+LD +G E + LL G+L++ Sbjct: 180 KENGVTHVIDYRTQDYVEEVKKIS-PEGVDIVLDALGGEDTRKSYDLLKPMGRLVVYGAA 238 Query: 246 ------------LGGNIATEINLNPI--ISKRITITGSTLRRRTDIAKQSIRDSLQLKIW 291 L ++P+ IS+ ++ G L + ++ + + K+ Sbjct: 239 NLVTGEKRSWFKLAKKWWNRPKVDPMKLISENKSVLGFNLGWLFE--ERELLTEVMDKLL 296 Query: 292 PLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332 L I P I +V P +V A ++ ++IGK++L P Sbjct: 297 KLYEEGKIKPKIDSVFPFEEVGEAMRRLQSRKNIGKVVLTP 337 >gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 319 Score = 190 bits (485), Expect = 5e-49 Identities = 94/325 (28%), Positives = 146/325 (44%), Gaps = 20/325 (6%) Query: 15 YGKSNVM--FLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPP--PKNANPILGLE 70 YG V+ E PIP P+ E+L+KV A VN D R+G + PI G++ Sbjct: 6 YGSPEVLLLLEVEVPIPTPKPGEVLVKVHAASVNPVDWKLRRGPPKLLLGRPFPPIPGMD 65 Query: 71 VAGKIVDLGENTTHWNIGDEVCALVN---GGGYAEYCLSHQGHTLPIPKGYNAIQAASLP 127 AG++V +G T + +GDEV + GG AEY ++ + P+G + +AA+LP Sbjct: 66 FAGEVVAVGSGVTRFKVGDEVFGRLPPKGGGALAEYVVAPESGLAKKPEGVSFEEAAALP 125 Query: 128 ESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACL 187 + T L ++ GQ VLI+G S G+GT A+Q+A GA V S Sbjct: 126 VAGLTALQALRDAGKVKPGQRVLINGASGGVGTFAVQIAKALGAHVTGVC-STRNAELVR 184 Query: 188 KLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQ--HLTLLSKEGKLIIISF 245 LGA I+Y EDF+ G D+I D VG + L G+ + + Sbjct: 185 SLGADEVIDYTTEDFVA---LTAGGEKYDVIFDAVGNSPFSLYRASLALKPGGRYVSVGG 241 Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT 305 + L ++ +T+ G R + +AK + D QL + + PVI + Sbjct: 242 GPSGL-----LLVLLLLPLTLGGGGRRLKFFLAKPNAEDLEQLAEL--VEEGKLKPVIDS 294 Query: 306 VLPLGKVAMAHDIMEKSEHIGKIIL 330 V PL A+ ++ GK+++ Sbjct: 295 VYPLEDAPEAYRRLKSGRARGKVVI 319 >gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase. Putative enoyl reductase of polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains, at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 293 Score = 186 bits (475), Expect = 7e-48 Identities = 87/315 (27%), Positives = 149/315 (47%), Gaps = 42/315 (13%) Query: 35 EILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCAL 94 E+ ++V+A G+N DV+ GL P + LGLE +G + +G T +GD V L Sbjct: 2 EVEVEVKAAGLNFRDVLVALGLLPGDETP---LGLECSGIVTRVGSGVTGLKVGDRVMGL 58 Query: 95 VNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGG 154 G +A + + IP + +AA+LP ++ T + L A L+ G++VLIH Sbjct: 59 APGA-FATHVRVDARLVVKIPDSLSFEEAATLPVAYLTAYYALVDLARLQKGESVLIHAA 117 Query: 155 SSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKE-------------- 200 + G+G AIQLA + GA V+ T SEEK +L+E Sbjct: 118 AGGVGQAAIQLAQHLGAEVFATVGSEEK------------REFLRELGGPVDHIFSSRDL 165 Query: 201 DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLN-PI 259 F + + + T GRG+D++L+ + E L L+ G+ + I +I + L Sbjct: 166 SFADGILRATGGRGVDVVLNSLSGELLRASWRCLAPFGRFVEIG--KRDILSNSKLGMRP 223 Query: 260 ISKRITITG----STLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMA 315 + ++ + R R ++ ++ +R+ L+ LL + V+ P+ TV+P A Sbjct: 224 FLRNVSFSSVDLDQLARERPELLRELLREVLE-----LLEAGVLKPLPPTVVPSASEIDA 278 Query: 316 HDIMEKSEHIGKIIL 330 +M+ +HIGK++L Sbjct: 279 FRLMQSGKHIGKVVL 293 >gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family. The medium chain reductase/dehydrogenases (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH) , quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Other MDR members have only a catalytic zinc, and some contain no coordinated zinc. Length = 271 Score = 185 bits (472), Expect = 1e-47 Identities = 95/269 (35%), Positives = 136/269 (50%), Gaps = 27/269 (10%) Query: 35 EILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCAL 94 E+L++VEA G+ D+ R+G YPPP ILG E AG +V++G T +GD V L Sbjct: 1 EVLVRVEAAGLCGTDLHIRRGGYPPPPKLPLILGHEGAGVVVEVGPGVTGVKVGDRVVVL 60 Query: 95 VNG-----------------------GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFF 131 N GG+AEY + + +P+P G + +AA LPE Sbjct: 61 PNLGCGTCELCRELCPGGGILGEGLDGGFAEYVVVPADNLVPLPDGLSLEEAALLPEPLA 120 Query: 132 TVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGA 191 T + L + L+ G TVL+ G G+G A QLA GA V T +S+EK +LGA Sbjct: 121 TAYHALRRAGVLKPGDTVLVLGA-GGVGLLAAQLAKAAGARVIVTDRSDEKLELAKELGA 179 Query: 192 KHAINYLKEDFLEILQKETQGRGIDIILDMVG-AEYLNQHLTLLSKEGKLIIISFLGGNI 250 H I+Y +ED E L + T G G D+++D VG E L Q L LL G+++++ G Sbjct: 180 DHVIDYKEEDLEEEL-RLTGGGGADVVIDAVGGPETLAQALRLLRPGGRIVVVGGTSGGP 238 Query: 251 ATEINLNPIISKRITITGSTLRRRTDIAK 279 + L ++ K +TI GST R D + Sbjct: 239 PLDD-LRRLLFKELTIIGSTGGTREDFEE 266 >gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 331 Score = 181 bits (461), Expect = 2e-46 Identities = 110/341 (32%), Positives = 166/341 (48%), Gaps = 26/341 (7%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 R V ++ G V+ + E+ +P+P E+++KVEA GV+ DV R+GLYP Sbjct: 1 NREVVVTRRGGPEVLKVVEADLPEPAAGEVVVKVEASGVSFADVQMRRGLYPDQPPLPFT 60 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126 G ++ G++ LG T + +GD V AL GG AEY + +P+P+G +A +A L Sbjct: 61 PGYDLVGRVDALGSGVTGFEVGDRVAALTRVGGNAEYINLDAKYLVPVPEGVDAAEAVCL 120 Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186 ++ T + L + A + +GQ VLIHG S G+G ++LA GA VY TA SE A Sbjct: 121 VLNYVTAYQMLHRAAKVLTGQRVLIHGASGGVGQALLELALLAGAEVYGTA-SERNHAAL 179 Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246 +LGA I+Y +D+L T G G+D++ D VG E + L+ G L+ Sbjct: 180 RELGATP-IDYRTKDWLP--AMLTPG-GVDVVFDGVGGESYEESYAALAPGGTLVCYGGN 235 Query: 247 GGNIATEINLNPIIS--------------KRITITGSTLRRRTDIA--KQSIRDSLQLKI 290 + +L + S +R T R D +Q + + L Sbjct: 236 SSLLQGRRSLAALGSLLARLAKLKLLPTGRRATFYYVWRDRAEDPKLFRQDLTELLD--- 292 Query: 291 WPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILL 331 LL I P I LPL +VA AH ++E + +GKI+LL Sbjct: 293 --LLAKGKIRPKIAKRLPLSEVAEAHRLLESGKVVGKIVLL 331 >gnl|CDD|31264 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only]. Length = 339 Score = 175 bits (444), Expect = 2e-44 Identities = 106/357 (29%), Positives = 163/357 (45%), Gaps = 50/357 (14%) Query: 5 KKMRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNAN 64 M+ + +G+ + + E P+P+P E+LIKVEA GV D+ KG +P PK Sbjct: 2 MTMKAAVLKKFGQP--LEIEEVPVPEPGPGEVLIKVEACGVCHTDLHVAKGDWPVPK--L 57 Query: 65 P-ILGLEVAGKIVDLGENTTHWNIGDEV-----------C-------------ALVNG-- 97 P I G E+ G +V++GE T +GD V C + G Sbjct: 58 PLIPGHEIVGTVVEVGEGVTGLKVGDRVGVGWLVISCGECEYCRSGNENLCPNQKITGYT 117 Query: 98 --GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGS 155 GGYAEY + + + IP+G + +AA L + T + L + AN++ G+ V + G+ Sbjct: 118 TDGGYAEYVVVPARYVVKIPEGLDLAEAAPLLCAGITTYRALKK-ANVKPGKWVAVV-GA 175 Query: 156 SGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGI 215 G+G A+Q A GA V +SEEK KLGA H IN D LE +++ Sbjct: 176 GGLGHMAVQYAKAMGAEVIAITRSEEKLELAKKLGADHVINSSDSDALEAVKEI-----A 230 Query: 216 DIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRT 275 D I+D VG L L L + G L+++ GG + +I K I+I GS + R Sbjct: 231 DAIIDTVGPATLEPSLKALRRGGTLVLVGLPGGGPIPLLPAFLLILKEISIVGSLVGTRA 290 Query: 276 DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332 D+ + I P I +PL ++ A++ MEK + G+ ++ Sbjct: 291 DLE----------EALDFAAEGKIKPEILETIPLDEINEAYERMEKGKVRGRAVIDM 337 >gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 325 Score = 174 bits (443), Expect = 3e-44 Identities = 82/240 (34%), Positives = 123/240 (51%), Gaps = 5/240 (2%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 M+ + G + + L E IP P E+L+KV A G+N D P + + Sbjct: 1 MKAWVLPKPGAALQLTLEEIEIPGPGAGEVLVKVHAAGLNPVDWKVIAWGPPAWSYPH-V 59 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVC---ALVNGGGYAEYCLSHQGHTLPIPKGYNAIQA 123 G++ AG +V +G T W +GD V +L GG +AEY + LP+P + +A Sbjct: 60 PGVDGAGVVVAVGAKVTGWKVGDRVAYHASLARGGSFAEYTVVDARAVLPLPDSLSFEEA 119 Query: 124 ASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183 A+LP + T + LF+ + +G+T+LI GG+ G+G+ A+QLA G V TT S+ Sbjct: 120 AALPCAGLTAYQALFKKLRIEAGRTILITGGAGGVGSFAVQLAKRAGLRVITTC-SKRNF 178 Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243 LGA H I+Y ED E +++ T GRG+D +LD VG E L+ G L+ I Sbjct: 179 EYVKSLGADHVIDYNDEDVCERIKEITGGRGVDAVLDTVGGETAAALAPTLAFNGHLVCI 238 >gnl|CDD|36411 KOG1197, KOG1197, KOG1197, Predicted quinone oxidoreductase [Energy production and conversion, General function prediction only]. Length = 336 Score = 172 bits (437), Expect = 1e-43 Identities = 104/330 (31%), Positives = 166/330 (50%), Gaps = 12/330 (3%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLY-PPPKNANP 65 ++ + ++ +G +V+ L + P+P P E+ IK +A G+N D+ RKGLY P P P Sbjct: 9 LKCIVVTEFGGYDVLKLEDRPVPPPAPGELTIKNKACGLNFIDLYFRKGLYDPAPLPYTP 68 Query: 66 ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125 G+E AG +V +GE T +GD V L G YAE +P+ +AA+ Sbjct: 69 --GMEAAGVVVAVGEGVTDRKVGDRVAYLNPFGAYAEEVTVPSVKVFKVPEAITLKEAAA 126 Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA 185 L T + LF+ N++ G TVL+H + G+G QL GA TA + EK Sbjct: 127 LLLQGLTAYMLLFEAYNVKPGHTVLVHAAAGGVGLLLCQLLRAVGAHTIATASTAEKHEI 186 Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245 + GA+H I+Y ED+++ ++K T G+G+D + D VG + + L L GK ++SF Sbjct: 187 AKENGAEHPIDYSTEDYVDEVKKITNGKGVDAVYDSVGKDTFAKSLAALKPMGK--MVSF 244 Query: 246 LGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQL---KIWPLLNSHVIAPV 302 + +PI +++ L R + + L +++ L+NS + Sbjct: 245 GNASGLI----DPIPLNQLSPKALQLVRPSLLGYIDGEVELVSYVARLFALVNSGHLKIH 300 Query: 303 IHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332 I V PL KVA AH +E + +GK++LLP Sbjct: 301 IDHVYPLSKVADAHADIESRKTVGKVLLLP 330 >gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 336 Score = 166 bits (424), Expect = 6e-42 Identities = 101/332 (30%), Positives = 155/332 (46%), Gaps = 42/332 (12%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT 82 L E P+P+P E+L++V A+ +N D++ G YPPP I + AG++V +GE Sbjct: 17 LVEEPVPEPGPGEVLVRVHAVSLNYRDLLILNGRYPPPVKDPLIPLSDGAGEVVAVGEGV 76 Query: 83 THWNIGDEVCALVN-----------------GGGY----AEYCLSHQGHTLPIPKGYNAI 121 T + +GD V GG AEY + + + P + Sbjct: 77 TRFKVGDRVVPTFFPNWLDGPPTAEDEASALGGPIDGVLAEYVVLPEEGLVRAPDHLSFE 136 Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181 +AA+LP + T W LF L+ G TVL+ G+ G+ A+Q A GA V T+ S+E Sbjct: 137 EAATLPCAGLTAWNALFGLGPLKPGDTVLVQ-GTGGVSLFALQFAKAAGARVIATSSSDE 195 Query: 182 KCLACLK-LGAKHAINYLKE-DFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGK 239 K L K LGA H INY D+ E + K T GRG+D ++++ G L Q + ++ G Sbjct: 196 K-LERAKALGADHVINYRTTPDWGEEVLKLTGGRGVDHVVEVGGPGTLAQSIKAVAPGGV 254 Query: 240 LIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIA---KQSIRDSLQLKIWPLLNS 296 + +I FL G + L P+++K T+ G IA + + + + Sbjct: 255 ISLIGFLSG-FEAPVLLLPLLTKGATLRG--------IAVGSRAQFEAMNR-----AIEA 300 Query: 297 HVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKI 328 H I PVI V P + A+ +E H GK+ Sbjct: 301 HRIRPVIDRVFPFEEAKEAYRYLESGSHFGKV 332 >gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 320 Score = 166 bits (422), Expect = 9e-42 Identities = 95/337 (28%), Positives = 156/337 (46%), Gaps = 29/337 (8%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 M+ + + G V+ L E PIP+P+ +LI+V+A G+NR ++ R+G P K + Sbjct: 1 MKAIVIEQPGGPEVLKLREIPIPEPKPGWVLIRVKAFGLNRSEIFTRQGHSPSVK-FPRV 59 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVCALVNG------GGYAEYCLSHQGHTLPIPKGYNA 120 LG+E G V+ + G V + G G YAEY L I + Sbjct: 60 LGIEAVG-EVEEAP-GGTFTPGQRVATAMGGMGRTFDGSYAEYTLVPNEQVYAIDSDLSW 117 Query: 121 IQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE 180 + A+LPE+++T W +LF++ L+ G T+LI GG+S +G A++LA GATV T +S Sbjct: 118 AELAALPETYYTAWGSLFRSLGLQPGDTLLIRGGTSSVGLAALKLAKALGATVTATTRSP 177 Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKL 240 E+ +LGA + E L+ G D +L++VG L L L G Sbjct: 178 ERAALLKELGADEVV-IDDGAIAEQLRAAPG--GFDKVLELVGTATLKDSLRHLRPGG-- 232 Query: 241 IIISFLG--GNIATEINLNPI----ISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLL 294 I+ G G T + NP+ +T+TGS+ D+ + +++ + Sbjct: 233 -IVCMTGLLGGQWTLEDFNPMDDIPSGVNLTLTGSSS---GDVPQTPLQELFD-----FV 283 Query: 295 NSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILL 331 + + V ++ AH ME + GK+++L Sbjct: 284 AAGHLDIPPSKVFTFDEIVEAHAYMESNRAFGKVVVL 320 >gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 303 Score = 156 bits (397), Expect = 6e-39 Identities = 92/308 (29%), Positives = 156/308 (50%), Gaps = 11/308 (3%) Query: 28 IPQPQKEEILIKVEAIGVNRPDVMQRKGLYP--PPKNANPILGLEVAGKIVDLGENTTHW 85 + P E+ I+V A +N D++ +GLYP PP P G E +G + +G + T Sbjct: 2 VAPPGPGEVRIQVRAFSLNFGDLLCVRGLYPTMPPYPFTP--GFEASGVVRAVGPHVTRL 59 Query: 86 NIGDEVCALVNG--GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANL 143 +GDEV A GG+A + + P + +A +LP F TV + F A L Sbjct: 60 AVGDEVIAGTGESMGGHATLVTVPEDQVVRKPASLSFEEACALPVVFLTVI-DAFARAGL 118 Query: 144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK-LGAKHAINYLKEDF 202 G+ +LI + G G A+QLA GA +Y TA S++K L LK LG H INY++EDF Sbjct: 119 AKGEHILIQTATGGTGLMAVQLARLKGAEIYATASSDDK-LEYLKQLGVPHVINYVEEDF 177 Query: 203 LEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISK 262 E + + T GRG+D++++ + E + + L L+ G+ + I+ A ++L+ ++S Sbjct: 178 EEEIMRLTGGRGVDVVINTLSGEAIQKGLNCLAPGGRYVEIAMTALKSAPSVDLS-VLSN 236 Query: 263 RITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS 322 + LR+ + + I D Q ++ L+ + P + + P + A+ + Sbjct: 237 NQSFHSVDLRKLLLLDPEFIAD-YQAEMVSLVEEGELRPTVSRIFPFDDIGEAYRYLSDR 295 Query: 323 EHIGKIIL 330 E+IGK+++ Sbjct: 296 ENIGKVVV 303 >gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 350 Score = 156 bits (396), Expect = 8e-39 Identities = 96/365 (26%), Positives = 163/365 (44%), Gaps = 54/365 (14%) Query: 7 MRHVAMSGYGKSNVM-FLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYP----PPK 61 MR V ++G+G + + + + P+P P E+LI+V A GVN D+ R+G Y Sbjct: 1 MRAVLLTGHGGLDKLVYRDDVPVPTPAPGEVLIRVGACGVNNTDINTREGWYSTEVDGAT 60 Query: 62 NANP---------------ILGLEVAGKIVDLGENTTHWNIGDEV--------------- 91 ++ I G ++ G++V +GE IG+ V Sbjct: 61 DSTGAGEAGWWGGTLSFPRIQGADIVGRVVAVGEGVDTARIGERVLVDPSIRDPPEDDPA 120 Query: 92 -CALVNG---GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQ 147 + GG+AEY + + P+ + ++ A+ P S+ T N+ + A + +G+ Sbjct: 121 DIDYIGSERDGGFAEYTVVPAENAYPVNSPLSDVELATFPCSYSTAE-NMLERAGVGAGE 179 Query: 148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQ 207 TVL+ G S G+G+ +QLA GA V A K A LGA I L++ L Sbjct: 180 TVLVTGASGGVGSALVQLAKRRGAIVIAVA-GAAKEEAVRALGADTVI--LRDAPLLADA 236 Query: 208 KETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITIT 267 K G +D++ D+VG L LL G+ + + G + E++L + K +T+ Sbjct: 237 KALGGEPVDVVADVVGGPLFPDLLRLLRPGGRYVTAGAIAGPV-VELDLRTLYLKDLTLF 295 Query: 268 GSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGK 327 GSTL R + ++ +R + I PV+ PL ++ A + H+GK Sbjct: 296 GSTLGTRE-VFRRLVR---------YIEEGEIRPVVAKTFPLSEIREAQAEFLEKRHVGK 345 Query: 328 IILLP 332 ++L+P Sbjct: 346 LVLVP 350 >gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Candida tropicalis enoyl thioester reductase (Etr1p) catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis. Etr1p forms homodimers with each subunit containing a nucleotide-binding Rossmann fold domain and a catalytic domain. Length = 339 Score = 154 bits (392), Expect = 3e-38 Identities = 78/252 (30%), Positives = 117/252 (46%), Gaps = 27/252 (10%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT 82 + + P+P+P +E+L+KV+A+ +N D + + P A ILG + AG +V++G Sbjct: 16 VVDVPVPKPGPDEVLVKVKAVALNPVDWKHQDYGFIPSYPA--ILGCDFAGTVVEVGSGV 73 Query: 83 THWNIGDEVCALVNG--------GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVW 134 T + +GD V V+G G + EY ++ T IP + +AA+LP T Sbjct: 74 TRFKVGDRVAGFVHGGNPNDPRNGAFQEYVVADADLTAKIPDNISFEEAATLPVGLVTAA 133 Query: 135 ANLFQTANLR----------SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTA--KSEEK 182 LFQ L G+ VLI GGSS +GT AIQLA G V TTA K+ + Sbjct: 134 LALFQKLGLPLPPPKPSPASKGKPVLIWGGSSSVGTLAIQLAKLAGYKVITTASPKNFDL 193 Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG-AEYLNQHLTLLSKEGKLI 241 LGA +Y D +E ++ T G+ + LD + E L + G Sbjct: 194 ---VKSLGADAVFDYHDPDVVEDIRAATGGK-LRYALDCISTPESAQLCAEALGRSGGGK 249 Query: 242 IISFLGGNIATE 253 ++S L TE Sbjct: 250 LVSLLPVPEETE 261 >gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group contains proteins that share the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenase family. