>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are eukaryotic MDHs localized to the cytoplasm and cytosol. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

Probab=96.60 E-value=0.0091 Score=36.34 Aligned_cols=57 Identities=16% Similarity=0.248 Sum_probs=41.3 Q ss_pred CEEEEECCCCHHHHHHHHHHHCCCC------EEEEEEECCCCC----CCCC------------------CHHHHCCCCEE Q ss_conf 0799975886789999999862997------289999653007----8600------------------66774799899 Q gi|254780294|r 2 YKIFIDGEHGTTGLKIRSRIVQRKD------LCLLSIPCEERH----NLRY------------------REDLLNAADVS 53 (311) Q Consensus 2 ~kVaIvGATG~vG~~li~lL~~hp~------~~l~~l~s~~~a----g~~~------------------~~~~~~~~Div 53 (311) T Consensus 3 ~kV~VtGAaG~Ig~~l~~~la~g~~~g~~~~i~L~L~Di~~~~~~l~Gv~mel~d~a~p~l~~i~~~~~~~~a~~~aDvv 82 (325) T cd01336 3 IRVLVTGAAGQIAYSLLPMIAKGDVFGPDQPVILHLLDIPPALKALEGVVMELQDCAFPLLKSVVATTDPEEAFKDVDVA 82 (325) T ss_pred EEEEEECCCHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCCCCEEEEEHHHCCCCCCCCEEECCCHHHHHCCCCEE T ss_conf 19999888718899999999758856899705999966778677655267457437864558735228878983688789 Q ss_pred EECCC Q ss_conf 99389 Q gi|254780294|r 54 ILCLP 58 (311) Q Consensus 54 f~a~p 58 (311) T Consensus 83 ii~ag 87 (325) T cd01336 83 ILVGA 87 (325) T ss_pred EEECC T ss_conf 99488

HHsearch alignment for GI: 254780294 and conserved domain: cd01336