RPSBLAST alignment for GI: 254780295 and conserved domain: cd02866

>gnl|CDD|30026 cd02866, PseudoU_synth_TruA_Archea, PseudoU_synth_archea: Pseudouridine synthase,. This group consists of archealpseudouridine synthases.Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. This group of proteins make Psedouridine in tRNAs.. Length = 221
 Score =  136 bits (343), Expect = 7e-33
 Identities = 81/243 (33%), Positives = 121/243 (49%), Gaps = 28/243 (11%)

Query: 8   IEYNGSGYFGWQRQKNGSSIQGSIEKAI----FLVTGEIVVVHGAGRTDSGVHALRQVAH 63
           + Y+G+ Y G+QRQ +  +++G + KA+     + + +   ++ AGRTD+GV AL  V  
Sbjct: 3   VAYDGTPYHGFQRQPDVRTVEGELIKALRRLGIIESPKRPRLYSAGRTDAGVSALGNVVA 62

Query: 64  FDLVREWVPVILCKALNAYLKISDTISILNLSIVDKQFHARFSAIRRSYLYRIITRQAPL 123
           F+  +E  P     A+N  L     I +   + V + FH R  A RR Y Y         
Sbjct: 63  FETEKELTP----PAINNALP--KDIRVWAWAKVPEDFHPRRDARRRYYRY--------- 107

Query: 124 ALEKGRAWLIPKSLDCENMRIAAQHLVGRHDFTTFRSIHCQASSPIRTIDHFDVNSFGNL 183
                  +L  +  D E M  AA+ L+G HDF+ F         P+RTI+  ++   G  
Sbjct: 108 -------YLGAEDYDVEAMAEAAKKLIGTHDFSNFSKR--DGRDPVRTIERIEIRENGEF 158

Query: 184 IEIRVVARSFLHTQIRSFVGSLKLVGDGKWTSTDLEKALQAQDRKECGPLAPPEGLYFDS 243
           + I VV  SFL   +R  VG+L LVG GK  +  ++K L  + RK+ G  APPEGL    
Sbjct: 159 LVIDVVGESFLWNMVRRIVGALSLVGKGKRENEWVDKLLDGEFRKKDGVPAPPEGLILVD 218

Query: 244 VEY 246
           V+Y
Sbjct: 219 VKY 221