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine (His-51), the ribose of NAD, a serine (Ser-48), then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 332 Score = 151 bits (384), Expect = 2e-37 Identities = 92/339 (27%), Positives = 151/339 (44%), Gaps = 53/339 (15%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP--ILGLEVAGKIVDLGE 80 + E P P+P E+LIKV+A GV D++ KG +P ILG E+ G + ++GE Sbjct: 15 IEEVPDPEPGPGEVLIKVKAAGVCYRDLLFWKGFFP---RGKYPLILGHEIVGTVEEVGE 71 Query: 81 NTTHWNIGDEVCAL---------------------------VNGGGYAEYCLSHQGHTLP 113 + GD V GG+AEY + + Sbjct: 72 GVERFKPGDRVILYYYIPCGKCEYCLSGEENLCRNRAEYGEEVDGGFAEYVKVPERSLVK 131 Query: 114 IPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATV 173 +P + AA T L + A ++ G TVL+ G G+G AIQLA GA V Sbjct: 132 LPDNVSDESAALAACVVGTAVHALKR-AGVKKGDTVLVTGAGGGVGIHAIQLAKALGARV 190 Query: 174 YTTAKSEEKCLACLKLGAKHAINYLK--EDFLEILQKETQGRGIDIILDMVGAEYLNQHL 231 +S EK +LGA + I+ K ED ++ G D+++++VG+ + + L Sbjct: 191 IAVTRSPEKLKILKELGADYVIDGSKFSEDVKKLG-------GADVVIELVGSPTIEESL 243 Query: 232 TLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIW 291 L+K G+L++I + + A + +I K I I GS + D + ++L+ Sbjct: 244 RSLNKGGRLVLIGNVTPDPA-PLRPGLLILKEIRIIGSISATKAD-----VEEALK---- 293 Query: 292 PLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330 L+ I PVI V+ L + A + ++ + +G+I+L Sbjct: 294 -LVKEGKIKPVIDRVVSLEDINEALEDLKSGKVVGRIVL 331 >gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1. Human Reticulon 4 Interacting Protein 1 is a member of the medium chain dehydrogenase/ reductase (MDR) family. Riticulons are endoplasmic reticulum associated proteins involved in membrane trafficking and neuroendocrine secretion. The MDR/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 350 Score = 143 bits (363), Expect = 7e-35 Identities = 103/354 (29%), Positives = 150/354 (42%), Gaps = 37/354 (10%) Query: 7 MRHVAMSGYGKSNVM-FLAESPIPQPQKE-EILIKVEAIGVNRPDVMQRKG--------- 55 M+ + YG + + L + IP +K ++LIKV A VN DV+ R G Sbjct: 1 MKAWQIHSYGGIDSLLLLENARIPVIRKPNQVLIKVHAASVNPIDVLMRSGYGRTLLNKK 60 Query: 56 LYPPPKNANP-----ILGLEVAGKIVDLGENTTHWNIGDEVCALVNG---GGYAEYCLSH 107 P + LG + +G +VD+G + IGDEV V G +AEY + Sbjct: 61 RKPQSCKYSGIEFPLTLGRDCSGVVVDIGSGVKSFEIGDEVWGAVPPWSQGTHAEYVVVP 120 Query: 108 QGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLR----SGQTVLIHGGSSGIGTTAI 163 + PK + +AASLP + T W+ L L +G+ VLI GGS G+GT AI Sbjct: 121 ENEVSKKPKNLSHEEAASLPYAGLTAWSALVNVGGLNPKNAAGKRVLILGGSGGVGTFAI 180 Query: 164 QLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG 223 QL +GA V TT S + LGA I+Y EDF E L + D+ILD VG Sbjct: 181 QLLKAWGAHVTTTC-STDAIPLVKSLGADDVIDYNNEDFEEELTERG---KFDVILDTVG 236 Query: 224 AEYLNQHLTLLSKEGKLIII--------SFLGGNIATEINLNPIISKRITITGSTLRRRT 275 + L LL K G + + LG + + + + + + Sbjct: 237 GDTEKWALKLLKKGGTYVTLVSPLLKNTDKLG--LVGGMLKSAVDLLKKNVKSLLKGSHY 294 Query: 276 DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKII 329 S S ++ L+ I PVI V P +V A++ +E GK + Sbjct: 295 RWGFFSPSGSALDELAKLVEDGKIKPVIDKVFPFEEVPEAYEKVESGHARGKTV 348 >gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 341 Score = 139 bits (352), Expect = 1e-33 Identities = 87/333 (26%), Positives = 146/333 (43%), Gaps = 42/333 (12%) Query: 27 PIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWN 86 P+P+P E+L+K+EA GV D+ G +P I G E AG +V +G + Sbjct: 20 PVPEPGPGEVLVKLEASGVCHTDLHAALGDWPVKPKLPLIGGHEGAGVVVAVGPGVSGLK 79 Query: 87 IGD--------------EVC----------ALVNG----GGYAEYCLSHQGHTLPIPKGY 118 +GD E C +G G +AEY ++ + PIP G Sbjct: 80 VGDRVGVKWLYDACGKCEYCRTGDETLCPNQKNSGYTVDGTFAEYAIADARYVTPIPDGL 139 Query: 119 NAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK 178 + QAA L + TV+ L + A L+ G V+I G G+G +Q A G V Sbjct: 140 SFEQAAPLLCAGVTVYKAL-KKAGLKPGDWVVISGAGGGLGHLGVQYAKAMGLRVIAIDV 198 Query: 179 SEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGID-IILDMVGAEYLNQHLTLLSKE 237 +EK +LGA +++ K D +E +++ T G G +++ V A Q L L Sbjct: 199 GDEKLELAKELGADAFVDFKKSDDVEAVKELTGGGGAHAVVVTAVSAAAYEQALDYLRPG 258 Query: 238 GKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297 G L+ + G ++ ++ + ITI GS + R D ++++L+ Sbjct: 259 GTLVCVGLPPGGFI-PLDPFDLVLRGITIVGSLVGTRQD-----LQEALE-----FAARG 307 Query: 298 VIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330 + P I V+PL + + ME+ + G++++ Sbjct: 308 KVKPHI-QVVPLEDLNEVFEKMEEGKIAGRVVV 339 >gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Candida tropicalis enoyl thioester reductase (Etr1p) catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis. Etr1p forms homodimers, with each subunit containing a nucleotide-binding Rossmann fold domain and a catalytic domain. Length = 324 Score = 139 bits (351), Expect = 2e-33 Identities = 90/331 (27%), Positives = 147/331 (44%), Gaps = 12/331 (3%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP- 65 MR + + +G V+ + P P P ++ I V A GV+ D R G P P Sbjct: 1 MRAIRLHEFGPPEVLVPEDVPDPVPGPGQVRIAVAAAGVHFVDTQLRSGWGPGPFPPELP 60 Query: 66 -ILGLEVAGKIVDLGENT-THWNIGDEVCA--LVNGGGYAEYCLSHQGHTLPIPKGYNAI 121 + G EVAG + +G W +G V A GGGYAE ++ P+P G + Sbjct: 61 YVPGGEVAGVVDAVGPGVDPAW-LGRRVVAHTGRAGGGYAELAVADVDSLHPVPDGLDLE 119 Query: 122 QAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEE 181 A ++ T L A L G VL+ + G+G+ +QLA GATV A Sbjct: 120 AAVAVVHDGRTALG-LLDLATLTPGDVVLVTAAAGGLGSLLVQLAKAAGATVVGAAGGPA 178 Query: 182 KCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLI 241 K LGA A++Y + D+ + +++ G G+ ++LD VG L LL+ G+ + Sbjct: 179 KTALVRALGADVAVDYTRPDWPDQVREALGGGGVTVVLDGVGGAIGRAALALLAPGGRFL 238 Query: 242 IISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAP 301 + G T ++ + + +T+ G + + +R L+ + + + P Sbjct: 239 TYGWASGE-WTALDEDDARRRGVTVVGLLGVQA---ERGGLRA-LEARALAEAAAGRLVP 293 Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332 V+ PL + A AH +E +GK++LLP Sbjct: 294 VVGQTFPLERAAEAHAALEARSTVGKVLLLP 324 >gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members. This group contains enzymes of the zinc-dependent alcohol dehydrogenase family, including members (aka MDR) identified as 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase and N-benzyl-3-pyrrolidinol dehydrogenase. 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase catalyzes the conversion of 6-Hydroxycyclohex-1-enecarbonyl-CoA and NAD+ to 6-Ketoxycyclohex-1-ene-1-carboxyl-CoA,NADH, and H+. This group displays the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 338 Score = 129 bits (327), Expect = 9e-31 Identities = 87/353 (24%), Positives = 151/353 (42%), Gaps = 47/353 (13%) Query: 12 MSGYGKSNV----MFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPIL 67 M + + L E P+P+P E+L+KV+A GV D+ G P L Sbjct: 1 MKAWRFHKGSKGLLVLEEVPVPEPGPGEVLVKVKAAGVCHSDLHILDGGVPTLTKLPLTL 60 Query: 68 GLEVAGKIVDLGENTTHWNIGDEV----------CALVNG-----------------GGY 100 G E+AG +V++G T++ +GD V CAL GG+ Sbjct: 61 GHEIAGTVVEVGAGVTNFKVGDRVAVPAVIPCGACALCRRGRGNLCLNQGMPGLGIDGGF 120 Query: 101 AEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGT 160 AEY + +P+P G QAA ++ T + + + ++ G+TVL+ G G+G Sbjct: 121 AEYIVVPARALVPVPDGVPFAQAAVATDAVLTPYHAVVRAGEVKPGETVLV-IGLGGLGL 179 Query: 161 TAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILD 220 A+Q+A GA V EEK +LGA +N L + + G G D+I D Sbjct: 180 NAVQIAKAMGAAVIAVDIKEEKLELAKELGADEVLNSLDDSPKDKKAAG-LGGGFDVIFD 238 Query: 221 MVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAK 279 VG + G+++++ G ++L+ +I++ + I GS Sbjct: 239 FVGTQPTFEDAQKAVKPGGRIVVVGL--GRDKLTVDLSDLIARELRIIGS-----FGGTP 291 Query: 280 QSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332 + + + L L+ + P + T PL ++ + + K + G+++L+P Sbjct: 292 EDLPEVLD-----LIAKGKLDPQVETR-PLDEIPEVLERLHKGKVKGRVVLVP 338 >gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 367 Score = 127 bits (320), Expect = 5e-30 Identities = 90/328 (27%), Positives = 151/328 (46%), Gaps = 60/328 (18%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 M+ + G + + E P+P+P++ EILI+V A GV D+ KG P P + Sbjct: 1 MKAAVLKGPNPP--LTIEEIPVPRPKEGEILIRVAACGVCHSDLHVLKGELPFPPPF--V 56 Query: 67 LGLEVAGKIVDLGENTTHWN---IGDEV-------------CA----------------- 93 LG E++G++V++G N + +GD V CA Sbjct: 57 LGHEISGEVVEVGPNVENPYGLSVGDRVVGSFIMPCGKCRYCARGKENLCEDFFAYNRLK 116 Query: 94 --LVNG-----------------GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVW 134 L +G GG AEY + P+P+ + ++A L + FT + Sbjct: 117 GTLYDGTTRLFRLDGGPVYMYSMGGLAEYAVVPATALAPLPESLDYTESAVLGCAGFTAY 176 Query: 135 ANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKH 193 L A++R G+TV + G G+G++AIQLA FGA + +EK +LGA H Sbjct: 177 GALKHAADVRPGETVAVIG-VGGVGSSAIQLAKAFGASPIIAVDVRDEKLAKAKELGATH 235 Query: 194 AINYLKEDFLEILQKETQGRGIDIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIAT 252 +N KED + +++ T GRG+D++++ +G E L ++ G+ +++ G Sbjct: 236 TVNAAKEDAVAAIREITGGRGVDVVVEALGKPETFKLALDVVRDGGRAVVVGLAPGGATA 295 Query: 253 EINLNPIISKRITITGST-LRRRTDIAK 279 EI + ++ + I I GS R R D+ + Sbjct: 296 EIPITRLVRRGIKIIGSYGARPRQDLPE 323 >gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins. Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes, or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 330 Score = 123 bits (311), Expect = 7e-29 Identities = 87/336 (25%), Positives = 145/336 (43%), Gaps = 51/336 (15%) Query: 25 ESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP-ILGLEVAGKIVDLGENTT 83 E P+P+P E+LIK+EA GV D+ +G + K P + G E+ G++V++G Sbjct: 16 EVPVPEPGPGEVLIKIEACGVCHTDLHAAEGDWGGSKY--PLVPGHEIVGEVVEVGAGVE 73 Query: 84 HWNIGDEV----------------------------CALVNGGGYAEYCLSHQGHTLPIP 115 +GD V GGYAEY ++ +T+ +P Sbjct: 74 GRKVGDRVGVGWLVGSCGRCEYCRRGLENLCQKAVNTGYTTQGGYAEYMVADAEYTVLLP 133 Query: 116 KGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYT 175 G QAA L + TV++ L + A R G+ V + G G+G A+Q A G Sbjct: 134 DGLPLAQAAPLLCAGITVYSAL-RDAGPRPGERVAVL-GIGGLGHLAVQYARAMGFETVA 191 Query: 176 TAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEY-LNQHLTLL 234 +S +K KLGA ++ E ++ G D+IL V + L L Sbjct: 192 ITRSPDKRELARKLGADEVVDSGAEL-----DEQAAAGGADVILVTVVSGAAAEAALGGL 246 Query: 235 SKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLL 294 + G+++++ + ++ P+I KR +I GST R D ++++L Sbjct: 247 RRGGRIVLVGLPESPPFS-PDIFPLIMKRQSIAGSTHGGRAD-----LQEALD-----FA 295 Query: 295 NSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330 + P+I T PL + A++ MEK + + +L Sbjct: 296 AEGKVKPMIETF-PLDQANEAYERMEKGDVRFRFVL 330 >gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase. Putative L-iditol 2-dehydrogenase based on annotation of some members in this subgroup. L-iditol 2-dehydrogenase catalyzes the NAD+-dependent conversion of L-iditol to L-sorbose in fructose and mannose metabolism. This enzyme is related to sorbitol dehydrogenase, alcohol dehydrogenase, and other medium chain dehydrogenase/reductases. The zinc-dependent alcohol dehydrogenase (ADH-Zn)-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH. This group is also called the medium chain dehydrogenases/reductase family (MDR) to highlight its broad range of activities and to distinguish from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal GroES-like catalytic domain. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 343 Score = 121 bits (306), Expect = 2e-28 Identities = 87/291 (29%), Positives = 136/291 (46%), Gaps = 41/291 (14%) Query: 15 YGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGK 74 +G ++V L E P+P+P E+L+KV A G+ DV + +G + K ILG E+AG+ Sbjct: 7 HGPNDVR-LEEVPVPEPGPGEVLVKVRACGICGTDVKKIRGGHTDLK-PPRILGHEIAGE 64 Query: 75 IVDLGENTTHWNIGDEVCALVN---------------------------GGGYAEYCL-- 105 IV++G+ T + +GD V + GG+AEY Sbjct: 65 IVEVGDGVTGFKVGDRVFVAPHVPCGECHYCLRGNENMCPNYKKFGNLYDGGFAEYVRVP 124 Query: 106 ---SHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSG-IGTT 161 +G L +P + +AA L E + A ++ G TVL+ G +G IG Sbjct: 125 AWAVKRGGVLKLPDNVSFEEAA-LVEPLACCINAQ-RKAGIKPGDTVLVIG--AGPIGLL 180 Query: 162 AIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILD 220 LA GA V + +E + KLGA + I+ +ED +E +++ T GRG D+++ Sbjct: 181 HAMLAKASGARKVIVSDLNEFRLEFAKKLGADYTIDAAEEDLVEKVRELTDGRGADVVIV 240 Query: 221 MVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGST 270 G+ E Q L L+ K G+++ L I+ N I + ITITGS Sbjct: 241 ATGSPEAQAQALELVRKGGRILFFGGLPKGSTVNIDPNLIHYREITITGSY 291 >gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADHs), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 333 Score = 119 bits (300), Expect = 1e-27 Identities = 84/278 (30%), Positives = 123/278 (44%), Gaps = 41/278 (14%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPIL-GLEVAGKIVDLGEN 81 L E +P P E+LIKVEA GV D ++G P P + G EV G+I +GE Sbjct: 15 LVERDVPLPGPGEVLIKVEACGVCHSDAFVKEGAMPGLS--YPRVPGHEVVGRIDAVGEG 72 Query: 82 TTHWNIGDEV-----------CA-------------LVNG----GGYAEYCLSHQGHTLP 113 + W +GD V C V G GGYAEY L+ Sbjct: 73 VSRWKVGDRVGVGWHGGHCGTCDACRRGDFVHCENGKVTGVTRDGGYAEYMLAPAEALAR 132 Query: 114 IPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHG-GSSGIGTTAIQLASYFGAT 172 IP +A +AA L + T + N + + + G V + G G G+G A+Q A+ G Sbjct: 133 IPDDLDAAEAAPLLCAGVTTF-NALRNSGAKPGDLVAVQGIG--GLGHLAVQYAAKMGFR 189 Query: 173 VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG-AEYLNQHL 231 ++ +K KLGA H I+ KED E LQ+ G G +IL A+ ++ + Sbjct: 190 TVAISRGSDKADLARKLGAHHYIDTSKEDVAEALQE--LG-GAKLILATAPNAKAISALV 246 Query: 232 TLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGS 269 L+ GKL+I+ G + ++ +I R +I G Sbjct: 247 GGLAPRGKLLILGAAGEPV--AVSPLQLIMGRKSIHGW 282 >gnl|CDD|31263 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]. Length = 350 Score = 117 bits (295), Expect = 4e-27 Identities = 94/364 (25%), Positives = 154/364 (42%), Gaps = 52/364 (14%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 M+ + Y + L E P P P ++LI+V A G+ D+ +G P + I Sbjct: 1 MKAAVV--YVGGGDVRLEEPPPPIPGPGDVLIRVTATGICGSDLHIYRGGEPFVPPGDII 58 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVCALVN------------------------------ 96 LG E G++V++G + +GD V N Sbjct: 59 LGHEFVGEVVEVGV-VRGFKVGDRVVVEPNIPCGHCRYCRAGEYNLCENPGFYGYAGLGG 117 Query: 97 --GGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGG 154 GG+AEY L +AA+L E T + + A +R G TV++ G Sbjct: 118 GIDGGFAEYVRVPADFNLAKLPDGIDEEAAALTEPLATAYHGHAERAAVRPGGTVVVVGA 177 Query: 155 SSGIGTTAIQLASYFGAT-VYTTAKSEEKC-LACLKLGAKHAINYLKEDFLEILQKETQG 212 IG AI LA GA+ V +S E+ LA GA +N ++D + + T G Sbjct: 178 GP-IGLLAIALAKLLGASVVIVVDRSPERLELAKEAGGADVVVNPSEDDAGAEILELTGG 236 Query: 213 RGIDIILDMVGAEY-LNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTL 271 RG D++++ VG+ L+Q L L G ++++ GG + ++SK +T+ GS Sbjct: 237 RGADVVIEAVGSPPALDQALEALRPGGTVVVVGVYGGED-IPLPAGLVVSKELTLRGSLR 295 Query: 272 RRRTDIAKQSIRDSLQLKIWPLLNSHVIAP--VIHTVLPLGKVAMAHDIM-EKSEHIGKI 328 + ++++ LL S I P +I LPL A A+++ ++ E K+ Sbjct: 296 PSGREDFERALD---------LLASGKIDPEKLITHRLPLDDAAEAYELFADRKEEAIKV 346 Query: 329 ILLP 332 +L P Sbjct: 347 VLKP 350 >gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members. Includes Human Mgc45594 gene product of undetermined function. