>cd00704 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. MDHs belong to the NAD-dependent, lactate dehydrogenase (LDH)-like, 2-hydroxycarboxylate dehydrogenase family, which also includes the GH4 family of glycoside hydrolases. They are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

Probab=96.89 E-value=0.0031 Score=39.25 Aligned_cols=57 Identities=19% Similarity=0.267 Sum_probs=39.0 Q ss_pred CEEEEECCCCHHHHHHHHHHHCCCC------EEEEEEECCCC----CCCCC------------------CHHHHCCCCEE Q ss_conf 0799975886789999999862997------28999965300----78600------------------66774799899 Q gi|254780294|r 2 YKIFIDGEHGTTGLKIRSRIVQRKD------LCLLSIPCEER----HNLRY------------------REDLLNAADVS 53 (311) Q Consensus 2 ~kVaIvGATG~vG~~li~lL~~hp~------~~l~~l~s~~~----ag~~~------------------~~~~~~~~Div 53 (311) T Consensus 1 ~KV~IiGA~G~IG~~la~~l~~~~l~g~~~~i~l~L~Di~~~~~~~~G~~mdl~~~a~~~~~~v~~~~~~~~~~~~aDvV 80 (323) T cd00704 1 LHVLITGAAGQIGYNLLFLIASGELFGDDQPVILHLLDIPPAMKALEGVVMELQDCAFPLLKGVVITTDPEEAFKDVDVA 80 (323) T ss_pred CEEEEECCCCHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCCEEECCCHHHHHCCCCEE T ss_conf 98999899978999999999728636998600899975888655531487866534665558748428858983799889 Q ss_pred EECCC Q ss_conf 99389 Q gi|254780294|r 54 ILCLP 58 (311) Q Consensus 54 f~a~p 58 (311) T Consensus 81 iitaG 85 (323) T cd00704 81 ILVGA 85 (323) T ss_pred EECCC T ss_conf 98278

HHsearch alignment for GI: 254780294 and conserved domain: cd00704