HHsearch alignment for GI: 254780294 and conserved domain: KOG1430

>KOG1430 consensus.
Probab=94.68  E-value=0.059  Score=31.32  Aligned_cols=37  Identities=11%  Similarity=0.236  Sum_probs=31.6

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHCC-CCEEEEEEECCCC
Q ss_conf             907999758867899999998629-9728999965300
Q gi|254780294|r    1 MYKIFIDGEHGTTGLKIRSRIVQR-KDLCLLSIPCEER   37 (311)
Q Consensus         1 M~kVaIvGATG~vG~~li~lL~~h-p~~~l~~l~s~~~   37 (311)
T Consensus         4 ~~~vlVtGG~GflG~hlv~~L~~~~~~~~irv~D~~~~   41 (361)
T KOG1430           4 KLSVLVTGGSGFLGQHLVQALLENELKLEIRVVDKTPT   41 (361)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCC
T ss_conf             77799989833789999999984566617999536775