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 329 Score = 117 bits (296), Expect = 4e-27 Identities = 75/227 (33%), Positives = 118/227 (51%), Gaps = 6/227 (2%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI-LGLEVAGKIVDLGEN 81 + + P+P P E+L+K +G+N D+ G Y P P G E G++V +GE Sbjct: 20 IVDVPVPLPGPGEVLVKNRFVGINASDINFTAGRYDPGV-KPPFDCGFEGVGEVVAVGEG 78 Query: 82 TTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTA 141 T + +GD V A ++ G +AEY + H +P+P+ + L S T L + Sbjct: 79 VTDFKVGDAV-ATMSFGAFAEYQVVPARHAVPVPEL--KPEVLPLLVSGLTASIALEEVG 135 Query: 142 NLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKED 201 ++SG+TVL+ + G G A+QLA G V T S+EK LG INY ED Sbjct: 136 EMKSGETVLVTAAAGGTGQFAVQLAKLAGCHVIGTCSSDEKAEFLKSLGCDRPINYKTED 195 Query: 202 FLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGG 248 E+L+KE +G+D++ + VG E + + L+ +G+LI+I F+ G Sbjct: 196 LGEVLKKEYP-KGVDVVYESVGGEMFDTCVDNLALKGRLIVIGFISG 241 >gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members. This group contains a structure identified as an arginate lyase. Other members are identified quinone reductases, alginate lyases, and other proteins related to the zinc-dependent dehydrogenases/reductases. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 336 Score = 116 bits (294), Expect = 7e-27 Identities = 96/346 (27%), Positives = 157/346 (45%), Gaps = 33/346 (9%) Query: 7 MRHVAMSGYGKS---NVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNA 63 M+ + + + + E P P P ++L++VEA+ VN D R G P P Sbjct: 1 MKAIGFTQPLPITDPDSLIDIELPKPVPGGRDLLVRVEAVSVNPVDTKVRAGGAPVPGQP 60 Query: 64 NPILGLEVAGKIVDLGENTTHWNIGDEVC---ALVNGGGYAEYCLSHQGHTLPIPKGYNA 120 ILG + +G + +G T + +GDEV + G AEY L + PK + Sbjct: 61 K-ILGWDASGVVEAVGSEVTLFKVGDEVYYAGDITRPGSNAEYQLVDERIVGHKPKSLSF 119 Query: 121 IQAASLPESFFTVWANLF-----QTANLRSGQTVLIHGGSSGIGTTAIQLAS-YFGATVY 174 +AA+LP + T W LF G+T+LI GG+ G+G+ AIQLA G TV Sbjct: 120 AEAAALPLTSLTAWEALFDRLGISEDAENEGKTLLIIGGAGGVGSIAIQLAKQLTGLTVI 179 Query: 175 TTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRG-IDIILDMVG-AEYLNQHLT 232 TA E +LGA H IN+ +D E Q E G +D I + ++ + Sbjct: 180 ATASRPESIAWVKELGADHVINH-HQDLAE--QLEALGIEPVDYIFCLTDTDQHWDAMAE 236 Query: 233 LLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR-----TDIAKQSIRDSLQ 287 L++ +G + +I + ++L P+ SK + + R D+ +Q + L Sbjct: 237 LIAPQGHICLIV----DPQEPLDLGPLKSKSASFHWEFMFTRSMFQTPDMIEQ--HEILN 290 Query: 288 LKIWPLLNSHVIAPVIHTVL-PLG--KVAMAHDIMEKSEHIGKIIL 330 ++ LL++ + + L P+ + AH ++E + IGKI+L Sbjct: 291 -EVADLLDAGKLKTTLTETLGPINAENLREAHALLESGKTIGKIVL 335 >gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Candida tropicalis enoyl thioester reductase (Etr1p) catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis. Etr1p forms homodimers with each subunit containing a nucleotide-binding Rossmann fold domain and a catalytic domain. Length = 323 Score = 116 bits (292), Expect = 1e-26 Identities = 86/318 (27%), Positives = 137/318 (43%), Gaps = 15/318 (4%) Query: 20 VMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYP--PPKNANPILGLEVAGKIVD 77 V+ L PIP P E+L+++ A +N D++ G Y PP A + G E G +V+ Sbjct: 13 VLELVSLPIPPPGPGEVLVRMLAAPINPSDLITISGAYGSRPPLPA--VPGNEGVGVVVE 70 Query: 78 LGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL---PESFFTVW 134 +G + +G V L G + EY ++ +P+P + QAA L P T W Sbjct: 71 VGSGVSGLLVGQRVLPLGGEGTWQEYVVAPADDLIPVPDSISDEQAAMLYINP---LTAW 127 Query: 135 ANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLK-LGAK 192 L + L G V+ + +S +G IQLA G T+ ++ + LK LGA Sbjct: 128 LMLTEYLKLPPGDWVIQNAANSAVGRMLIQLAKLLGFKTINVV--RRDEQVEELKALGAD 185 Query: 193 HAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252 I+ ED + +++ T G G + LD VG E + L G L+ L G Sbjct: 186 EVIDSSPEDLAQRVKEATGGAGARLALDAVGGESATRLARSLRPGGTLVNYGLLSGEPVP 245 Query: 253 EINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKV 312 + I K IT+ G LR+ A + + ++ L+ + V+ + PL Sbjct: 246 -FPRSVFIFKDITVRGFWLRQWLHSATKEAKQETFAEVIKLVEAGVLTTPVGAKFPLEDF 304 Query: 313 AMAHDIMEKSEHIGKIIL 330 A E+ GK++L Sbjct: 305 EEAVAAAEQPGRGGKVLL 322 >gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family. This group shares the zinc coordination sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 306 Score = 115 bits (289), Expect = 2e-26 Identities = 89/302 (29%), Positives = 137/302 (45%), Gaps = 39/302 (12%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 M+ + +G G NV L E P P+P E+LIKV A G+ D+ KG Y P + + Sbjct: 1 MKALVKTGPGPGNVE-LREVPEPEPGPGEVLIKVAAAGICGSDLHIYKGDYDPVE-TPVV 58 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEV-----------CALVN-----------------GG 98 LG E +G IV++G + W +GD V C G Sbjct: 59 LGHEFSGTIVEVGPDVEGWKVGDRVVSETTFSTCGRCPYCRRGDYNLCPHRKGIGTQADG 118 Query: 99 GYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGI 158 G+AEY L + +P+ + AA L E + + + +R G TV++ G I Sbjct: 119 GFAEYVLVPEESLHELPENLSLEAAA-LTEPLAVAVHAVAERSGIRPGDTVVVF-GPGPI 176 Query: 159 GTTAIQLASYFGATVY---TTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGI 215 G A Q+A GATV T +A +LGA +N +ED E++ + T G G Sbjct: 177 GLLAAQVAKLQGATVVVVGTEKDEVRLDVA-KELGADA-VNGGEEDLAELVNEITDGDGA 234 Query: 216 DIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR 274 D++++ GA L Q L LL K G+++ + + G +A I++ II K +++ GS Sbjct: 235 DVVIECSGAVPALEQALELLRKGGRIVQVG-IFGPLAASIDVERIIQKELSVIGSRSSTP 293 Query: 275 TD 276 Sbjct: 294 AS 295 >gnl|CDD|35246 KOG0023, KOG0023, KOG0023, Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism]. Length = 360 Score = 112 bits (282), Expect = 1e-25 Identities = 84/341 (24%), Positives = 147/341 (43%), Gaps = 55/341 (16%) Query: 27 PIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWN 86 P+ +P + ++L+K+E GV D+ KG + K + G E+AG +V +G N T + Sbjct: 30 PVREPGENDVLVKIEYCGVCHSDLHAWKGDWGLSK-YPLVPGHEIAGVVVKVGSNVTGFK 88 Query: 87 IGDEV----------------------CAL-------------VNGGGYAEYCLSHQGHT 111 IGD V C + GG+ EY + + Sbjct: 89 IGDRVGVGWLNGSCLSCEYCKSGNENYCPKMHFTYNGVYHDGTITQGGFQEYAVVDEVFA 148 Query: 112 LPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGA 171 + IP+ AA L + TV++ L + + L G+ V I G G+G A+Q A G Sbjct: 149 IKIPENLPLASAAPLLCAGITVYSPL-KRSGLGPGKWVGI-VGLGGLGHMAVQYAKAMGM 206 Query: 172 TVYTTAKSEEKCL-ACLKLGAKHAINYLKE-DFLEILQKETQGRGIDIILDMVGAEYLNQ 229 V + S +K A LGA ++ ++ D ++ + K T G GID + ++ L Sbjct: 207 RVTVISTSSKKKEEAIKSLGADVFVDSTEDPDIMKAIMKTTDG-GIDTVSNLAEHA-LEP 264 Query: 230 HLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLK 289 L LL G L+++ + +++ P+I R +I GS + R + +++L Sbjct: 265 LLGLLKVNGTLVLVGLPEKPL--KLDTFPLILGRKSIKGSIVGSRKE-----TQEALD-- 315 Query: 290 IWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330 + +I I V L +V A++ MEK + + ++ Sbjct: 316 ---FVARGLIKSPIELV-KLSEVNEAYERMEKGDVRYRFVV 352 >gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group has the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 345 Score = 110 bits (278), Expect = 5e-25 Identities = 76/296 (25%), Positives = 129/296 (43%), Gaps = 39/296 (13%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP- 65 MR +G+ + + E P P+P + ++++VEA GV R D +G P P Sbjct: 1 MRAAVYEEFGE--PLEIREVPDPEPPPDGVVVEVEACGVCRSDWHGWQG--HDPDVTLPH 56 Query: 66 ILGLEVAGKIVDLGENTTHWNIGDEVCA---LVNG------------------------G 98 + G E AG +V++GE+ + W +GD V L G G Sbjct: 57 VPGHEFAGVVVEVGEDVSRWRVGDRVTVPFVLGCGTCPYCRAGDSNVCEHQVQPGFTHPG 116 Query: 99 GYAEYCLSHQG-HTL-PIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSS 156 +AEY + L +P + + AA L F T + L A ++ G+ V +HG Sbjct: 117 SFAEYVAVPRADVNLVRLPDDVDFVTAAGLGCRFATAFRALVHQARVKPGEWVAVHGC-G 175 Query: 157 GIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINY-LKEDFLEILQKETQGRGI 215 G+G +A+ +AS GA V ++K +LGA +N ED ++ T G G Sbjct: 176 GVGLSAVMIASALGARVIAVDIDDDKLELARELGAVATVNASEVEDVAAAVRDLTGG-GA 234 Query: 216 DIILDMVG-AEYLNQHLTLLSKEGKLIIIS-FLGGNIATEINLNPIISKRITITGS 269 + +D +G E + L K G+ + + LG + ++ ++++ + I GS Sbjct: 235 HVSVDALGIPETCRNSVASLRKRGRHVQVGLTLGEEAGVALPMDRVVARELEIVGS 290 >gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases. This group contains proteins identified as sorbitol dehydrogenases and other sugar dehydrogenases of the medium-chain dehydrogenase/reductase family (MDR), which includes zinc-dependent alcohol dehydrogenase and related proteins. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Related proteins include threonine dehydrogenase, formaldehyde dehydrogenase, and butanediol dehydrogenase. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Horse liver alcohol dehydrogenase is a dimeric enzyme and each subunit has two domains. The NAD binding domain is in a Rossmann fold and the catalytic domain contains a zinc ion to which substrates bind. There is a cleft between the domains that closes upon formation of the ternary complex. Length = 343 Score = 109 bits (275), Expect = 1e-24 Identities = 93/359 (25%), Positives = 153/359 (42%), Gaps = 51/359 (14%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDV--MQRKGLYPPPKNAN 64 M+ + ++G G + + P P+P E+L+KV+A G+ D+ G Y PP Sbjct: 1 MKALVLTGPGD---LRYEDIPKPEPGPGEVLVKVKACGICGSDIPRYLGTGAYHPPL--- 54 Query: 65 PILGLEVAGKIVDLGENTTHWNIGDEV--CALVN-------------------------G 97 +LG E +G + ++G +GD V L+ Sbjct: 55 -VLGHEFSGTVEEVGSGVDDLAVGDRVAVNPLLPCGKCEYCKKGEYSLCSNYDYIGSRRD 113 Query: 98 GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSG 157 G +AEY + + IP + +AA + E + A + G TV++ G + Sbjct: 114 GAFAEYVSVPARNLIKIPDHVDYEEAA-MIEPAAVALHAVRL-AGITLGDTVVVIGAGT- 170 Query: 158 IGTTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGID 216 IG AIQ GA V +EK +LGA IN +ED +E +++ T+GRG D Sbjct: 171 IGLLAIQWLKILGAKRVIAVDIDDEKLAVARELGADDTINPKEED-VEKVRELTEGRGAD 229 Query: 217 IILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIA-TEINLNPIISKRITITGSTLRRR 274 ++++ G+ + Q L L GK++++ G++ +E I+ K +TI GS Sbjct: 230 LVIEAAGSPATIEQALALARPGGKVVLVGIPYGDVTLSEEAFEKILRKELTIQGSWNSYS 289 Query: 275 TDIAKQSIRDSLQLKIWPLLNSHVIA--PVIHTVLPLGKVAMA-HDIMEKSEHIGKIIL 330 R +L LL S I P+I LPL A + ++ E GK++L Sbjct: 290 APFPGDEWRTALD-----LLASGKIKVEPLITHRLPLEDGPAAFERLADREEFSGKVLL 343 >gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase. This group contains arabinose dehydrogenase (AraDH) and related alcohol dehydrogenases. AraDH is a member of the medium chain dehydrogenase/reductase family and catalyzes the NAD(P)-dependent oxidation of D-arabinose and other pentoses, the initial step in the metabolism of d-arabinose into 2-oxoglutarate. Like the alcohol dehydrogenases, AraDH binds a zinc in the catalytic cleft as well as a distal structural zinc. AraDH forms homotetramers as a dimer of dimers. AraDH replaces a conserved catalytic His with replace with Arg, compared to the canonical ADH site. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 340 Score = 109 bits (275), Expect = 1e-24 Identities = 80/301 (26%), Positives = 135/301 (44%), Gaps = 51/301 (16%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP- 65 M+ + YGK + L + P+P+P ++L++V GV D+ G P Sbjct: 1 MKAARLYEYGKP--LRLEDVPVPEPGPGQVLVRVGGAGVCHSDLHVIDG---VWGGILPY 55 Query: 66 ----ILGLEVAGKIVDLGENTTHWNIGDEVCALVNG------------------------ 97 LG E AG + ++G GD V +V+ Sbjct: 56 KLPFTLGHENAGWVEEVGSGVDGLKEGDPV--VVHPPWGCGTCRYCRRGEENYCENARFP 113 Query: 98 -----GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTAN-LRSGQTVLI 151 GG+AEY L + +P+G + ++AA L ++ T + + + L G TV++ Sbjct: 114 GIGTDGGFAEYLLVPSRRLVKLPRGLDPVEAAPLADAGLTAYHAVKKALPYLDPGSTVVV 173 Query: 152 HG-GSSGIGTTAIQLASYF-GATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKE 209 G G G+G A+Q+ ATV +SEE +LGA H +N +D +E +++ Sbjct: 174 IGVG--GLGHIAVQILRALTPATVIAVDRSEEALKLAERLGADHVLN-ASDDVVEEVREL 230 Query: 210 TQGRGIDIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITG 268 T GRG D ++D VG+ E L LL+K G+ +I+ GG+ + + ++ I++ G Sbjct: 231 TGGRGADAVIDFVGSDETLALAAKLLAKGGRYVIVG-YGGHG--RLPTSDLVPTEISVIG 287 Query: 269 S 269 S Sbjct: 288 S 288 >gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 337 Score = 106 bits (266), Expect = 1e-23 Identities = 78/297 (26%), Positives = 128/297 (43%), Gaps = 45/297 (15%) Query: 16 GKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGL-----YPPPKNANPILGLE 70 K + + + P P P E+L++V+ +G+ D+ G YP ILG E Sbjct: 7 EKPGRLEVVDIPEPVPGAGEVLVRVKRVGICGSDLHIYHGRNPFASYPR------ILGHE 60 Query: 71 VAGKIVDLGENTTHWNIGDEVC-----------ALVNG----------------GGYAEY 103 ++G++V++GE +GD V A G GG+AEY Sbjct: 61 LSGEVVEVGEGVAGLKVGDRVVVDPYISCGECYACRKGRPNCCENLQVLGVHRDGGFAEY 120 Query: 104 CLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAI 163 + L +P+G + QAA L E + A+ + A + +G TVL+ G + IG I Sbjct: 121 IVVPADA-LLVPEGLSLDQAA-LVE-PLAIGAHAVRRAGVTAGDTVLVVG-AGPIGLGVI 176 Query: 164 QLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG 223 Q+A GA V +E+ +LGA IN ED L++ T G G D+++D G Sbjct: 177 QVAKARGARVIVVDIDDERLEFARELGADDTINVGDEDVAARLRELTDGEGADVVIDATG 236 Query: 224 A-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAK 279 + + + L++ G+++++ G + K +TI GS R D Sbjct: 237 NPASMEEAVELVAHGGRVVLVGLSKGPVT--FPDPEFHKKELTILGSRNATREDFPD 291 >gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 329 Score = 106 bits (266), Expect = 1e-23 Identities = 78/268 (29%), Positives = 118/268 (44%), Gaps = 39/268 (14%) Query: 23 LAESPIPQPQKEEILIKVEAIGV---NRPDVMQRKGLYPPPKNAN-PILGLEVAGKIVDL 78 L E P+P+ + E+L++ + V R M Y PP P+ G V G++V+ Sbjct: 22 LVEVPLPELKDGEVLVRTLYLSVDPYMR-GWMSDAKSYSPPVQLGEPMRGGGV-GEVVE- 78 Query: 79 GENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTL-PIPKGYNAIQAASLPESFF------ 131 + + +GD V G+ EY + L + LP S + Sbjct: 79 -SRSPDFKVGDLVSGF---LGWQEYAVVDGASGLRKLDPSLG------LPLSAYLGVLGM 128 Query: 132 ---TVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK 188 T + L + + G+TV++ + +G+ Q+A GA V A S+EKC L Sbjct: 129 TGLTAYFGLTEIGKPKPGETVVVSAAAGAVGSVVGQIAKLLGARVVGIAGSDEKC-RWLV 187 Query: 189 --LGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII---I 243 LG AINY D E L++ GID+ D VG E L+ LTLL+K G++ + I Sbjct: 188 EELGFDAAINYKTPDLAEALKEAAPD-GIDVYFDNVGGEILDAALTLLNKGGRIALCGAI 246 Query: 244 SFLGGNIATE---INLNPIISKRITITG 268 S N NL II+KR+T+ G Sbjct: 247 S--QYNATEPPGPKNLGNIITKRLTMQG 272 >gnl|CDD|36416 KOG1202, KOG1202, KOG1202, Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism]. Length = 2376 Score = 105 bits (264), Expect = 1e-23 Identities = 71/303 (23%), Positives = 131/303 (43%), Gaps = 36/303 (11%) Query: 45 VNRPDVMQRKGLYPP---PKN---ANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGG 98 +N D+M G P P + + +LG+E +G+ G V +V Sbjct: 1456 LNFRDIMLASGKLSPDAIPGDLASQDCLLGMEFSGRDAS----------GRRVMGMVPAK 1505 Query: 99 GYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGI 158 A L+ + +P + +A+++P + T + L ++ G+ +LIH GS G+ Sbjct: 1506 SLATTVLASRDFLWEVPSKWTLEEASTVPVVYSTAYYALVVRGQMKKGEKILIHAGSGGV 1565 Query: 159 GTTAIQLASYFGATVYTTAKSEEKCLACL----KLGAKHAINYLKEDFLEILQKETQGRG 214 G AI +A G TV+TT S EK L +L + N F + + T+GRG Sbjct: 1566 GQAAIAIALAHGCTVFTTVGSAEKREFLLKRFPQLQETNFANSRDTSFEQHVLWHTKGRG 1625 Query: 215 IDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR 274 +D++L+ + E L + L+ G+ + I + + + + + K ++ G L Sbjct: 1626 VDLVLNSLAEEKLQASIRCLALHGRFLEIGKFDLSQNSPLGMA-VFLKNVSFHGILL--- 1681 Query: 275 TDIAKQSIRD---SLQLKIWPLL----NSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGK 327 S+ + + ++ L+ S V+ P+ TV +V A M +HIGK Sbjct: 1682 -----DSVMEGEEEMWREVAALVAEGIKSGVVRPLPTTVFHGQQVEDAFRFMASGKHIGK 1736 Query: 328 IIL 330 +++ Sbjct: 1737 VVI 1739 >gnl|CDD|32313 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only]. Length = 340 Score = 105 bits (263), Expect = 2e-23 Identities = 63/257 (24%), Positives = 112/257 (43%), Gaps = 18/257 (7%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI-LGLEVAGKIVDLGEN 81 L E +P+P + ++L++ + ++ P R + P A P+ LG + G V Sbjct: 29 LEEVDVPEPGEGQVLLRTLYLSLD-PY--MRGRMSDAPSYAPPVELGEVMVGGTVAKVVA 85 Query: 82 TTH--WNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAA--SLPESFFTVWANL 137 + H + GD V V G+ EY +S + + A L T + L Sbjct: 86 SNHPGFQPGDIV---VGVSGWQEYAISDGEGLRKLDPSPAPLSAYLGVLGMPGLTAYFGL 142 Query: 138 FQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK-LGAKHAIN 196 ++G+TV++ + +G+ Q+A G V A EKC + LG I+ Sbjct: 143 LDIGQPKAGETVVVSAAAGAVGSVVGQIAKLKGCRVVGIAGGAEKCDFLTEELGFDAGID 202 Query: 197 YLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINL 256 Y EDF + L++ +GID+ + VG E L+ L LL+ ++ + + A E+ Sbjct: 203 YKAEDFAQALKEAC-PKGIDVYFENVGGEVLDAVLPLLNLFARIPVCGAISQYNAPELPP 261 Query: 257 NP-----IISKRITITG 268 P +++KR+ + G Sbjct: 262 GPRRLPLLMAKRLRVQG 278 >gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family. This group resembles the zinc-dependent alcohol dehydrogenases of the medium chain dehydrogenase family. However, this subgroup does not contain the characteristic catalytic zinc site. Also, it contains an atypical structural zinc-binding pattern: DxxCxxCxxxxxxxC. