BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780297|ref|YP_003064710.1| peptide deformylase [Candidatus Liberibacter asiaticus str. psy62] (170 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780297|ref|YP_003064710.1| peptide deformylase [Candidatus Liberibacter asiaticus str. psy62] Length = 170 Score = 347 bits (890), Expect = 6e-98, Method: Compositional matrix adjust. Identities = 170/170 (100%), Positives = 170/170 (100%) Query: 1 MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60 MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV Sbjct: 1 MVKKPLVIFPDPILRRVSRPIEKINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRLVV 60 Query: 61 IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120 IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ Sbjct: 61 IDLQDHAHRKNPMVFINPKIITFSDDFSVYQEGCLSIPDYRADVKRSAFITVRYMDCNAQ 120 Query: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD Sbjct: 121 HQIIYADGLLATCLQHELDHLNGILFIDHLSRLKRDMITKKMSKLVQLRD 170 >gi|254780860|ref|YP_003065273.1| NADH dehydrogenase subunit H [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 23.5 bits (49), Expect = 2.4, Method: Compositional matrix adjust. Identities = 15/62 (24%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Query: 8 IFPDPILRRVSRPIEKINSDIMNLIDNM--LEVMYSTDGIGLAAVQIGVLYRLVVIDLQD 65 +F +PI+ S I + + ++++I ++ V+ DG +A + +G+LY L + L+ Sbjct: 69 VFKEPIIPSKSNKILFLLAPLVSVILSLSAWAVVPVADGWIIADINVGILYILAISSLEI 128 Query: 66 HA 67 + Sbjct: 129 YG 130 >gi|254780865|ref|YP_003065278.1| NADH dehydrogenase subunit L [Candidatus Liberibacter asiaticus str. psy62] Length = 666 Score = 23.1 bits (48), Expect = 2.8, Method: Composition-based stats. Identities = 7/17 (41%), Positives = 14/17 (82%) Query: 33 DNMLEVMYSTDGIGLAA 49 DN+L++ + +G+GLA+ Sbjct: 136 DNLLQMFFGWEGVGLAS 152 >gi|254780778|ref|YP_003065191.1| elongation factor Ts [Candidatus Liberibacter asiaticus str. psy62] Length = 296 Score = 22.7 bits (47), Expect = 3.3, Method: Compositional matrix adjust. Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 25 NSDIMNLIDNMLEVMYSTDG 44 N+D +L+ N+ + STDG Sbjct: 87 NTDFQSLVSNIAGIALSTDG 106 >gi|254780711|ref|YP_003065124.1| signal recognition particle protein [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 22.7 bits (47), Expect = 3.7, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 23 KINSDIMNLIDNMLEVMYSTDGIGLAAVQIGVLYRL 58 KIN ++ L + E+M+ST G+G A+ ++ RL Sbjct: 412 KINK-LLKLHRQVAEMMHSTQGLGGNALTQQIMGRL 446 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 22.3 bits (46), Expect = 4.3, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 19/30 (63%) Query: 13 ILRRVSRPIEKINSDIMNLIDNMLEVMYST 42 + + +R +++ I + ID +LEV++ST Sbjct: 308 VTEKTTRIVQESAQTISSKIDQLLEVLHST 337 >gi|254780221|ref|YP_003064634.1| hypothetical protein CLIBASIA_00530 [Candidatus Liberibacter asiaticus str. psy62] Length = 97 Score = 21.9 bits (45), Expect = 6.1, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 4/25 (16%) Query: 11 DPILRRVSRPIE----KINSDIMNL 31 DPILRR+ P++ +INS L Sbjct: 71 DPILRRMDGPVKHVERRINSKTTTL 95 >gi|254780499|ref|YP_003064912.1| hypothetical protein CLIBASIA_01930 [Candidatus Liberibacter asiaticus str. psy62] Length = 167 Score = 21.9 bits (45), Expect = 6.4, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 65 DHAHRKNPMVFINPKIITFSDD 86 D + +KN +V P I+ FS+D Sbjct: 107 DTSGKKNVVVIREPDILPFSED 128 >gi|254780847|ref|YP_003065260.1| hypothetical protein CLIBASIA_03710 [Candidatus Liberibacter asiaticus str. psy62] Length = 282 Score = 21.9 bits (45), Expect = 7.0, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Query: 56 YRLVVIDLQDHAHRKNPMVFINPKIIT 82 YR++ L+ AHR P++ NP I+ Sbjct: 142 YRML---LERFAHRHIPLICANPDIVA 165 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.327 0.143 0.418 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 109,642 Number of Sequences: 1233 Number of extensions: 4169 Number of successful extensions: 20 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 11 length of query: 170 length of database: 328,796 effective HSP length: 68 effective length of query: 102 effective length of database: 244,952 effective search space: 24985104 effective search space used: 24985104 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 35 (18.1 bits)