HHsearch alignment for GI: 254780294 and conserved domain: PRK13535

>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional.
Probab=99.17  E-value=2.6e-08  Score=70.67  Aligned_cols=281  Identities=14%  Similarity=0.130  Sum_probs=173.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC---CCCEEEEEEECCCCC-------------C-----------------CCC------
Q ss_conf             0799975886789999999862---997289999653007-------------8-----------------600------
Q gi|254780294|r    2 YKIFIDGEHGTTGLKIRSRIVQ---RKDLCLLSIPCEERH-------------N-----------------LRY------   42 (311)
Q Consensus         2 ~kVaIvGATG~vG~~li~lL~~---hp~~~l~~l~s~~~a-------------g-----------------~~~------   42 (311)
T Consensus         2 ikIgINGF-GRIGR~v~R~~~e~~~~~~i~vVaINd~~~~~~~ayLLkyDSvhG~~~~~v~~~~~~l~v~~~~I~~~~~~   80 (336)
T PRK13535          2 IRVAINGF-GRIGRNVLRALYESGRRAEITVVAINELADAEGMAHLLKYDTSHGRFAWEVRQERDQLFVGDDAIRLLHER   80 (336)
T ss_pred             EEEEEECC-CHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHCCCCCCCCCCCCEEEECCEEEECCEEEEEEECC
T ss_conf             69999788-88999999999866889986999978899989999986422678889997897089799999899999558


Q ss_pred             --CHHHHC--CCCEEEECCCCHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHCCCCCCHHHHHHCCCCEEEECCCCC
Q ss_conf             --667747--9989999389837899999986125848982276303555431100210004776520496077258421
Q gi|254780294|r   43 --REDLLN--AADVSILCLPDVASLEIIQLIKKNGINSRIIDTSTAHRIAPGWVYGFPEMDKSQKEKIRSARYITNPGCY  118 (311)
Q Consensus        43 --~~~~~~--~~Divf~a~p~~~s~~~~~~~~~~g~~~~vid~ss~~R~~~~vpl~vPEvN~~~~~~~~~~~iIanPnC~  118 (311)
T Consensus        81 dp~~ipW~~~~vD~ViE~TG~f~~~~~a~~Hl~~GakkViiSaP~~~~~d---~tiV~GVN~~~~~~--~~~IiSnASCT  155 (336)
T PRK13535         81 DLASLPWRELGVDVVLDCTGVYGSREDGEAHIAAGAKKVLFSHPGSNDLD---ATVVYGVNHDQLRA--EHRIVSNASCT  155 (336)
T ss_pred             CHHHCCCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCCCC---CEEEECCCHHHCCC--CCEEEECCCCC
T ss_conf             94339831158759997043116789999998759856898258876668---63896157567486--65389757533


Q ss_pred             CCCCHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCHHCCCC-CCCCCCCCCCCCCCCCC---CCCCCCCHHHHCCC
Q ss_conf             133112478888850345565026765123333561000000134-44322343322222344---44434201332167
Q gi|254780294|r  119 ATGAIAILRPLRKAKLLPDRYPITINAVSGYTGGGKKLISRMEQK-NMPDTISSNHFFYSLDL---LHKHLPEITQYSLI  194 (311)
Q Consensus       119 ~t~~~laL~PL~~~~~i~~~~~~~~~~~sg~sgaG~~~~~~~~~~-~~~~~~~~~~~~~~~~~---~~~h~~e~~~~~~~  194 (311)
T Consensus       156 TNclAPv~kvl~~~fGI~~g~mTTIHa~T~~Q~----l~D~~h~d~Rr~Raa~~nIIPtsTgAakAi~~VlP~L------  225 (336)
T PRK13535        156 TNCIIPVIKLLDDAFGIESGTVTTIHSAMNDQQ----VIDAYHPDLRRTRAASQSIIPVDTKLAAGITRIFPQF------  225 (336)
T ss_pred             CCEEEEHHHHHHHCCCEEEEEEEEEECCCCCCC----CCCCCCCCCCCCCCHHHCCEECCCHHHHHHHHHCHHH------
T ss_conf             241401255366336757757887723768776----6667788863444024375456621788885216543------


Q ss_pred             CEEEEEEEECCCCCCEEEEEEEEEEECCCCCCCHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCCHHHHCCCCEEEE--
Q ss_conf             113688752034332027899998632577544899886654220014430560278788789864276279960799--
Q gi|254780294|r  195 KTSPMFLPSVGRFPQGIAIQISLDMERLSWKTNSEELHSIFQEYYMGQNIVSVVPLEESRKIKTIACEMMSGNDKLHL--  272 (311)
Q Consensus       195 ~~~~~~~~~~~~~~~g~~~~v~v~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~~~~~~~~~p~~~~~~g~n~v~V--  272 (311)
T Consensus       226 ~GKl~G~a~RVPt~~vS~vDlt~~---l~k~~t~eein~~~k~aa~~-~lkgil~y~~~~---lVS~-Df~~~~~SsI~D  297 (336)
T PRK13535        226 NDRFEAISVRVPTINVTAIDLSVT---VKKPVKVNEVNQLLQKAAQG-AFHGIVDYTELP---LVSI-DFNHDPHSAIVD  297 (336)
T ss_pred             CCCEEEEEEECCCCCCEEEEEEEE---ECCCCCHHHHHHHHHHHHHC-CCCCEEEEECCC---EEEE-CCCCCCCCEEEE
T ss_conf             786437899767897158999999---63665489999999998536-447844438796---4242-049999500787


Q ss_pred             -EEEEECCCCEEEEEEEECCCHHHHHHHHHHHHHHH
Q ss_conf             -99980899769999972221013689999999987
Q gi|254780294|r  273 -FFFDSSELPYINIIAVFDNLGKGASGAAIQNMDLL  307 (311)
Q Consensus       273 -g~~~~~~~~~~~v~s~~DNL~KGAAgnAVQn~nlm  307 (311)
T Consensus       298 ~~~t~v~~~~~vKv~aWYDNE-wGYs~R~vdla~~m  332 (336)
T PRK13535        298 GTQTRVSGAHLIKTLVWCDNE-WGFANRMLDTTLAM  332 (336)
T ss_pred             HHHCEEECCCEEEEEEEECCH-HHHHHHHHHHHHHH
T ss_conf             304599789889999998867-99999999999999