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 325 Score = 101 bits (253), Expect = 3e-22 Identities = 88/318 (27%), Positives = 150/318 (47%), Gaps = 51/318 (16%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPD--VMQRKGLYPPPKNAN 64 M+ + G N+ + P+P E+LI+V+ GVN D V+ + P P Sbjct: 1 MKALVFEKSGIENLKVE-DVKDPKPGPGEVLIRVKMAGVNPVDYNVINAVKVKPMPH--- 56 Query: 65 PILGLEVAGKIVDLGENTTHWNIGDEV----------CAL---------VNG-------- 97 I G E AG + ++G++ GD V C + NG Sbjct: 57 -IPGAEFAGVVEEVGDHVKGVKKGDRVVVYNRVFDGTCDMCLSGNEMLCRNGGIIGVVSN 115 Query: 98 GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSG 157 GGYAEY + + + IP + AASLP + T + + +TA L G+TV++ G S Sbjct: 116 GGYAEYIVVPEKNLFKIPDSISDELAASLPVAALTAY-HALKTAGLGPGETVVVFGASGN 174 Query: 158 IGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINY--LKEDFLEILQKETQGRGI 215 G A+QLA GA V A S + L + GA ++Y ++E EI + Sbjct: 175 TGIFAVQLAKMMGAEVI--AVSRKDWLK--EFGADEVVDYDEVEEKVKEIT------KMA 224 Query: 216 DIILDMVGAEYLNQHLTLLSKEGKLIII-SFLGGNIATEINLNPIISKRITITGSTLRRR 274 D++++ +G+ + + L++L + G+L+ + GG + ++L+ + SK+I+I GST R Sbjct: 225 DVVINSLGSSFWDLSLSVLGRGGRLVTFGTLTGGEVK--LDLSDLYSKQISIIGSTGGTR 282 Query: 275 TDIAK-QSIRDSLQLKIW 291 ++ + I L++K+W Sbjct: 283 KELLELVKIAKDLKVKVW 300 >gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 329 Score = 98.0 bits (245), Expect = 3e-21 Identities = 66/203 (32%), Positives = 97/203 (47%), Gaps = 43/203 (21%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT 82 L E P+P+P E+LIKVEA GV R D+ +G PPPK I G E+ G++ +G Sbjct: 19 LTEVPVPEPGPGEVLIKVEACGVCRTDLHIVEGDLPPPK-LPLIPGHEIVGRVEAVGPGV 77 Query: 83 THWNIGDEV-----------C-------------ALVNG----GGYAEYCLSHQGHTLPI 114 T +++GD V C A G GGYAEY ++ + PI Sbjct: 78 TRFSVGDRVGVPWLGSTCGECRYCRSGRENLCDNARFTGYTVDGGYAEYMVADERFAYPI 137 Query: 115 PKGYNAIQAASLPESFFTVWANL-----FQTANLRSGQTVLIHG-GSSGIGTTAIQLASY 168 P+ Y+ +AA L + A + + A L+ GQ + ++G G+S A+Q+A Y Sbjct: 138 PEDYDDEEAAPL------LCAGIIGYRALKLAGLKPGQRLGLYGFGAS--AHLALQIARY 189 Query: 169 FGATVYTTAKSEEKCLACLKLGA 191 GA V+ +S E +LGA Sbjct: 190 QGAEVFAFTRSGEHQELARELGA 212 >gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)- dependent oxidation. THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria) and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Length = 341 Score = 96.5 bits (241), Expect = 9e-21 Identities = 102/357 (28%), Positives = 152/357 (42%), Gaps = 77/357 (21%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDV---------MQRKGLYPPPKNANPILGLEVAG 73 L E P+P+P E+LIKV A + DV R PP I G E AG Sbjct: 15 LVEVPVPKPGPGEVLIKVLAASICGTDVHIYEWDEWAQSRI---KPPL----IFGHEFAG 67 Query: 74 KIVDLGENTTHWNIGDEVCA---LVNGGGYAEYCLSHQGH-------------------- 110 ++V++GE T +GD V A +V G Y C + H Sbjct: 68 EVVEVGEGVTRVKVGDYVSAETHIVCGKCYQ--CRTGNYHVCQNTKILGVDTDGCFAEYV 125 Query: 111 TLP----------IPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSG-IG 159 +P IP +IQ L + TV ++ SG++VLI G G IG Sbjct: 126 VVPEENLWKNDKDIPPEIASIQE-PLGNAVHTV-----LAGDV-SGKSVLITG--CGPIG 176 Query: 160 TTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDII 218 AI +A GA V + + + K+GA IN +ED +E+ T G G+D++ Sbjct: 177 LMAIAVAKAAGASLVIASDPNPYRLELAKKMGADVVINPREEDVVEVK-SVTDGTGVDVV 235 Query: 219 LDMVGAEY-LNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDI 277 L+M G + Q L L+ G++ I+ G + ++N N +I K +T+ G T R+ + Sbjct: 236 LEMSGNPKAIEQGLKALTPGGRVSILGLPPGPVDIDLN-NLVIFKGLTVQGITGRKMFET 294 Query: 278 AKQSIRDSLQLKIWPLLNSHVI--APVIHTVLPLGKVAMAHDIMEKSEHIGKIILLP 332 Q LL S + +PVI LPL A ++M + GK++L P Sbjct: 295 WYQVSA---------LLKSGKVDLSPVITHKLPLEDFEEAFELMRSGK-CGKVVLYP 341 >gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Candida tropicalis enoyl thioester reductase (Etr1p) catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis. Etr1p forms homodimers, with each subunit containing a nucleotide-binding Rossmann fold domain and a catalytic domain. Length = 324 Score = 94.6 bits (236), Expect = 4e-20 Identities = 77/270 (28%), Positives = 117/270 (43%), Gaps = 12/270 (4%) Query: 7 MRHVAMSGYGKSNVMF---LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNA 63 M+ + + YGK + L E +P+P E+LIKVEA +N D+ KG Y K Sbjct: 1 MKALLLEEYGKPLEVKELSLPEPEVPEPGPGEVLIKVEAAPINPSDLGFLKGQYGSTKAL 60 Query: 64 NPILGLEVAGKIVDLGENTTHWN-IGDEVCALVNGGG-YAEYCLSHQGHTLPIPKGYNAI 121 G E +G +V G + IG V L G YAEY ++ LP+P G + Sbjct: 61 PVPPGFEGSGTVVAAGGGPLAQSLIGKRVAFLAGSYGTYAEYAVADAQQCLPLPDGVSFE 120 Query: 122 QAASLPESF---FTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAK 178 Q AS SF T + +TA + V+ +S +G ++L G V + Sbjct: 121 QGAS---SFVNPLTALG-MLETAREEGAKAVVHTAAASALGRMLVRLCKADGIKVINIVR 176 Query: 179 SEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEG 238 +E+ K+GA++ +N DFLE L++ I D VG Q L + Sbjct: 177 RKEQVDLLKKIGAEYVLNSSDPDFLEDLKELIAKLNATIFFDAVGGGLTGQILLAMPYGS 236 Query: 239 KLIIISFLGGNIATEINLNPIISKRITITG 268 L + +L G + I+ +I K +I G Sbjct: 237 TLYVYGYLSGKLDEPIDPVDLIFKNKSIEG 266 >gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 305 Score = 94.0 bits (234), Expect = 5e-20 Identities = 72/274 (26%), Positives = 112/274 (40%), Gaps = 19/274 (6%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 MR + + + E P PQP E L++V AI +NR ++ K P A P Sbjct: 1 MRALVVDPDAPLRLRL-GEVPDPQPAPHEALVRVAAISLNRGEL---KFAAERPDGAVP- 55 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASL 126 G + AG + + + +G V L G +AE G +P G + QAA+L Sbjct: 56 -GWDAAGVVERAAADGSGPAVGARVVGLGAMGAWAELVAVPTGWLAVLPDGVSFAQAATL 114 Query: 127 PESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLAC 186 P + T L + L G+ VL+ G S G+G A+QLA+ GA V S + Sbjct: 115 PVAGVTALRALRRGGPL-LGRRVLVTGASGGVGRFAVQLAALAGAHVVAVVGSPARAEGL 173 Query: 187 LKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFL 246 +LGA + E+ G +D+++D VG L + L LL+ G ++ + Sbjct: 174 RELGAAEVV----VGGSEL-----SGAPVDLVVDSVGGPQLARALELLAPGGTVVSVGSS 224 Query: 247 GGNIATEINLNPIISK--RITITGSTLRRRTDIA 278 G A N + + L +A Sbjct: 225 SGEPAV-FNPAAFVGGGGGRRLYTFFLYDGEPLA 257 >gnl|CDD|143884 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase. Length = 131 Score = 93.5 bits (233), Expect = 7e-20 Identities = 48/125 (38%), Positives = 70/125 (56%), Gaps = 3/125 (2%) Query: 157 GIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGI 215 G+G A+QLA GA V +SEEK +LGA H INY EDF+E +++ T GRG+ Sbjct: 1 GVGLAAVQLAKALGAARVIAVDRSEEKLELAKELGADHVINYRDEDFVERVRELTGGRGV 60 Query: 216 DIILDMVGA-EYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRR 274 D+++D VGA L Q L LL G+++++ GG L ++ K +TI GS R Sbjct: 61 DVVIDCVGAPATLEQALELLRPGGRVVVVGLPGGAP-VPFPLRDLLLKELTILGSLGGGR 119 Query: 275 TDIAK 279 + + Sbjct: 120 EEFEE 124 >gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 337 Score = 92.6 bits (231), Expect = 1e-19 Identities = 72/341 (21%), Positives = 134/341 (39%), Gaps = 79/341 (23%) Query: 29 PQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIG 88 +++ IK+ GV D+ + + P + G E+ G +V +G T + +G Sbjct: 20 RPLGPDDVDIKITYCGVCHSDLHTLRNEWGPT-KYPLVPGHEIVGIVVAVGSKVTKFKVG 78 Query: 89 DEV-----------------------------------CALVNGGGYAEYCLSHQGHTLP 113 D V + GGYA++ + + Sbjct: 79 DRVGVGCQVDSCGTCEQCKSGEEQYCPKGVVTYNGKYPDGTITQGGYADHIVVDERFVFK 138 Query: 114 IPKGYNAIQAASLPESFF---TVWANLFQTANLRSGQTVLIHG-GSSGIGTTAIQLASYF 169 IP+G ++ AA L TV++ L + + G+ V + G G G+G A++ A Sbjct: 139 IPEGLDSAAAAPL---LCAGITVYSPL-KRNGVGPGKRVGVVGIG--GLGHLAVKFAKAL 192 Query: 170 GATVY----TTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAE 225 GA V + +K E+ LKLGA I + ++ +D+I+D V A Sbjct: 193 GAEVTAFSRSPSKKED----ALKLGADEFIATKDPEAMKKAAGS-----LDLIIDTVSAS 243 Query: 226 Y-LNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRD 284 + L+ +L+LL G L+++ + + P+I R ++ GS + R + + Sbjct: 244 HDLDPYLSLLKPGGTLVLVGAPEEPL--PVPPFPLIFGRKSVAGSLIGGRKETQE----- 296 Query: 285 SLQLKIWPLLNS---HVIAPVIHTVLPLGKVAMAHDIMEKS 322 +L+ H I P + + P+ + A + +EK Sbjct: 297 --------MLDFAAEHGIKPWVEVI-PMDGINEALERLEKG 328 >gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine, via NAD(H)-dependent oxidation. THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Length = 334 Score = 92.6 bits (231), Expect = 1e-19 Identities = 73/279 (26%), Positives = 116/279 (41%), Gaps = 42/279 (15%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP-ILGLEVAGKIVDLGEN 81 + E P+P+P +E+LIKV A G+ D+ +G + A P + G E AG +V +G Sbjct: 14 VEEVPVPEPGPDEVLIKVAACGICGTDLHIYEGEFGA---APPLVPGHEFAGVVVAVGSK 70 Query: 82 TTHWNIGDEVCALVN-----------------------G----GGYAEYCLSHQGHTLPI 114 T + +GD V N G GG+AEY + I Sbjct: 71 VTGFKVGDRVAVDPNIYCGECFYCRRGRPNLCENLTAVGVTRNGGFAEYVVVPAKQVYKI 130 Query: 115 PKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLA-SYFGATV 173 P + +AA L E + ++ G +VL+ G IG QL + V Sbjct: 131 PDNLSFEEAA-LAEPLSCA-VHGLDLLGIKPGDSVLVFGAGP-IGLLLAQLLKLNGASRV 187 Query: 174 YTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG-AEYLNQHLT 232 +EEK KLGA ++ +ED QKE G D++++ G + L Q + Sbjct: 188 TVAEPNEEKLELAKKLGATETVDPSRED--PEAQKEDNPYGFDVVIEATGVPKTLEQAIE 245 Query: 233 LLSKEGKLIIISFLGGNIATEINLNP--IISKRITITGS 269 + G +++ F ++++P I K +TI GS Sbjct: 246 YARRGGTVLV--FGVYAPDARVSISPFEIFQKELTIIGS 282 >gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. Length = 312 Score = 91.6 bits (228), Expect = 3e-19 Identities = 66/229 (28%), Positives = 107/229 (46%), Gaps = 13/229 (5%) Query: 23 LAESPIPQPQKEEILIKVEAIGV---NRPDVMQ-RKGLYPPPKNANPILGLEVAGKIVDL 78 + E P P P ++L++VE GV + P Q R P + P G E G++V L Sbjct: 9 VEEHPRPTPGPGQVLVRVEGCGVCGSDLPAFNQGRPWFVYPAEPGGP--GHEGWGRVVAL 66 Query: 79 GENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLF 138 G +GD V L GG +AEY L+ H +P+P + + P N+F Sbjct: 67 GPGVRGLAVGDRVAGLS-GGAFAEYDLADADHAVPLPS---LLDGQAFPGEPLGCALNVF 122 Query: 139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK-LGAKHAINY 197 + +R+G+TV + G IG +QLA+ GA LA + LGA + Sbjct: 123 RRGWIRAGKTVAVIGAGF-IGLLFLQLAAAAGARRVIAIDRRPARLALARELGATEVVTD 181 Query: 198 LKEDFLEILQKETQGRGIDIILDMVG-AEYLNQHLTLLSKEGKLIIISF 245 E +E +++ T G G D++++ VG L+ L+++ G+L+I + Sbjct: 182 DSEAIVERVRELTGGAGADVVIEAVGHQWPLDLAGELVAERGRLVIFGY 230 >gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase. Crotonyl-CoA reductase, a member of the medium chain dehydrogenase/reductase family, catalyzes the NADPH-dependent conversion of crotonyl-CoA to butyryl-CoA, a step in (2S)-methylmalonyl-CoA production for straight-chain fatty acid biosynthesis. Like enoyl reductase, another enzyme in fatty acid synthesis, crotonyl-CoA reductase is a member of the zinc-dependent alcohol dehydrogenase-like medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 393 Score = 90.6 bits (225), Expect = 5e-19 Identities = 63/218 (28%), Positives = 90/218 (41%), Gaps = 47/218 (21%) Query: 27 PIPQPQKEEILIKVEAIGVN---------RP----DVMQRKGLYPPPKNANPILGLEVAG 73 P+P+ E+L+ V A GVN P QR+G P I G + +G Sbjct: 36 PVPELGPGEVLVAVMAAGVNYNNVWAALGEPVSTFAARQRRGRDEPYH----IGGSDASG 91 Query: 74 KIVDLGENTTHWNIGDEV---CALVNG-------------------------GGYAEYCL 105 + +GE +W +GDEV C++ +G G +A++ L Sbjct: 92 IVWAVGEGVKNWKVGDEVVVHCSVWDGNDPERAGGDPMFDPSQRIWGYETNYGSFAQFAL 151 Query: 106 SHQGHTLPIPKGYNAIQAASLPESFFTVWANLF--QTANLRSGQTVLIHGGSSGIGTTAI 163 +P PK + +AA+ T + LF ++ G VLI G S G+G+ AI Sbjct: 152 VQATQLMPKPKHLSWEEAAAYMLVGATAYRMLFGWNPNTVKPGDNVLIWGASGGLGSMAI 211 Query: 164 QLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKED 201 QLA GA SEEK C LGA+ IN D Sbjct: 212 QLARAAGANPVAVVSSEEKAEYCRALGAEGVINRRDFD 249 >gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains, at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Candida tropicalis enoyl thioester reductase (Etr1p) catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis. Etr1p forms homodimers, with each subunit containing a nucleotide-binding Rossmann fold domain and a catalytic domain. Length = 324 Score = 90.1 bits (224), Expect = 8e-19 Identities = 73/329 (22%), Positives = 135/329 (41%), Gaps = 11/329 (3%) Query: 7 MRHVAMSGYGK-SNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65 MR + +G ++V+ + E P P P E+L++ ++ D+ +G Y Sbjct: 1 MRAAVHTQFGDPADVLEIGEVPKPTPGAGEVLVRTTLSPIHNHDLWTIRGTYGYKPELPA 60 Query: 66 ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYN---AIQ 122 I G E G + +GE +G V G +AEY ++ +P+P G + A Q Sbjct: 61 IGGSEAVGVVDAVGEGVKGLQVGQRVAVAPVHGTWAEYFVAPADGLVPLPDGISDEVAAQ 120 Query: 123 AASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182 ++P S L ++ GQ ++ + +G LA+ G V + + Sbjct: 121 LIAMPLSA----LMLLDFLGVKPGQWLIQNAAGGAVGKLVAMLAAARGINVINLVRRDAG 176 Query: 183 CLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLII 242 LG ++ + + + +++ G I + LD VG + + L+LL + G L+ Sbjct: 177 VAELRALGIGPVVSTEQPGWQDKVREAAGGAPISVALDSVGGKLAGELLSLLGEGGTLVS 236 Query: 243 ISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPL-LNSHVIAP 301 + G +I+ +I K+ T+ G R + R + ++ L L ++ P Sbjct: 237 FGSMSGEP-MQISSGDLIFKQATVRGFWGGRWSQEMSVEYRKRMIAELLTLALKGQLLLP 295 Query: 302 VIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330 V V LG A A + GK++L Sbjct: 296 V-EAVFDLGDAAKAAAASMRPGRAGKVLL 323 >gnl|CDD|31262 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion]. Length = 366 Score = 89.5 bits (222), Expect = 1e-18 Identities = 80/356 (22%), Positives = 125/356 (35%), Gaps = 67/356 (18%) Query: 28 IPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNI 87 + P+ E+L+++ A GV D G P A +LG E AG + +GE T Sbjct: 22 LDPPRAGEVLVRITATGVCHTDAHTLSGDDPEGFPA--VLGHEGAGIVEAVGEGVTSVKP 79 Query: 88 GDEV-------------------------------CALVNG-----------------GG 99 GD V + +G Sbjct: 80 GDHVILLFTPECGQCKFCLSGKPNLCEAIRATQGKGTMPDGTTRLSGNGVPVYHYLGCST 139 Query: 100 YAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIG 159 +AEY + H+ + I +A L T + TA + G TV + G G+G Sbjct: 140 FAEYTVVHEISLVKIDPDAPLEKACLLGCGVTTGIGAVVNTAKVEPGDTVAVF-GLGGVG 198 Query: 160 TTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDII 218 AIQ A GA + + EK K GA H +N + D + E G D Sbjct: 199 LAAIQGAKAAGAGRIIAVDINPEKLELAKKFGATHFVNPKEVDDVVEAIVELTDGGADYA 258 Query: 219 LDMVG-AEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPI-ISKRITITGSTL---RR 273 + VG E + Q L + G +II EI+ P + GS R Sbjct: 259 FECVGNVEVMRQALEATHRGGTSVIIGV--AGAGQEISTRPFQLVTGRVWKGSAFGGARP 316 Query: 274 RTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKII 329 R+DI + + + K+ + ++ +PL + A D+M + + I +I Sbjct: 317 RSDIPRL-VDLYMAGKL-------PLDRLVTHTIPLEDINEAFDLMHEGKSIRSVI 364 >gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast. This group contains members identified in targeting of yeast membrane proteins ATPase. AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast, identified as a multicopy suppressor of pma1 mutants which cause temperature sensitive growth arrest due to the inability of ATPase to target to the cell surface. This family is homologous to the medium chain family of dehydrogenases and reductases. Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 352 Score = 88.9 bits (221), Expect = 2e-18 Identities = 65/221 (29%), Positives = 94/221 (42%), Gaps = 27/221 (12%) Query: 25 ESPIP-QPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI-LGLEVAGKIVDLGENT 82 + P+P + EI++KV A +N D+ Y LG + +G IV +G N Sbjct: 19 KLPLPNCYKDNEIVVKVHAAALNPVDLKLYNS-YTFHFKVKEKGLGRDYSGVIVKVGSNV 77 Query: 83 -THWNIGDEVCAL---VNG--GGYAEYCL-----SHQGHTLPIPKGYNAIQAASLPESFF 131 + W +GDEVC + G G ++Y L + T P+ + +AA+ P Sbjct: 78 ASEWKVGDEVCGIYPHPYGGQGTLSQYLLVDPKKDKKSIT-RKPENISLEEAAAWPLVLG 136 Query: 132 TVWANLFQT-ANLRSGQTVLIHGGSSGIGTTAIQLASYFGA--TVYTTA--KSEEKCLAC 186 T + L L VL+ GGS+ +G AIQLA TV T +S E Sbjct: 137 TAYQILEDLGQKLGPDSKVLVLGGSTSVGRFAIQLAKNHYNIGTVVGTCSSRSAEL---N 193 Query: 187 LKLGAKHAINYLKED----FLEILQKETQGRGIDIILDMVG 223 KLGA H I+Y +L+ D+ILD VG Sbjct: 194 KKLGADHFIDYDAHSGVKLLKPVLENVKGQGKFDLILDCVG 234 >gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase. 6-hydroxyhexanoate dehydrogenase, an enzyme of the zinc-dependent alcohol dehydrogenase-like family of medium chain dehydrogenases/reductases catalyzes the conversion of 6-hydroxyhexanoate and NAD(+) to 6-oxohexanoate + NADH and H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains, at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 350 Score = 86.9 bits (216), Expect = 8e-18 Identities = 75/310 (24%), Positives = 120/310 (38%), Gaps = 60/310 (19%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLY--------- 57 M+ A+ GK + E P+P E+L+KV A GV D+ G Y Sbjct: 1 MKAAAVVEPGKP--LEEVEIDTPKPPGTEVLVKVTACGVCHSDLHIWDGGYDLGGGKTMS 58 Query: 58 ------PPPKNANPILGLEVAGKIVDLGENTTHWNIGDEV-------------------- 91 P +LG E+ G++V +G + +GD+V Sbjct: 59 LDDRGVKLPL----VLGHEIVGEVVAVGPDAADVKVGDKVLVYPWIGCGECPVCLAGDEN 114 Query: 92 -CA------LVNGGGYAEYCL-SHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANL 143 CA + GGYAEY + H + + G + AA+L S T ++ + + Sbjct: 115 LCAKGRALGIFQDGGYAEYVIVPHSRYLVDPG-GLDPALAATLACSGLTAYSAV-KKLMP 172 Query: 144 RSGQT--VLIHGGSSGIGTTAIQLASYFGATVYTTA-KSEEKCLACLKLGAKHAINYLKE 200 V+I G+ G+G A+ L G E K A GA +N Sbjct: 173 LVADEPVVII--GAGGLGLMALALLKALGPANIIVVDIDEAKLEAAKAAGADVVVNGSDP 230 Query: 201 DFLEILQKETQGRGIDIILDMVGAE-YLNQHLTLLSKEGKLIIISFLGGNIATEINLNPI 259 D + + K G G+D ++D V + +L+K GKL+++ GG + L + Sbjct: 231 DAAKRIIKAAGG-GVDAVIDFVNNSATASLAFDILAKGGKLVLVGLFGGEA--TLPLPLL 287 Query: 260 ISKRITITGS 269 + +TI GS Sbjct: 288 PLRALTIQGS 297 >gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Length = 351 Score = 84.5 bits (210), Expect = 3e-17 Identities = 70/297 (23%), Positives = 117/297 (39%), Gaps = 50/297 (16%) Query: 15 YGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPP---PKNANP------ 65 +G+ ++ E P P + E+ IKV G+ D+ + L P P +P Sbjct: 7 HGRKDIRV-EEVPEPPVKPGEVKIKVAWCGICGSDLHEY--LDGPIFIPTEGHPHLTGET 63 Query: 66 ---ILGLEVAGKIVDLGENTTHWNIGDEVCA----------------------------L 94 LG E +G +V++G T + +GD V Sbjct: 64 APVTLGHEFSGVVVEVGSGVTGFKVGDRVVVEPTIKCGTCGACKRGLYNLCDSLGFIGLG 123 Query: 95 VNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGG 154 GGG+AEY + H +P +AA L E W + + + + G T L+ G Sbjct: 124 GGGGGFAEYVVVPAYHVHKLPDNVPLEEAA-LVEPLAVAW-HAVRRSGFKPGDTALVLGA 181 Query: 155 SSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGR 213 IG I GA+ + + SE + +LGA ++ + D + ++K T G Sbjct: 182 GP-IGLLTILALKAAGASKIIVSEPSEARRELAEELGATIVLDPTEVDVVAEVRKLTGGG 240 Query: 214 GIDIILDMVGAEY-LNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGS 269 G+D+ D G + L+ + L G + ++ I N N ++ K T+TGS Sbjct: 241 GVDVSFDCAGVQATLDTAIDALRPRGTAVNVAIWEKPI--SFNPNDLVLKEKTLTGS 295 >gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase. Glutathione-dependent formaldehyde dehydrogenases (FDHs, Class III ADH) are members of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. Class III ADH are also known as glutathione-dependent formaldehyde dehydrogenase (FDH), which convert aldehydes to corresponding carboxylic acid and alcohol. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 363 Score = 84.5 bits (210), Expect = 4e-17 Identities = 77/308 (25%), Positives = 118/308 (38%), Gaps = 63/308 (20%) Query: 28 IPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNI 87 + P E+L+++ A G+ D+ G P P A +LG E AG + ++G T Sbjct: 20 LDDPGPGEVLVRIAAAGLCHSDLHVVTGDLPAPLPA--VLGHEGAGVVEEVGPGVTGVKP 77 Query: 88 GDEV---------------------CALVNG--------------------------GGY 100 GD V C L G G + Sbjct: 78 GDHVVLSWIPACGTCRYCSRGQPNLCDLGAGILGGQLPDGTRRFTADGEPVGAMCGLGTF 137 Query: 101 AEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHG-GSSGIG 159 AEY + + + I +AA L T + TA +R G TV + G G G+G Sbjct: 138 AEYTVVPEASVVKIDDDIPLDRAALLGCGVTTGVGAVVNTARVRPGDTVAVIGCG--GVG 195 Query: 160 TTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDII 218 AIQ A GA + EK + GA H +N ++D +E ++ T GRG D Sbjct: 196 LNAIQGARIAGASRIIAVDPVPEKLELARRFGATHTVNASEDDAVEAVRDLTDGRGADYA 255 Query: 219 LDMVG-AEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPII----SKRI--TITGSTL 271 + VG A + Q L + K G +++ G ++L + KR+ ++ GS Sbjct: 256 FEAVGRAATIRQALAMTRKGGTAVVVG--MGPPGETVSLPALELFLSEKRLQGSLYGSA- 312 Query: 272 RRRTDIAK 279 R DI + Sbjct: 313 NPRRDIPR 320 >gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains, at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Candida tropicalis enoyl thioester reductase (Etr1p) catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis. Etr1p forms homodimers, with each subunit containing a nucleotide-binding Rossmann fold domain and a catalytic domain. Length = 341 Score = 79.2 bits (196), Expect = 2e-15 Identities = 75/315 (23%), Positives = 125/315 (39%), Gaps = 26/315 (8%) Query: 13 SGYGK-SNVMFLAESPIPQPQ-KEEILIKVEAIGVNRPDVMQRKGLYP--PPKNANP--I 66 + +G+ V+ L IP P E+L+K+ A +N D+ Q +G+YP PP P + Sbjct: 7 TEHGEPKEVLQLESYEIPPPGPPNEVLVKMLAAPINPADINQIQGVYPIKPPTTPEPPAV 66 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVCALVNGGG-YAEYCLSHQGHTLPIPKGYNAIQAAS 125 G E G++V +G GD V L G G + + + + +P + QAA+ Sbjct: 67 GGNEGVGEVVKVGSGVKSLKPGDWVIPLRPGLGTWRTHAVVPADDLIKVPNDVDPEQAAT 126 Query: 126 LPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATV---------YTT 176 L + T + L L+ G V+ +G +S +G IQLA G Sbjct: 127 LSVNPCTAYRLLEDFVKLQPGDWVIQNGANSAVGQAVIQLAKLLGIKTINVVRDRPDLEE 186 Query: 177 AKSEEKCLACLKLGAKHAINY---LKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTL 233 K K LGA H + E+L K G + L+ VG + + L Sbjct: 187 LKERLK-----ALGADHVLTEEELRSLLATELL-KSAPGGRPKLALNCVGGKSATELARL 240 Query: 234 LSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPL 293 LS G ++ + G + + +I K IT+ G L R A ++ + ++ L Sbjct: 241 LSPGGTMVTYGGMSGQ-PVTVPTSLLIFKDITLRGFWLTRWLKRANPEEKEDMLEELAEL 299 Query: 294 LNSHVIAPVIHTVLP 308 + + + Sbjct: 300 IREGKLKAPPVEKVT 314 >gnl|CDD|36410 KOG1196, KOG1196, KOG1196, Predicted NAD-dependent oxidoreductase [General function prediction only]. Length = 343 Score = 75.3 bits (185), Expect = 2e-14 Identities = 62/233 (26%), Positives = 94/233 (40%), Gaps = 36/233 (15%) Query: 56 LYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQ--GHTLP 113 PP + PI G V K++D G ++ GD V +V G+ EY + Sbjct: 65 YAPPYEPGKPIDGFGV-AKVIDSGH--PNYKKGDLVWGIV---GWEEYSVITPNDLEHFK 118 Query: 114 IPKGYNAIQAASLPESFF---------TVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQ 164 I + +P S++ T +A ++ + + G+TV + S +G Q Sbjct: 119 IQHPTD------VPLSYYLGLLGMPGLTAYAGFYEICSPKKGETVFVSAASGAVGQLVGQ 172 Query: 165 LASYFGATVYTTAKSEEKCLACL-KLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG 223 A G V +A S+EK K G A NY +E L K GIDI + VG Sbjct: 173 FAKLMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLSAALKRCFPEGIDIYFENVG 232 Query: 224 AEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNP--------IISKRITITG 268 + L+ L ++ G++ + G I+ NP II KRI I G Sbjct: 233 GKMLDAVLLNMNLHGRIA----VCGMISQYNLENPEGLHNLSTIIYKRIRIQG 281 >gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like. MDR/AHD-like proteins, including a protein annotated as a threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)-dependent oxidation. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Zinc-dependent ADHs are medium chain dehydrogenase/reductase type proteins (MDRs) and have a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. In addition to alcohol dehydrogenases, this group includes quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 339 Score = 75.0 bits (185), Expect = 2e-14 Identities = 74/279 (26%), Positives = 113/279 (40%), Gaps = 39/279 (13%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT 82 L E P+P P E+L++V+A G+ D+ + P I G E AG +V +G Sbjct: 14 LREFPVPVPGPGEVLLRVKASGLCGSDLHYYYHGHRAPAYQGVIPGHEPAGVVVAVGPGV 73 Query: 83 THWNIGDEV-------CALVNG---------------------GGYAEYCLSHQGHTLPI 114 TH+ +GD V C GG+AEY L + +P+ Sbjct: 74 THFRVGDRVMVYHYVGCGACRNCRRGWMQLCTSKRAAYGWNRDGGHAEYMLVPEKTLIPL 133 Query: 115 PKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHG-GSSGIGTTAIQLASYFGAT- 172 P + A L T + L + + TVL+ G G G+G LA GA Sbjct: 134 PDDLSFADGALLLCGIGTAYHAL-RRVGVSGRDTVLVVGAGPVGLGALM--LARALGAED 190 Query: 173 VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYL-NQHL 231 V S E+ LGA IN ++D EI ++ T G G D+ ++ G L Sbjct: 191 VIGVDPSPERLELAKALGADFVINSGQDDVQEI-RELTSGAGADVAIECSGNTAARRLAL 249 Query: 232 TLLSKEGKLIIISFLGGNIATEINLNP-IISKRITITGS 269 + G+L+ +G I ++ +I K+ T+ GS Sbjct: 250 EAVRPWGRLV---LVGEGGELTIEVSNDLIRKQRTLIGS 285 >gnl|CDD|35248 KOG0025, KOG0025, KOG0025, Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription, Energy production and conversion]. Length = 354 Score = 70.7 bits (173), Expect = 5e-13 Identities = 74/344 (21%), Positives = 136/344 (39%), Gaps = 18/344 (5%) Query: 1 MPICKKMRHVAMSGYGK-SNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYP- 58 + + + + S +G + V+ L +P ++L+K+ A +N D+ Q +G+YP Sbjct: 14 SQMPARSKALVYSEHGDPAKVLQLKNLELPAVPGSDVLVKMLAAPINPSDINQIQGVYPV 73 Query: 59 -PPKNANPILGLEVAGKIVDLGENTTHWNIGDEVCAL-VNGGGYAEYCLSHQGHTLPIPK 116 P A + G E G++V +G N + GD V L N G + + + + + K Sbjct: 74 RPELPA--VGGNEGVGEVVAVGSNVKGFKPGDWVIPLSANLGTWRTEAVFSESDLIKVDK 131 Query: 117 GYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFG----AT 172 AA+L + T + L L G +V+ +G +SG+G IQLA G Sbjct: 132 DIPLASAATLSVNPCTAYRMLKDFVQLNKGDSVIQNGANSGVGQAVIQLAKALGIKTINV 191 Query: 173 VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLT 232 V EE LGA I + ++ + + + L+ VG + + Sbjct: 192 VRDRPNIEELKKQLKSLGATEVITEEELRDRKMKKFKGDNPRPRLALNCVGGKSATEIAR 251 Query: 233 LLSKEGKLIIISFLGG--NIATEINLNPIISKRITITGSTLRRRTDIAKQS-IRDSLQLK 289 L + G ++ GG + + +I K + + G + R K R + + Sbjct: 252 YLERGGTMVT---YGGMSKQPVTVPTSLLIFKDLKLRGFWVTRWKKEHKSPEERKEMIDE 308 Query: 290 IWPLLNSHVIAPVIHTVLPLGKVAMAHD--IMEKSEHIGKIILL 331 + L + +PL A D + + + +II+L Sbjct: 309 LCDLYRRGKLKAPNCEKVPLADHKTALDAALSKFGKSGKQIIVL 352 >gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH). This group contains the hypothetical TM0436 alcohol dehydrogenase from Thermotoga maritima, proteins annotated as 5-exo-alcohol dehydrogenase, and other members of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. MDR, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. Length = 361 Score = 69.6 bits (171), Expect = 1e-12 Identities = 72/298 (24%), Positives = 109/298 (36%), Gaps = 60/298 (20%) Query: 25 ESPIPQPQKEEILIKVEAIGVNRPDVMQRKG---LYPPPKNANPILGLEVAGKIVDLG-E 80 E P+P + +L++V GV DV G P P ILG E G++V LG Sbjct: 17 EVPLPDLEPGAVLVRVRLAGVCGSDVHTVAGRRPRVPLPI----ILGHEGVGRVVALGGG 72 Query: 81 NTTHWN-----IGDEV---------------------CALV-------------NGGGYA 101 TT +GD V C GGYA Sbjct: 73 VTTDVAGEPLKVGDRVTWSVGAPCGRCYRCLVGDPTKCENRKKYGHEASCDDPHLSGGYA 132 Query: 102 EYCLSHQG-HTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRS-GQTVLIHGGSSGIG 159 E+ G + +P AA + TV A G TV++ G+ +G Sbjct: 133 EHIYLPPGTAIVRVPDNVPDEVAAPANCALATV-LAALDRAGPVGAGDTVVVQ-GAGPLG 190 Query: 160 TTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAIN---YLKEDFLEILQKETQGRGI 215 A+ A GA V S E+ + GA I+ I++ T GRG Sbjct: 191 LYAVAAAKLAGARRVIVIDGSPERLELAREFGADATIDIDELPDPQRRAIVRDITGGRGA 250 Query: 216 DIILDMVG-AEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNP--IISKRITITGST 270 D++++ G + + L LL + G +++ + A + L+P I+ K +TI G Sbjct: 251 DVVIEASGHPAAVPEGLELLRRGGTYVLVGSVAP--AGTVPLDPERIVRKNLTIIGVH 306 >gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Aldose reductase catalyzes the NADP(H)-dependent conversion of glucose to sorbital, and SDH uses NAD(H) in the conversion of sorbitol to fructose. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 343 Score = 67.5 bits (166), Expect = 4e-12 Identities = 79/291 (27%), Positives = 122/291 (41%), Gaps = 54/291 (18%) Query: 21 MFLAESPIPQPQKEEILIKVEAIGVNRPDV----MQRKGLYPPPKNANP-ILGLEVAGKI 75 + L E PIP+P E+L++V A+G+ DV R G + + P +LG E AG + Sbjct: 10 LRLEERPIPEPGPGEVLVRVRAVGICGSDVHYYKHGRIGDFVVKE---PMVLGHESAGTV 66 Query: 76 VDLGENTTHWNIGDEVCALVNGG---GYAEYCLSHQGH-----------TLPIPKG---- 117 V +G TH +GD V + G E+C S G T P+ G Sbjct: 67 VAVGSGVTHLKVGDRVA--IEPGVPCRTCEFCKS--GRYNLCPDMRFAATPPVD-GTLCR 121 Query: 118 YNAIQAA---SLPESFFTVWANLF----------QTANLRSGQTVLIHGGSSG-IGTTAI 163 Y A LP++ L + A +R G TVL+ G +G IG Sbjct: 122 YVNHPADFCHKLPDNVSLEEGALVEPLSVGVHACRRAGVRPGDTVLVFG--AGPIGLLTA 179 Query: 164 QLASYFGAT-VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEI---LQKETQGRGIDIIL 219 +A FGAT V T + +LGA H +N ED E + + G+G D+++ Sbjct: 180 AVAKAFGATKVVVTDIDPSRLEFAKELGATHTVNVRTEDTPESAEKIAELLGGKGPDVVI 239 Query: 220 DMVGAEY-LNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGS 269 + GAE + + G ++++ +G T + L+ + I I G Sbjct: 240 ECTGAESCIQTAIYATRPGGTVVLVG-MGKPEVT-LPLSAASLREIDIRGV 288 >gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2. Glutathione-dependent formaldehyde dehydrogenases (FDHs) are members of the zinc-dependent/medium chain alcohol dehydrogenase family. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. These tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 344 Score = 67.3 bits (165), Expect = 5e-12 Identities = 91/369 (24%), Positives = 148/369 (40%), Gaps = 68/369 (18%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQ-KEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65 M+ V G G V E PIPQ Q + ++KV A + D+ +G P Sbjct: 1 MKAVVFKGPGDVRV---EEVPIPQIQDPTDAIVKVTAAAICGSDLHIYRGHIPSTPGF-- 55 Query: 66 ILGLEVAGKIVDLGENTTHWNIGDEV---------------------CALVN-------- 96 +LG E G++V++G +GD V CA Sbjct: 56 VLGHEFVGEVVEVGPEVRTLKVGDRVVSPFTIACGECFYCRRGQSGRCAKGGLFGYAGSP 115 Query: 97 --GGGYAEYCL-SHQGHTL-PIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIH 152 G AEY TL +P G + A L + T + + A +R G TV + Sbjct: 116 NLDGAQAEYVRVPFADGTLLKLPDGLSDEAALLLGDILPTGYFGA-KRAQVRPGDTVAVI 174 Query: 153 GGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQ 211 G +G A+ A GA V+ E+ LGA IN+ + +E +++ T+ Sbjct: 175 GCGP-VGLCAVLSAQVLGAARVFAVDPVPERLERAAALGA-EPINFEDAEPVERVREATE 232 Query: 212 GRGIDIILDMVG-AEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPI--ISKRITITG 268 GRG D++L+ VG A L+ L+ G +IS +G + A E + +K +T+ Sbjct: 233 GRGADVVLEAVGGAAALDLAFDLVRPGG---VISSVGVHTAEEFPFPGLDAYNKNLTL-- 287 Query: 269 STLRRRTDIAK---QSIRDSLQLKIWPLLNSHVIAP--VIHTVLPLGKVAMAHDIMEKSE 323 + +S+ L PLL S + +I +PL + A+ + +K + Sbjct: 288 -------RFGRCPVRSLFPEL----LPLLESGRLDLEFLIDHRMPLEEAPEAYRLFDKRK 336 Query: 324 HIGKIILLP 332 + K++L P Sbjct: 337 -VLKVVLDP 344 >gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family. This group has the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. Length = 350 Score = 66.3 bits (162), Expect = 1e-11 Identities = 89/359 (24%), Positives = 133/359 (37%), Gaps = 73/359 (20%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGL--------YPPPKNANPILGLEVAGK 74 L E P+P+P EIL+KVEA G+ D+ G PP I G E G+ Sbjct: 14 LEEVPVPRPGPGEILVKVEACGICAGDIKCYHGAPSFWGDENQPPYVKPPMIPGHEFVGR 73 Query: 75 IVDLGENTTHWN--IGDEV----------CALVNGGGY-------------------AEY 103 +V+LGE +GD V C N G Y AEY Sbjct: 74 VVELGEGAEERGVKVGDRVISEQIVPCWNCRFCNRGQYWMCQKHDLYGFQNNVNGGMAEY 133 Query: 104 ------CLSHQ-GHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHG-GS 155 + H+ +P AI L + V AN++ V++ G G Sbjct: 134 MRFPKEAIVHKVPDDIPPED---AILIEPLACALHAV-----DRANIKFDDVVVLAGAGP 185 Query: 156 SGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGI 215 G+G + K E LA K GA +N + D +E +++ T G G Sbjct: 186 LGLGMIGAARLKNPKKLIVLDLKDERLALA-RKFGADVVLNPPEVDVVEKIKELTGGYGC 244 Query: 216 DIILDMVGAEY-LNQHLTLLSKEGKLIIISFLGGNIATEINLNPIIS--KRITITGSTLR 272 DI ++ G + Q L ++ K G+ + S G + + + II K + + GS L Sbjct: 245 DIYIEATGHPSAVEQGLNMIRKLGRFVEFSVFGDPVTVDWS---IIGDRKELDVLGSHLG 301 Query: 273 RRT-DIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330 IA I L + I V H PL A ++M + + K++L Sbjct: 302 PYCYPIAIDLIASG-------RLPTDGI--VTHQ-FPLEDFEEAFELMARGDDSIKVVL 350 >gnl|CDD|35245 KOG0022, KOG0022, KOG0022, Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism]. Length = 375 Score = 64.1 bits (156), Expect = 5e-11 Identities = 72/367 (19%), Positives = 126/367 (34%), Gaps = 71/367 (19%) Query: 21 MFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP-ILGLEVAGKIVDLG 79 + + E + P+ E+ IK+ A GV D G P P ILG E AG + +G Sbjct: 20 LVIEEIEVAPPKAHEVRIKILATGVCHTDAYVWSGKDPEG--LFPVILGHEAAGIVESVG 77 Query: 80 ENTTHWNIGDEV-------------CA--------------------------------- 93 E T GD V C Sbjct: 78 EGVTTVKPGDHVIPLFTPQCGECKFCKSPKTNLCEKFRADNGKGGMPYDGTSRFTCKGKP 137 Query: 94 ---LVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVL 150 + ++EY + I + L T + + TA + G TV Sbjct: 138 IYHFMGTSTFSEYTVVDDISVAKIDPSAPLEKVCLLGCGVSTGYGAAWNTAKVEPGSTVA 197 Query: 151 IHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHAIN--YLKEDFLEILQ 207 + G G+G A GA+ + + +K + GA IN LK+ E++ Sbjct: 198 VF-GLGGVGLAVAMGAKAAGASRIIGVDINPDKFEKAKEFGATEFINPKDLKKPIQEVII 256 Query: 208 KETQGRGIDIILDMVGAEYLNQHLTLLSKE--GKLIIISFLGGNIATEINLNPIISKRIT 265 + T G G+D + +G + + GK ++I +++ R T Sbjct: 257 EMTDG-GVDYSFECIGNVSTMRAALESCHKGWGKSVVIGVAAAGQEISTRPFQLVTGR-T 314 Query: 266 ITGST---LRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKS 322 GS + ++DI K ++D ++ K+ + I LP ++ A D++ + Sbjct: 315 WKGSAFGGFKSKSDIPK-LVKDYMKKKL-------NLDEFITHELPFEEINKAFDLLHEG 366 Query: 323 EHIGKII 329 + I ++ Sbjct: 367 KSIRCVL 373 >gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 341 Score = 64.3 bits (157), Expect = 5e-11 Identities = 83/360 (23%), Positives = 135/360 (37%), Gaps = 56/360 (15%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGV--------NRPDVMQRKGLYP 58 MR + + + P P+P ++L+KV A G+ P+ M P Sbjct: 1 MRAAVFRD----GPLVVRDVPDPEPGPGQVLVKVLACGICGSDLHATAHPEAMVDDAGGP 56 Query: 59 PPKNANP--ILGLEVAGKIVDLGENTTH-WNIGDEVCAL-----------------VNGG 98 + +LG E G++VD G T +G V +L G Sbjct: 57 SLMDLGADIVLGHEFCGEVVDYGPGTERKLKVGTRVTSLPLLLCGQGASCGIGLSPEAPG 116 Query: 99 GYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGI 158 GYAEY L + L +P G + AA L E V + + A L G+ L+ G I Sbjct: 117 GYAEYMLLSEALLLRVPDGLSMEDAA-LTEP-LAVGLHAVRRARLTPGEVALVIGCGP-I 173 Query: 159 GTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGI-- 215 G I G + + S E+ L +GA ++ + E G Sbjct: 174 GLAVIAALKARGVGPIVASDFSPERRALALAMGADIVVDPAADSPFAAWAAELARAGGPK 233 Query: 216 -DIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPI--ISKRITITGSTLR 272 +I + VGA L Q + + G I++ +G + ++ N+ P I K +T+ S Sbjct: 234 PAVIFECVGAPGLIQQIIEGAPPGGRIVV--VGVCMESD-NIEPALAIRKELTLQFSLGY 290 Query: 273 RRTDIAKQSIRDSLQLKIWPLLNSHVI--APVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330 + A D+L L + AP++ + L V A + + EH KI++ Sbjct: 291 TPEEFA-----DALD-----ALAEGKVDVAPMVTGTVGLDGVPDAFEALRDPEHHCKILV 340 >gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members. This subgroup of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family has members identified as 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase and alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. Length = 277 Score = 63.1 bits (154), Expect = 1e-10 Identities = 61/277 (22%), Positives = 104/277 (37%), Gaps = 34/277 (12%) Query: 66 ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAAS 125 G G++V++G T + GD V G +AE + +P+P G +AA Sbjct: 23 PPGYSSVGRVVEVGSGVTGFKPGDRVFCF---GPHAERVVVPANLLVPLPDGLPPERAA- 78 Query: 126 LPESFFTVWA---NLFQTANLRSGQTVLIHGGSSG-IGTTAIQLASYFGA-TVYTTAKSE 180 + A N + A R G+ V + G G +G A QLA GA V Sbjct: 79 ----LTALAATALNGVRDAEPRLGERVAVVGL--GLVGLLAAQLAKAAGAREVVGVDPDA 132 Query: 181 EKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG-AEYLNQHLTLLSKEGK 239 + LG + E GRG D++++ G L L LL G+ Sbjct: 133 ARRELAEALGPADPVA-------ADTADEIGGRGADVVIEASGSPSALETALRLLRDRGR 185 Query: 240 LIIISFLGGNIAT---EINLN--PIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLL 294 ++++ + G E + PI S ++ G R R +++ ++L L L Sbjct: 186 VVLVGWYGLKPLLLGEEFHFKRLPIRSSQVYGIGRYDRPRRWTEARNLEEALDLLAEGRL 245 Query: 295 NSHVIAPVIHTVLPLGKVAMAHDIMEKSEHIG-KIIL 330 +I +P A+ ++ + K++L Sbjct: 246 -----EALITHRVPFEDAPEAYRLLFEDPPECLKVVL 277 >gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family. This group resembles the zinc-dependent alcohol dehydrogenase and has the catalytic and structural zinc-binding sites characteristic of this group. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Other MDR members have only a catalytic zinc, and some contain no coordinated zinc. Length = 384 Score = 62.5 bits (152), Expect = 1e-10 Identities = 62/246 (25%), Positives = 98/246 (39%), Gaps = 45/246 (18%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDV----MQRKG--LYPPPKNANPILGLEVAGKIV 76 + + P+P + +EILI+V+A G+ D+ + G LYP ++G E +G + Sbjct: 41 VEDVPVPNLKPDEILIRVKACGICGSDIHLYETDKDGYILYPGLTEFPVVIGHEFSGVVE 100 Query: 77 DLGENTTHWNIGDEVCA---------------------------LVNGGGYAEYCLSHQG 109 G+N ++ GD V A G +AEY + Sbjct: 101 KTGKNVKNFEKGDPVTAEEMMWCGMCRACRSGSPNHCKNLKELGFSADGAFAEYIAVNAR 160 Query: 110 HTLPIPK------GYNAIQAASLPESFFTVWANLFQTA-NLRSGQTVLIHGGSSGIGTTA 162 + I + A +A +L E + LF R G V+++G IG A Sbjct: 161 YAWEINELREIYSEDKAFEAGALVEPTSVAYNGLFIRGGGFRPGAYVVVYGAGP-IGLAA 219 Query: 163 IQLASYFGAT-VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQK---ETQGRGIDII 218 I LA GA+ V SEE+ ++GA + N K +K T+G G DI Sbjct: 220 IALAKAAGASKVIAFEISEERRNLAKEMGADYVFNPTKMRDCLSGEKVMEVTKGWGADIQ 279 Query: 219 LDMVGA 224 ++ GA Sbjct: 280 VEAAGA 285 >gnl|CDD|35247 KOG0024, KOG0024, KOG0024, Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 354 Score = 62.6 bits (152), Expect = 2e-10 Identities = 57/291 (19%), Positives = 104/291 (35%), Gaps = 41/291 (14%) Query: 15 YGKSNVMFLAESPIPQPQK-EEILIKVEAIGVNRPDVMQ-RKGLYPPPKNANP-ILGLEV 71 GK ++ + PIP +E+L+ ++A+G+ DV G P +LG E Sbjct: 11 RGKGDIRI-EQRPIPTITDPDEVLVAIKAVGICGSDVHYYTHGRIGDFVVKKPMVLGHES 69 Query: 72 AGKIVDLGENTTHWNIGDEV---------------------------CAL-VNGGGYAEY 103 +G + ++G+ H +GD V CA G AEY Sbjct: 70 SGIVEEVGDEVKHLKVGDRVAIEPGLPCRDCDFCKEGRYNLCPHMVFCATPPVDGTLAEY 129 Query: 104 CLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTAI 163 + +P + + +L E + A ++ G VL+ G IG Sbjct: 130 YVHPADFCYKLPDNV-SFEEGALIEPLSVGVHACRR-AGVKKGSKVLVLGAGP-IGLLTG 186 Query: 164 QLASYFGAT-VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQG----RGIDII 218 +A GA+ V T + K GA + + L + + + D+ Sbjct: 187 LVAKAMGASDVVITDLVANRLELAKKFGATVTDPSSHKSSPQELAELVEKALGKKQPDVT 246 Query: 219 LDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGS 269 D GAE + ++ G +++ +G + + + K + + GS Sbjct: 247 FDCSGAEVTIRAAIKATRSGGTVVLVGMGAEE-IQFPIIDVALKEVDLRGS 296 >gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases. Yhdh and yhfp-like putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 325 Score = 61.8 bits (151), Expect = 2e-10 Identities = 63/224 (28%), Positives = 97/224 (43%), Gaps = 31/224 (13%) Query: 22 FLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGEN 81 FL P+ + ++LI+V +N D + G +N G++ AG +V + Sbjct: 16 FLRTLPLDDLPEGDVLIRVHYSSLNYKDALAATGNGGVTRNYPHTPGIDAAGTVVSSDDP 75 Query: 82 TTHWNIGDEVCALVNG--------GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTV 133 + GDEV LV G GG+AEY +P+P+G + +A L + FT Sbjct: 76 R--FREGDEV--LVTGYDLGMNTDGGFAEYVRVPADWVVPLPEGLSLREAMILGTAGFT- 130 Query: 134 WANLFQTANLRSGQT-----VLIHGGSSGIGTTAIQLASYFGATVY-TTAKSEEKCLACL 187 A L +GQT VL+ G + G+G+ A+ + + G TV T K E+ Sbjct: 131 -AALSVHRLEDNGQTPEDGPVLVTGATGGVGSIAVAILAKLGYTVVALTGKEEQADYL-K 188 Query: 188 KLGAKHAINYLKEDFLEI----LQKETQGRGIDIILDMVGAEYL 227 LGA ++ +ED L+ L K I D VG + L Sbjct: 189 SLGASEVLD--REDLLDESKKPLLKARWAGAI----DTVGGDVL 226 >gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates. For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ in the substrate binding pocket and therefore in substrate specificity. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine (His-51), the ribose of NAD, a serine (Ser-48), then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 365 Score = 61.7 bits (150), Expect = 3e-10 Identities = 80/364 (21%), Positives = 128/364 (35%), Gaps = 71/364 (19%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT 82 + E + P+ E+ IKV A GV D+ G P P ILG E AG + +G Sbjct: 15 IEEIEVAPPKAGEVRIKVVATGVCHTDLHVIDGKLPTPLPV--ILGHEGAGIVESIGPGV 72 Query: 83 THWNIGDEV----------CALVNGG---------------------------------- 98 T GD+V C Sbjct: 73 TTLKPGDKVIPLFGPQCGKCKQCLNPRPNLCSKSRGTNGRGLMSDGTSRFTCKGKPIHHF 132 Query: 99 ----GYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGG 154 +AEY + + I + + F T + TA + G T + G Sbjct: 133 LGTSTFAEYTVVSEISLAKIDPDAPLEKVCLIGCGFSTGYGAAVNTAKVTPGSTCAVF-G 191 Query: 155 SSGIGTTAIQLASYFGATVYTTAK-SEEKCLACLKLGAKHAIN--YLKEDFLEILQKETQ 211 G+G + I GA+ +++K +LGA IN + +E+L E Sbjct: 192 LGGVGLSVIMGCKAAGASRIIAVDINKDKFEKAKQLGATECINPRDQDKPIVEVL-TEMT 250 Query: 212 GRGIDIILDMVG-AEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNP--IISKRITITG 268 G+D +++G A+ L Q L G ++ + TE L+P +++ R TI G Sbjct: 251 DGGVDYAFEVIGSADTLKQALDATRLGGGTSVVVGV-PPSGTEATLDPNDLLTGR-TIKG 308 Query: 269 S---TLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIMEKSEHI 325 + + + + K + Q K PL +I VLP ++ D+M E I Sbjct: 309 TVFGGWKSKDSVPKL-VALYRQKKF-PL------DELITHVLPFEEINDGFDLMRSGESI 360 Query: 326 GKII 329 I+ Sbjct: 361 RTIL 364 >gnl|CDD|176255 cd08295, double_bond_reductase_like, Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase. This group includes proteins identified as the Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase. The Arabidopsis enzyme, a member of the medium chain dehydrogenase/reductase family, catalyzes the reduction of 7-8-double bond of phenylpropanal substrates as a plant defense mechanism. Prostaglandins and related eicosanoids (lipid mediators involved in host defense and inflamation) are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. Leukotriene B4 (LTB4) can be metabolized by LTB4 20-hydroxylase in inflamatory cells, and in other cells by bifunctional LTB4 12-HD/PGR. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 338 Score = 59.6 bits (145), Expect = 1e-09 Identities = 70/229 (30%), Positives = 96/229 (41%), Gaps = 27/229 (11%) Query: 55 GLYPPP-KNANPILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLP 113 LY PP K I G VA K+VD + +GD V G+ EY L +G L Sbjct: 63 SLYLPPFKPGEVITGYGVA-KVVD--SGNPDFKVGDLVWGFT---GWEEYSLIPRGQDL- 115 Query: 114 IPKGYNAIQAASLPESF---------FTVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQ 164 I +P S+ T +A ++ + G+TV + S +G Q Sbjct: 116 -----RKIDHTDVPLSYYLGLLGMPGLTAYAGFYEVCKPKKGETVFVSAASGAVGQLVGQ 170 Query: 165 LASYFGATVYTTAKSEEKC-LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG 223 LA G V +A S+EK L KLG A NY +E L+ K GIDI D VG Sbjct: 171 LAKLKGCYVVGSAGSDEKVDLLKNKLGFDDAFNYKEEPDLDAALKRYFPNGIDIYFDNVG 230 Query: 224 AEYLNQHLTLLSKEGKLII---IS-FLGGNIATEINLNPIISKRITITG 268 + L+ L ++ G++ IS + NL II KR+ I G Sbjct: 231 GKMLDAVLLNMNLHGRIAACGMISQYNLEWPEGVRNLLNIIYKRVKIQG 279 >gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions near the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates. Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 365 Score = 59.0 bits (144), Expect = 2e-09 Identities = 70/295 (23%), Positives = 109/295 (36%), Gaps = 65/295 (22%) Query: 31 PQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDE 90 P+ +E+L+++ A G+ D++ R G P P A +LG E AG + +G T GD Sbjct: 25 PRPDEVLVRIVATGICHTDLVVRDGGLPTPLPA--VLGHEGAGVVEAVGSAVTGLKPGDH 82 Query: 91 VCALVNGGGYAEYCLSHQ----GHTLPI------PKGYNAIQAASLPE---SFF------ 131 V G CLS + P+ P G + FF Sbjct: 83 VVLSFASCGECANCLSGHPAYCENFFPLNFSGRRPDGSTPLSLDDGTPVHGHFFGQSSFA 142 Query: 132 -------------------TVWANL---FQT--------ANLRSGQTVLIHGGSSGIGTT 161 + A L QT R G ++ + G +G Sbjct: 143 TYAVVHERNVVKVDKDVPLELLAPLGCGIQTGAGAVLNVLKPRPGSSIAVFGA-GAVGLA 201 Query: 162 AIQLASYFGAT----VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDI 217 A+ A G T V E LA +LGA H IN +ED + +++ T G G+D Sbjct: 202 AVMAAKIAGCTTIIAVDIVDSRLE--LA-KELGATHVINPKEEDLVAAIREIT-GGGVDY 257 Query: 218 ILDMVG-AEYLNQHLTLLSKEGKLIII--SFLGGNIATEINLNPIISKRITITGS 269 LD G + Q + L+ G L ++ G + +++N ++ TI G Sbjct: 258 ALDTTGVPAVIEQAVDALAPRGTLALVGAPPPGAEV--TLDVNDLLVSGKTIRGV 310 >gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. Formaldehyde dehydrogenase (aka ADH3) may be the ancestral form of alcohol dehydrogenase, which evolved to detoxify formaldehyde. This CD contains glutathione dependant FDH, glutathione independent FDH, and related alcohol dehydrogenases. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 347 Score = 56.9 bits (138), Expect = 7e-09 Identities = 80/366 (21%), Positives = 136/366 (37%), Gaps = 59/366 (16%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKE-EILIKVEAIGVNRPDVMQRKGLYPPPKNANP 65 M+ + G GK + L E P P+ Q + +++V A + D+ +G P K+ Sbjct: 1 MKALVYLGPGK---IGLEEVPDPKIQGPHDAIVRVTATSICGSDLHIYRGGVPGAKH-GM 56 Query: 66 ILGLEVAGKIVDLGENTTHWNIGDEV----------------------------CALVNG 97 ILG E G++V++G + GD V L N Sbjct: 57 ILGHEFVGEVVEVGSDVKRLKPGDRVSVPCITFCGRCRFCRRGYHAHCENGLWGWKLGNR 116 Query: 98 --GGYAEYCL--SHQGHTLPIPKGYNAIQAAS----LPESFFTVWANLFQTANLRSGQTV 149 GG AEY + IP G A LP F + A ++ G TV Sbjct: 117 IDGGQAEYVRVPYADMNLAKIPDGLPDEDALMLSDILPTGFHGA-----ELAGIKPGSTV 171 Query: 150 LIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQK 208 + G +G A+ A GA + + E+ + GA IN D +E + + Sbjct: 172 AVIGAGP-VGLCAVAGARLLGAARIIAVDSNPERLDLAKEAGATDIINPKNGDIVEQILE 230 Query: 209 ETQGRGIDIILDMVG-AEYLNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITIT 267 T GRG+D +++ VG E Q + ++ G + + G L K +T Sbjct: 231 LTGGRGVDCVIEAVGFEETFEQAVKVVRPGGTIANVGVYGKPD-PLPLLGEWFGKNLTFK 289 Query: 268 GSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHTVLPLGKVAMAHDIME-KSEHIG 326 + R + + L L ++ + + H PL + A+ + + K + Sbjct: 290 TGLVPVRARMPE-----LLDLIEEGKIDPSKL--ITH-RFPLDDILKAYRLFDNKPDGCI 341 Query: 327 KIILLP 332 K+++ P Sbjct: 342 KVVIRP 347 >gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase. L-idonate 5-dehydrogenase (L-ido 5-DH ) catalyzes the conversion of L-lodonate to 5-ketogluconate in the metabolism of L-Idonate to 6-P-gluconate. In E. coli, this GntII pathway is a subsidiary pathway to the canonical GntI system, which also phosphorylates and transports gluconate. L-ido 5-DH is found in an operon with a regulator indR, transporter idnT, 5-keto-D-gluconate 5-reductase, and Gnt kinase. L-ido 5-DH is a zinc-dependent alcohol dehydrogenase-like protein. The alcohol dehydrogenase ADH-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH. This group is also called the medium chain dehydrogenases/reductase family (MDR) which displays a broad range of activities and are distinguished from the smaller short chain dehydrogenases(~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal GroES-like catalytic domain. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 339 Score = 56.5 bits (137), Expect = 1e-08 Identities = 82/350 (23%), Positives = 139/350 (39%), Gaps = 65/350 (18%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDV-MQRKGLYPPPKNANP-ILGLEVAGKIVDLGE 80 + E P P+P E+ ++V A G+ D+ + G + + P +LG EV+G + +G Sbjct: 11 VEERPAPEPGPGEVRVRVAAGGICGSDLHYYQHGGFGTVRLREPMVLGHEVSGVVEAVGP 70 Query: 81 NTTHWNIGDEVCALVNG---GGYAEYCLSHQ----------G------HT---------- 111 T G V VN G +YC + + G H Sbjct: 71 GVTGLAPGQRVA--VNPSRPCGTCDYCRAGRPNLCLNMRFLGSAMRFPHVQGGFREYLVV 128 Query: 112 -----LPIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGSSG-IGTTAIQL 165 +P+P G +++ A+L E + + +L G+ VL+ G +G IG + Sbjct: 129 DASQCVPLPDGL-SLRRAALAEPLAVALHAVNRAGDLA-GKRVLVTG--AGPIGALVVAA 184 Query: 166 ASYFGATVYTTAKSEEKCLA-CLKLGAKHAINYLKEDFLEILQKETQGRG-IDIILDMVG 223 A GA + LA +GA +N L D L +G D++ + G Sbjct: 185 ARRAGAAEIVATDLADAPLAVARAMGADETVN-LARDPLAAYA---ADKGDFDVVFEASG 240 Query: 224 AEY-LNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRRRTDIAKQSI 282 A L L ++ G ++ + LGG + LN +++K + + GS R + A +++ Sbjct: 241 APAALASALRVVRPGGTVVQVGMLGG--PVPLPLNALVAKELDLRGS-FRFDDEFA-EAV 296 Query: 283 RDSLQLKIWPLLNSHVI--APVIHTVLPLGKVAMAHDIMEKSEHIGKIIL 330 R LL + I P+I V PL + A A + K+ L Sbjct: 297 R---------LLAAGRIDVRPLITAVFPLEEAAEAFALAADRTRSVKVQL 337 >gnl|CDD|176254 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto- 13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 329 Score = 55.7 bits (135), Expect = 1e-08 Identities = 64/274 (23%), Positives = 114/274 (41%), Gaps = 34/274 (12%) Query: 13 SGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVA 72 G K + L E +P + E+L + + V+ P M+ + ++G +VA Sbjct: 13 DGKPKESDFELVEEELPPLKDGEVLCEALFLSVD-P-YMRPYSKRLNEGD--TMIGTQVA 68 Query: 73 GKIVDLGENTTHWNIGDEVCALVNGGGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFF- 131 K+++ + + +G V A G+ + +S G P A LP S Sbjct: 69 -KVIE--SKNSKFPVGTIVVA---SFGWRTHTVS-DGKDQPDLYKLPADLPDDLPPSLAL 121 Query: 132 --------TVWANLFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKC 183 T + L + ++G+TV+++G + +G+ Q+A G V A S++K Sbjct: 122 GVLGMPGLTAYFGLLEICKPKAGETVVVNGAAGAVGSLVGQIAKIKGCKVIGCAGSDDKV 181 Query: 184 LACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIII 243 +LG NY E L KE GID D VG E+ + L+ ++ G++ + Sbjct: 182 AWLKELGFDAVFNYKTVSLEEAL-KEAAPDGIDCYFDNVGGEFSSTVLSHMNDFGRVAVC 240 Query: 244 SFLGGNIATEINLNP---------IISKRITITG 268 G+I+T + P II K++ + G Sbjct: 241 ----GSISTYNDKEPKKGPYVQETIIFKQLKMEG 270 >gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. This group contains members identified as zinc dependent alcohol dehydrogenases (ADH), and class III ADG (aka formaldehyde dehydrogenase, FDH). Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. Class III ADH are also know as glutathione-dependent formaldehyde dehydrogenase (FDH), which convert aldehydes to the corresponding carboxylic acid and alcohol. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 371 Score = 55.5 bits (134), Expect = 2e-08 Identities = 67/267 (25%), Positives = 108/267 (40%), Gaps = 55/267 (20%) Query: 8 RHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI- 66 A + Y S + + E + P E+L+K+ A G+ D+ G P P P+ Sbjct: 8 ETGAPTPYADSRPLVIEEVELDPPGPGEVLVKIAAAGLCHSDLSVINGDRPRPL---PMA 64 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEV-------------CA------------------LV 95 LG E AG +V++GE T +GD V CA L+ Sbjct: 65 LGHEAAGVVVEVGEGVTDLEVGDHVVLVFVPSCGHCRPCAEGRPALCEPGAAANGAGTLL 124 Query: 96 NGG-----------------GYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLF 138 +GG +AEY + + + I K AA + T + Sbjct: 125 SGGRRLRLRGGEINHHLGVSAFAEYAVVSRRSVVKIDKDVPLEIAALFGCAVLTGVGAVV 184 Query: 139 QTANLRSGQTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLKLGAKHAINY 197 TA +R GQ+V + G G+G +A+ A GA+ V +E+K +LGA +N Sbjct: 185 NTAGVRPGQSVAVV-GLGGVGLSALLGAVAAGASQVVAVDLNEDKLALARELGATATVNA 243 Query: 198 LKEDFLEILQKETQGRGIDIILDMVGA 224 + +E +++ T G G+D +M G+ Sbjct: 244 GDPNAVEQVRELTGG-GVDYAFEMAGS 269 >gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases. yhfp putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 326 Score = 55.0 bits (133), Expect = 3e-08 Identities = 64/255 (25%), Positives = 104/255 (40%), Gaps = 18/255 (7%) Query: 25 ESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTH 84 + + ++LI+V VN D + K I G+++AG +V+ N Sbjct: 19 NLTLDDLPEGDVLIRVAYSSVNYKDGLASIPGGKIVKRYPFIPGIDLAGTVVE--SNDPR 76 Query: 85 WNIGDEVCALVNG------GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFTVWANLF 138 + GDEV GGY+EY +P+PKG +A L + FT A L Sbjct: 77 FKPGDEVIVTSYDLGVSHHGGYSEYARVPAEWVVPLPKGLTLKEAMILGTAGFT--AALS 134 Query: 139 QTANLRSGQT-----VLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLKLGAKH 193 +G T VL+ G + G+G+ A+ + + G V + + KLGAK Sbjct: 135 IHRLEENGLTPEQGPVLVTGATGGVGSLAVSILAKLGYEVVASTGKADAADYLKKLGAKE 194 Query: 194 AINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIATE 253 I +E+ E K + + +D VG + L L+ L G + + GG E Sbjct: 195 VIP--REELQEESIKPLEKQRWAGAVDPVGGKTLAYLLSTLQYGGSVAVSGLTGGG-EVE 251 Query: 254 INLNPIISKRITITG 268 + P I + + + G Sbjct: 252 TTVFPFILRGVNLLG 266 >gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases. This group is predominated by atypical alcohol dehydrogenases; they exist as tetramers and exhibit specificity for NADP(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like other zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric ADHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains; however, they do not have and a structural zinc in a lobe of the catalytic domain. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 351 Score = 54.9 bits (133), Expect = 3e-08 Identities = 64/277 (23%), Positives = 104/277 (37%), Gaps = 42/277 (15%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPI 66 M+ AM G GK + E PIP + +++ A+ DV G P ++ I Sbjct: 1 MKAFAMLGIGKVGWI---EKPIPVCGPNDAIVRPTAVAPCTSDVHTVWGGAPGERH-GMI 56 Query: 67 LGLEVAGKIVDLGENTTHWNIGDEVCA-LVNGGGYAEYCL----SHQGHTL--------- 112 LG E G + ++G + GD V + + S G L Sbjct: 57 LGHEAVGVVEEVGSEVKDFKPGDRVIVPAITPDWRSVAAQRGYPSQSGGMLGGWKFSNFK 116 Query: 113 ------------------PIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHG- 153 P+P G QA LP+ T + + AN++ G TV + G Sbjct: 117 DGVFAEYFHVNDADANLAPLPDGLTDEQAVMLPDMMSTGFHG-AELANIKLGDTVAVFGI 175 Query: 154 GSSGIGTTAIQLASYFGATVYTTAKSEEKCL-ACLKLGAKHAINYLKEDFLEILQKETQG 212 G +G A+ A GA S + + GA ++Y D +E + K T G Sbjct: 176 GP--VGLMAVAGARLRGAGRIIAVGSRPNRVELAKEYGATDIVDYKNGDVVEQILKLTGG 233 Query: 213 RGIDIILDMVG-AEYLNQHLTLLSKEGKLIIISFLGG 248 +G+D ++ G + Q L +L G + +++ G Sbjct: 234 KGVDAVIIAGGGQDTFEQALKVLKPGGTISNVNYYGE 270 >gnl|CDD|176253 cd08293, PTGR2, Prostaglandin reductase. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 345 Score = 52.8 bits (127), Expect = 1e-07 Identities = 31/108 (28%), Positives = 52/108 (48%), Gaps = 7/108 (6%) Query: 147 QTVLIHGGSSGIGTTAIQLASYFGAT-VYTTAKSEEKCLACLK-LGAKHAINYLKEDFLE 204 QT+++ G + G+ A Q+ G + V S+EKC LG AINY ++ E Sbjct: 156 QTMVVSGAAGACGSLAGQIGRLLGCSRVVGICGSDEKCQLLKSELGFDAAINYKTDNVAE 215 Query: 205 ILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISFLGGNIAT 252 L +E G+D+ D VG E + ++ +++ +I L G I+ Sbjct: 216 RL-RELCPEGVDVYFDNVGGEISDTVISQMNENSHII----LCGQISQ 258 >gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family, including threonine dehydrogenase. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 319 Score = 51.1 bits (123), Expect = 5e-07 Identities = 59/280 (21%), Positives = 99/280 (35%), Gaps = 56/280 (20%) Query: 22 FLAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGEN 81 + + P P+P E L++V G+ D+ KG YP P + G E G + + E Sbjct: 13 RVEDLPKPEPPPGEALVRVLLAGICNTDLEIYKGYYPFPG----VPGHEFVGIVEEGPE- 67 Query: 82 TTHW---------NIGDEVCAL-------------VNG-----GGYAEYCLSHQGHTLPI 114 NI C V G G +AEY + + Sbjct: 68 -AELVGKRVVGEINIACGRCEYCRRGLYTHCPNRTVLGIVDRDGAFAEYLTLPLENLHVV 126 Query: 115 PKGYNAIQAASLPESFFTVWA---NLFQTANLRSGQTVLIHGGSSG-IGTTAIQLASYFG 170 P QA F A + + + G V + G G +G Q+ + G Sbjct: 127 PDLVPDEQAV-----FAEPLAAALEILEQVPITPGDKVAVLG--DGKLGLLIAQVLALTG 179 Query: 171 ATVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVG-AEYLNQ 229 V + EK L L + + + + + E++G G D++++ G L Sbjct: 180 PDVVLVGRHSEK----LALARRLGV-----ETVLPDEAESEGGGFDVVVEATGSPSGLEL 230 Query: 230 HLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGS 269 L L+ G +++ S G + +L + IT+ GS Sbjct: 231 ALRLVRPRGTVVLKSTYAGPAS--FDLTKAVVNEITLVGS 268 >gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like. This group is related to formaldehyde dehydrogenase (FDH), which is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. This family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Another member is identified as a dihydroxyacetone reductase. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins). The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 345 Score = 49.9 bits (120), Expect = 1e-06 Identities = 50/194 (25%), Positives = 84/194 (43%), Gaps = 42/194 (21%) Query: 66 ILGLEVAGKIVDLGENTTHWNIGDEV----------CAL---------VNGG---GY--- 100 ILG E G + ++G T++ +GD V C +GG G Sbjct: 57 ILGHEGVGVVEEVGSAVTNFKVGDRVLISCISSCGTCGYCRKGLYSHCESGGWILGNLID 116 Query: 101 ---AEYC-LSHQGHTL-PIPKGYNAIQAASLPESFFTVWANLFQTANLRSGQTVLIHGGS 155 AEY + H ++L +P+G + A L + T + ++ G TV I Sbjct: 117 GTQAEYVRIPHADNSLYKLPEGVDEEAAVMLSDILPTGYECGVLNGKVKPGDTVAI---- 172 Query: 156 SGIGTTAIQLASYFGATVYTTAK------SEEKCLACLKLGAKHAINYLKEDFLEILQKE 209 +G + LA+ A +Y+ +K + + KLGA H +N K D +E + + Sbjct: 173 --VGAGPVGLAALLTAQLYSPSKIIMVDLDDNRLEVAKKLGATHTVNSAKGDAIEQVLEL 230 Query: 210 TQGRGIDIILDMVG 223 T GRG+D++++ VG Sbjct: 231 TDGRGVDVVIEAVG 244 >gnl|CDD|176248 cd08288, MDR_yhdh, Yhdh putative quinone oxidoreductases. Yhdh putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 324 Score = 45.6 bits (109), Expect = 2e-05 Identities = 48/191 (25%), Positives = 85/191 (44%), Gaps = 27/191 (14%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENT 82 L E + ++ ++V +N D + G + + G+++AG +V+ + Sbjct: 17 LRELDESDLPEGDVTVEVHYSTLNYKDGLAITGKGGIVRTFPLVPGIDLAGTVVE----S 72 Query: 83 TH--WNIGDEVCALVNG--------GGYAEYCLSHQGHTLPIPKGYNAIQAASLPESFFT 132 + + GD V ++ G GGYA+ +P+P+G +A QA ++ + FT Sbjct: 73 SSPRFKPGDRV--VLTGWGVGERHWGGYAQRARVKADWLVPLPEGLSARQAMAIGTAGFT 130 Query: 133 VWANLFQTANLRSGQT-----VLIHGGSSGIGTTAIQLASYFGATVY-TTAKSEEKCLAC 186 A L A G T VL+ G + G+G+ A+ L + G V +T + EE Sbjct: 131 --AMLCVMALEDHGVTPGDGPVLVTGAAGGVGSVAVALLARLGYEVVASTGRPEEA--DY 186 Query: 187 LK-LGAKHAIN 196 L+ LGA I+ Sbjct: 187 LRSLGASEIID 197 >gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates. For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ in the substrate binding pocket and therefore in substrate specificity. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine (His-51), the ribose of NAD, a serine (Ser-48) , then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 365 Score = 38.5 bits (90), Expect = 0.002 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 6/66 (9%) Query: 31 PQKEEILIKVEAIGVNRPDVMQRKGLYPP--PKNANPILGLEVAGKIVDLGENTTHWNIG 88 P+ E+ IK+ A V D++ +G P ILG E AG + +GE T+ G Sbjct: 25 PKANEVRIKMLATSVCHTDILAIEGFKATLFPV----ILGHEGAGIVESVGEGVTNLKPG 80 Query: 89 DEVCAL 94 D+V L Sbjct: 81 DKVIPL 86 >gnl|CDD|35944 KOG0725, KOG0725, KOG0725, Reductases with broad range of substrate specificities [General function prediction only]. Length = 270 Score = 38.1 bits (88), Expect = 0.003 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Query: 145 SGQTVLIHGGSSGIG-TTAIQLASYFGATVYTTAKSEEKCLACLK 188 +G+ L+ GGSSGIG A+ LA GA V T +SEE+ + Sbjct: 7 AGKVALVTGGSSGIGKAIALLLAKA-GAKVVITGRSEERLEETAQ 50 >gnl|CDD|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 368 Score = 37.2 bits (87), Expect = 0.006 Identities = 27/79 (34%), Positives = 35/79 (44%), Gaps = 4/79 (5%) Query: 31 PQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP-ILGLEVAGKIVDLGENTTHWNIGD 89 P+ E+ IK+ A GV D G P+ P ILG E AG + +GE T GD Sbjct: 25 PKAGEVRIKILATGVCHTDAYTLSGA--DPEGLFPVILGHEGAGIVESVGEGVTSVKPGD 82 Query: 90 EVCAL-VNGGGYAEYCLSH 107 V L G ++C S Sbjct: 83 HVIPLYTPECGECKFCKSG 101 >gnl|CDD|36422 KOG1208, KOG1208, KOG1208, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism]. Length = 314 Score = 37.3 bits (86), Expect = 0.006 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Query: 145 SGQTVLIHGGSSGIGT-TAIQLASYFGATVYTTAKSEEKCLA 185 SG+ L+ G +SGIG TA +LA GA V ++EE+ Sbjct: 34 SGKVALVTGATSGIGFETARELALR-GAHVVLACRNEERGEE 74 >gnl|CDD|30648 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only]. Length = 265 Score = 36.0 bits (83), Expect = 0.014 Identities = 29/82 (35%), Positives = 37/82 (45%), Gaps = 10/82 (12%) Query: 145 SGQTVLIHGGSSGIG-TTAIQLASYFGATVYTTAKSEEKCLACLK-LGAKH-------AI 195 G+T LI G SSGIG A QLA G + A+ E+K A K L K Sbjct: 5 KGKTALITGASSGIGAELAKQLARR-GYNLILVARREDKLEALAKELEDKTGVEVEVIPA 63 Query: 196 NYLKEDFLEILQKETQGRGIDI 217 + + LE L+ E + RG I Sbjct: 64 DLSDPEALERLEDELKERGGPI 85 >gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 386 Score = 35.6 bits (83), Expect = 0.018 Identities = 65/273 (23%), Positives = 104/273 (38%), Gaps = 60/273 (21%) Query: 98 GGYAEYCLSHQGHT--LPIPKGYNAIQAASLPESFFTVW-ANLFQTANLRSGQTVLIHG- 153 GG AEY IP + +A L + T + A A ++ G TV + G Sbjct: 136 GGQAEYVRVPFADVGPFKIPDDLSDEKALFLSDILPTGYHAAEL--AEVKPGDTVAVWGC 193 Query: 154 GSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLK--LGAKHAINYLKEDF-LEILQKE 209 G +G A + A GA V + E+ L + LGA IN+ + D +E L++ Sbjct: 194 G--PVGLFAARSAKLLGAERVIAIDRVPER-LEMARSHLGA-ETINFEEVDDVVEALREL 249 Query: 210 TQGRGIDIILDMVGAEY----------------------LNQHLTLLSKEGKLIIISFLG 247 T GRG D+ +D VG E L + + + K G + II G Sbjct: 250 TGGRGPDVCIDAVGMEAHGSPLHKAEQALLKLETDRPDALREAIQAVRKGGTVSIIGVYG 309 Query: 248 GNIATEINLNPIISKRITI-TGSTLRRRTDIAKQSIRDSLQLKIWPLLNSHVIAPVIHT- 305 G + + + ++K +T+ G T +R P L + + + Sbjct: 310 GTV-NKFPIGAAMNKGLTLRMGQTHVQR---------------YLPRLLELIESGELDPS 353 Query: 306 -----VLPLGKVAMAHDIM-EKSEHIGKIILLP 332 LPL A+ I +K + K++L P Sbjct: 354 FIITHRLPLEDAPEAYKIFDKKEDGCIKVVLKP 386 >gnl|CDD|176200 cd08238, sorbose_phosphate_red, L-sorbose-1-phosphate reductase. L-sorbose-1-phosphate reductase, a member of the MDR family, catalyzes the NADPH-dependent conversion of l-sorbose 1-phosphate to d-glucitol 6-phosphate in the metabolism of L-sorbose to (also converts d-fructose 1-phosphate to d-mannitol 6-phosphate). The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. Length = 410 Score = 35.5 bits (82), Expect = 0.024 Identities = 20/84 (23%), Positives = 34/84 (40%), Gaps = 7/84 (8%) Query: 7 MRHVAMSGYGKSNVMFLAESPIPQPQKEEILIKVEAIGVNRPDVM------QRKGLYPPP 60 M+ A YGK + L + +P+ +EIL++V + + K + Sbjct: 1 MKTKAWRMYGK-GDLRLEKFELPEIADDEILVRVISDSLCFSTWKLALQGSDHKKVPNDL 59 Query: 61 KNANPILGLEVAGKIVDLGENTTH 84 ILG E AG I+ +G+ Sbjct: 60 AKEPVILGHEFAGTILKVGKKWQG 83 >gnl|CDD|31231 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]. Length = 251 Score = 35.2 bits (80), Expect = 0.027 Identities = 38/147 (25%), Positives = 59/147 (40%), Gaps = 19/147 (12%) Query: 145 SGQTVLIHGGSSGIG-TTAIQLASYFGATVYTTAKS-----EEKCLACLKLGAKHAINYL 198 SG+ L+ G SSGIG A LA GA V A+ E A +K + Sbjct: 4 SGKVALVTGASSGIGRAIARALARE-GARVVVAARRSEEEAAEALAAAIKEAGGGRAAAV 62 Query: 199 KEDFLEILQ---------KETQGRGIDIILDMVGAEYLNQHLTLLSKEG--KLIIISFLG 247 D + + +E GR IDI+++ G + L L++E ++I ++ LG Sbjct: 63 AADVSDDEESVEALVAAAEEEFGR-IDILVNNAGIAGPDAPLEELTEEDWDRVIDVNLLG 121 Query: 248 GNIATEINLNPIISKRITITGSTLRRR 274 + T L + +RI S Sbjct: 122 AFLLTRAALPLMKKQRIVNISSVAGLG 148 >gnl|CDD|30582 COG0233, Frr, Ribosome recycling factor [Translation, ribosomal structure and biogenesis]. Length = 187 Score = 34.7 bits (80), Expect = 0.039 Identities = 26/132 (19%), Positives = 50/132 (37%), Gaps = 22/132 (16%) Query: 177 AKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEY------LNQH 230 + L + + A+ LK + +I GR +LD + EY LNQ Sbjct: 1 MMMINEILKDAEEKMEKALEALKNELSKI----RTGRANPSLLDRITVEYYGSPTPLNQL 56 Query: 231 LTLLSKEGKLIIISFLGGNIATEI---------NLNPII---SKRITITGSTLRRRTDIA 278 ++ E + ++I ++ I LNP R+ + T RR ++ Sbjct: 57 ASISVPEARTLVIKPFDKSMVKAIEKAILASNLGLNPNNDGNVIRVPLPPLTEERRKELV 116 Query: 279 KQSIRDSLQLKI 290 K + + + + K+ Sbjct: 117 KVAKKYAEEAKV 128 >gnl|CDD|36419 KOG1205, KOG1205, KOG1205, Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 282 Score = 34.5 bits (79), Expect = 0.043 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Query: 146 GQTVLIHGGSSGIG-TTAIQLASYFGATVYTTAKS----EEKCLACLKLGAKHAINYLKE 200 G+ VLI G SSGIG A +LA GA + A+ E KLG+ + L+ Sbjct: 12 GKVVLITGASSGIGEALAYELAKR-GAKLVLVARRARRLERVAEELRKLGSLEKVLVLQL 70 Query: 201 D 201 D Sbjct: 71 D 71 >gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH). Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family. Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent. PFDH converts 2 molecules of aldehydes to corresponding carboxylic acid and alcohol. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins). The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 375 Score = 33.7 bits (78), Expect = 0.072 Identities = 40/145 (27%), Positives = 59/145 (40%), Gaps = 18/145 (12%) Query: 97 GGGYAEYCLSHQG--HTLPIPKGYNAIQA---ASLPESFFTVWANLFQTANLRSGQTVLI 151 GGG AEY + L +P A + L + F T W L + A ++ G TV + Sbjct: 124 GGGQAEYLRVPYADFNLLKLPDRDGAKEKDDYLMLSDIFPTGWHGL-ELAGVQPGDTVAV 182 Query: 152 HGGSSGIGTTAIQLASYFGA-TVYTTAKSEEKCLACLKLGAKH---AINYLKEDFLE-IL 206 G + +G A A GA VY E+ L L I++ D +E IL Sbjct: 183 FG-AGPVGLMAAYSAILRGASRVYVVDHVPER----LDLAESIGAIPIDFSDGDPVEQIL 237 Query: 207 QKETQGRGIDIILDMVGAEYLNQHL 231 + G+D +D VG E ++ Sbjct: 238 --GLEPGGVDRAVDCVGYEARDRGG 260 >gnl|CDD|33748 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]. Length = 245 Score = 32.6 bits (74), Expect = 0.15 Identities = 15/38 (39%), Positives = 22/38 (57%) Query: 145 SGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEK 182 +G T+LI GG+SGIG + G TV ++EE+ Sbjct: 4 TGNTILITGGASGIGLALAKRFLELGNTVIICGRNEER 41 >gnl|CDD|144654 pfam01139, UPF0027, Uncharacterized protein family UPF0027. Length = 419 Score = 32.2 bits (74), Expect = 0.22 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 8/57 (14%) Query: 148 TVLIHGGSSGIGTTAIQLASYFGATVYTTAKSE-----EKCLACLKLGAKHAINYLK 199 V+IH GS G+G Q+A+ + K ++ LA L LG+ +YL Sbjct: 190 WVMIHSGSRGLGH---QIATDYLRLAEKAMKKYGIKLPDRQLAYLPLGSPEGQDYLA 243 >gnl|CDD|31876 COG1690, RtcB, Uncharacterized conserved protein [Function unknown]. Length = 432 Score = 31.4 bits (71), Expect = 0.31 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 9/63 (14%) Query: 143 LRSGQ-TVLIHGGSSGIGTTAIQLASYF-----GATVYTTAKSEEKCLACLKLGAKHAIN 196 L G V+IH GS G+G Q+A+ F A ++ LAC+ + ++ Sbjct: 204 LAEGTVWVMIHTGSRGLGH---QIATDFVRLAEQAMGRYGIAVPDRQLACVPVDSEDGQA 260 Query: 197 YLK 199 YL Sbjct: 261 YLA 263 >gnl|CDD|33946 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]. Length = 246 Score = 31.3 bits (71), Expect = 0.35 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Query: 144 RSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLA-CLKLGAKHAI 195 G+ LI G SSGIG + + GA V A+ EE+ A ++GA A+ Sbjct: 4 LKGKVALITGASSGIGEATARALAEAGAKVVLAARREERLEALADEIGAGAAL 56 >gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. This group includes alcohol dehydrogenases corresponding to mammalian classes I, II, IV. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine (His-51), the ribose of NAD, a serine (Ser-48) , then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 373 Score = 31.1 bits (71), Expect = 0.43 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Query: 31 PQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANPILGLEVAGKIVDLGENTTHWNIGDE 90 P+ E+ IK+ A G+ R D G P ILG E AG + +GE T GD+ Sbjct: 30 PKAHEVRIKIVATGICRSDDHVVSGKLVTPFPV--ILGHEAAGIVESVGEGVTTVKPGDK 87 Query: 91 VCAL 94 V L Sbjct: 88 VIPL 91 >gnl|CDD|32411 COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]. Length = 283 Score = 30.2 bits (68), Expect = 0.75 Identities = 36/170 (21%), Positives = 64/170 (37%), Gaps = 15/170 (8%) Query: 137 LFQTANLRSGQTVLIHGGSSGIGTTAIQLASYFGATVYTTAKSEEKCLACLK----LGAK 192 + + L+ G T+L G G G AI A +G TV SEE+ K G + Sbjct: 64 ILEKLGLKPGMTLLDIG--CGWGGLAIYAAEEYGVTVVGVTLSEEQLAYAEKRIAARGLE 121 Query: 193 HAINYLKEDFLEILQKETQGRGIDI-ILDMVG----AEYLNQHLTLLSKEGKLIIISFLG 247 + +D+ + +E R + + + + VG ++ + LL G++++ S Sbjct: 122 DNVEVRLQDYRDF--EEPFDRIVSVGMFEHVGKENYDDFFKKVYALLKPGGRMLLHSI-T 178 Query: 248 GNIATEINLNPIISKRITITGSTLRRRTDIAKQSIRDSLQLKIWPLLNSH 297 G I K I G L ++I + + + L H Sbjct: 179 GPDQEFRRFPDFIDKYI-FPGGELPSISEILELASEAGFVVLDVESLRPH 227 >gnl|CDD|36424 KOG1210, KOG1210, KOG1210, Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 331 Score = 29.9 bits (67), Expect = 0.93 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Query: 149 VLIHGGSSGIG-TTAIQLASYFGATVYTTAKSEEKCLA 185 +LI GGSSG+G A++ GA V TA+S +K L Sbjct: 36 ILITGGSSGLGLALALECKRE-GADVTITARSGKKLLE 72 >gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates. For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ in the substrate binding pocket and therefore in substrate specificity. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine (His-51), the ribose of NAD, a serine (Ser-48) , then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 369 Score = 30.0 bits (68), Expect = 0.93 Identities = 24/83 (28%), Positives = 33/83 (39%), Gaps = 10/83 (12%) Query: 31 PQKEEILIKVEAIGVNRPDVMQRKGLYPPPKNANP----ILGLEVAGKIVDLGENTTHWN 86 PQ E+ IK+ + DV + K P ILG E AG + +GE T Sbjct: 25 PQAMEVRIKILHTSLCHTDVYFWEA-----KGQTPLFPRILGHEAAGIVESVGEGVTDLK 79 Query: 87 IGDEVCALVNGG-GYAEYCLSHQ 108 GD V + G +C S + Sbjct: 80 PGDHVLPVFTGECKECRHCKSEK 102 >gnl|CDD|32849 COG3034, COG3034, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 298 Score = 29.6 bits (66), Expect = 1.1 Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 6/54 (11%) Query: 115 PKGYNAIQAASLPE------SFFTVWANLFQTANLRSGQTVLIHGGSSGIGTTA 162 P+G+ + L S + N + A R+G ++IHG G + Sbjct: 101 PEGFYRLTRKQLNPDSYYYLSINIGYPNAYDKALGRTGGGIMIHGACLSDGCYS 154 >gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase. Glucose dehydrogenase (GlcDH), a member of the medium chain dehydrogenase/zinc-dependent alcohol dehydrogenase-like family, catalyzes the NADP(+)-dependent oxidation of glucose to gluconate, the first step in the Entner-Doudoroff pathway, an alternative to or substitute for glycolysis or the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossman fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. Length = 355 Score = 29.5 bits (67), Expect = 1.3 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Query: 23 LAESPIPQPQKEEILIKVEAIGVNRPDVMQRKGLY--PPPKNANPILGLEVAGKIVDLGE 80 + + P P+P E+L++ +GV D G Y PP +LG E G + ++G+ Sbjct: 15 VVDIPEPEPTPGEVLVRTLEVGVCGTDREIVAGEYGTAPPGEDFLVLGHEALGVVEEVGD 74 Query: 81 NT 82 + Sbjct: 75 GS 76 >gnl|CDD|34854 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]. Length = 415 Score = 29.4 bits (66), Expect = 1.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Query: 24 AESPIPQPQKEEILIKVEAIGVNRPDVMQRK 54 A P PQPQ E L+ +E IG+ ++Q K Sbjct: 119 ANEPCPQPQTREHLMALEIIGIKNIIIVQNK 149 >gnl|CDD|38269 KOG3059, KOG3059, KOG3059, N-acetylglucosaminyltransferase complex, subunit PIG-C/GPI2, required for phosphatidylinositol biosynthesis [Lipid transport and metabolism]. Length = 292 Score = 29.1 bits (65), Expect = 1.7 Identities = 20/81 (24%), Positives = 34/81 (41%), Gaps = 1/81 (1%) Query: 186 CLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQHLTLLSKEGKLIIISF 245 L L ++ NY E FLE L+ D+ + + L+QHL +++ +I +S Sbjct: 15 VLYLKQEYPDNYTDESFLEELRMNINISIYDLWSAVAESMVLSQHLDMITSF-VVIFVST 73 Query: 246 LGGNIATEINLNPIISKRITI 266 L N++ L S Sbjct: 74 LESNLSENKILYGSNSIPGIG 94 >gnl|CDD|143883 pfam00106, adh_short, short chain dehydrogenase. This family contains a wide variety of dehydrogenases. Length = 167 Score = 29.1 bits (66), Expect = 1.8 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 7/51 (13%) Query: 148 TVLIHGGSSGIGT-TAIQLASYFGATVYTTAKSE-----EKCLACLK-LGA 191 TVLI GG+ G+G A LA+ + ++ + +A L+ LGA Sbjct: 2 TVLITGGTGGLGLALARWLAAEGARHLVLVSRRGDAPGAAELVAELEALGA 52 >gnl|CDD|36415 KOG1201, KOG1201, KOG1201, Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism]. Length = 300 Score = 28.3 bits (63), Expect = 3.0 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Query: 145 SGQTVLIHGGSSGIG-TTAIQLA 166 SG+ VLI GG SG+G A++ A Sbjct: 37 SGEIVLITGGGSGLGRLIALEFA 59 >gnl|CDD|31794 COG1606, COG1606, ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only]. Length = 269 Score = 27.6 bits (61), Expect = 5.7 Identities = 12/59 (20%), Positives = 18/59 (30%), Gaps = 12/59 (20%) Query: 172 TVYTTAKSEEKCLACLKLGAKHAINYLKEDFLEILQKETQGRGIDIILDMVGAEYLNQH 230 E +C C K L +E + RG D++ D A L + Sbjct: 83 DPEFKENPENRCYLC------------KRAVYSTLVEEAEKRGYDVVADGTNASDLFDY 129 >gnl|CDD|30680 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein]. Length = 323 Score = 26.7 bits (59), Expect = 8.1 Identities = 15/79 (18%), Positives = 25/79 (31%), Gaps = 8/79 (10%) Query: 66 ILGLEVAGKIVDLGENTTHWNIGDEVCALVNGGGYAE--------YCLSHQGHTLPIPKG 117 ++G E +I+D + T GD A+V + QG L +P G Sbjct: 137 VVGAETLSRILDWTDRDTCVLFGDGAGAVVLEATEDDNGILDTDLGSDGSQGDLLYLPGG 196 Query: 118 YNAIQAASLPESFFTVWAN 136 +A + Sbjct: 197 GSATPKEESGGGLLVMDGR 215 >gnl|CDD|176392 cd01797, NIRF_N, amino-terminal ubiquitin-like domain of Np95 and NIRF. NIRF_N This CD represents the amino-terminal ubiquitin-like domain of a family of nuclear proteins that includes Np95 and NIRF (Np95/ICBP90-like RING finger) protein. Both Np95 and NIRF have a domain architecture consisting of a ubiquitin-like domain, a PHD finger, a YDG/SRA domain, Rb-binding motifs and a RING finger domain. Both Np95 and NIRF are ubiquitin ligases that ubiquitinate PCNP (PEST-containing nuclear proteins). While Np95 is capable of binding histones, NIRF is involved in cell cycle regulation. Length = 78 Score = 26.7 bits (59), Expect = 8.1 Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 265 TITGSTLRRRTDIAKQSIRDSLQLKIWPLLN 295 T+ G R +++ + + L+ KI L N Sbjct: 7 TMDGKETRTVDSLSRLTKVEELREKIQELFN 37 >gnl|CDD|144375 pfam00750, tRNA-synt_1d, tRNA synthetases class I (R). Other tRNA synthetase sub-families are too dissimilar to be included. This family includes only arginyl tRNA synthetase. Length = 345 Score = 27.0 bits (60), Expect = 8.2 Identities = 13/47 (27%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Query: 227 LNQHLTLLSKEGKLIIISFLGGNIATEINLNPIISKRITITGSTLRR 273 L E K +++ F N A I++ + R TI G L R Sbjct: 7 AQGGLGSALLENKKVVVEFSSPNPAKPIHVGHL---RSTIIGDALSR 50 >gnl|CDD|133288 cd01888, eIF2_gamma, eIF2-gamma (gamma subunit of initiation factor 2). eIF2 is a heterotrimeric translation initiation factor that consists of alpha, beta, and gamma subunits. The GTP-bound gamma subunit also binds initiator methionyl-tRNA and delivers it to the 40S ribosomal subunit. Following hydrolysis of GTP to GDP, eIF2:GDP is released from the ribosome. The gamma subunit has no intrinsic GTPase activity, but is stimulated by the GTPase activating protein (GAP) eIF5, and GDP/GTP exchange is stimulated by the guanine nucleotide exchange factor (GEF) eIF2B. eIF2B is a heteropentamer, and the epsilon chain binds eIF2. Both eIF5 and eIF2B-epsilon are known to bind strongly to eIF2-beta, but have also been shown to bind directly to eIF2-gamma. It is possible that eIF2-beta serves simply as a high-affinity docking site for eIF5 and eIF2B-epsilon, or that eIF2-beta serves a regulatory role. eIF2-gamma is found only in eukaryotes and archaea. It is closely related to SelB, the selenocysteine-specific elongation factor from eubacteria. The translational factor components of the ternary complex, IF2 in eubacteria and eIF2 in eukaryotes are not the same protein (despite their unfortunately similar names). Both factors are GTPases; however, eubacterial IF-2 is a single polypeptide, while eIF2 is heterotrimeric. eIF2-gamma is a member of the same family as eubacterial IF2, but the two proteins are only distantly related. This family includes translation initiation, elongation, and release factors. Length = 203 Score = 26.8 bits (60), Expect = 8.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 24 AESPIPQPQKEEILIKVEAIGVNRPDVMQRK 54 A P PQPQ E L +E +G+ ++Q K Sbjct: 116 ANEPCPQPQTSEHLAALEIMGLKHIIIVQNK 146 >gnl|CDD|119337 cd06569, GH20_Sm-chitobiase-like, The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.. Length = 445 Score = 26.9 bits (60), Expect = 8.7 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 3/29 (10%) Query: 197 YLKEDFLEILQKETQGRGIDII--LDMVG 223 Y + D++EIL K + R I++I +DM G Sbjct: 94 YSRADYIEIL-KYAKARHIEVIPEIDMPG 121 >gnl|CDD|145441 pfam02287, Dehydratase_SU, Dehydratase small subunit. This family contains the small subunit of the trimeric diol dehydratases and glycerol dehydratases. These enzymes are produced by some enterobacteria in response to growth substances. Length = 136 Score = 26.6 bits (59), Expect = 9.0 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 5/41 (12%) Query: 252 TEINLNPIISKRIT-----ITGSTLRRRTDIAKQSIRDSLQ 287 +I L ++S ++T IT TLR + IA+ + R +L Sbjct: 28 DDITLENVLSGKVTAQDLRITPETLRMQAQIAESAGRPALA 68 >gnl|CDD|39037 KOG3833, KOG3833, KOG3833, Uncharacterized conserved protein, contains RtcB domain [Function unknown]. Length = 505 Score = 26.5 bits (58), Expect = 9.9 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Query: 146 GQ-TVLIHGGSSGIG--TTAIQLASYFGATVYTTAKSEEKCLACLKLGAKHAINYLK 199 GQ V+IH GS G+G L A ++ LAC ++ + +YLK Sbjct: 252 GQVVVMIHSGSRGLGHQVATDSLVKMEKAMARDKIVVNDRQLACARINSVEGQDYLK 308 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0784 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,984,325 Number of extensions: 210637 Number of successful extensions: 863 Number of sequences better than 10.0: 1 Number of HSP's gapped: 633 Number of HSP's successfully gapped: 150 Length of query: 332 Length of database: 6,263,737 Length adjustment: 94 Effective length of query: 238 Effective length of database: 4,232,491 Effective search space: 1007332858 Effective search space used: 1007332858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 58 (26.0 bits)