HHsearch results for GI: 254780299 and protein with PDBid: 2c12_A

>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A*
Probab=100.00  E-value=0  Score=411.44  Aligned_cols=359  Identities=14%  Similarity=0.201  Sum_probs=290.3

Q ss_pred             CCEECCCCCCCCCCCEEECCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHH
Q ss_conf             98462017998521365668899999999996796203377666644476379999999998301445312213567789
Q gi|254780299|r   81 TPQLHAYGPGGERWDKVEFHPAWHALLRRSIHDGLHCSIWDRSFEPVVRKQAHKIRAARLYLMAQLEAGHLMSPSVTSAS  160 (562)
Q Consensus        81 ~P~l~~~d~~G~r~d~v~~~p~~~~l~~~~~~~Gl~~~~~~~~~~~~~~~~~~~~~~a~~~l~~~~~~g~~cp~~mt~~a  160 (562)
                      .|....++....+.++.   |..+++++.+.+.||.++.++.++|+.+..  ....+....-.+..++++.+++.++...
T Consensus        26 ~p~~~e~~~~~d~~~~~---~~~~~~~~~l~e~Gl~~l~vP~e~GG~g~~--~~~~~~v~e~la~~~~s~~~~~~~~~~~  100 (439)
T 2c12_A           26 TKASAEYSTQKDQLSRF---QATRPFYREAVRHGLIKAQVPIPLGGTMES--LVHESIILEELFAVEPATSITIVATALG  100 (439)
T ss_dssp             GGHHHHHTTCSSHHHHH---HTTHHHHHHHHHTTTTGGGSBGGGTCCBCC--HHHHHHHHHHHHTTCCTTHHHHHHHHHH
T ss_pred             CCCHHHHHHHCCCCCCC---CCCHHHHHHHHHCCCCCCCCCHHHCCCCCC--HHHHHHHHHHHHHHCCCCHHHHCCCHHH
T ss_conf             72256786524511246---674999999997799876889435999989--9999999999987585502553254689


Q ss_pred             HHHH-H-CCHHHHHHHHHHHCCCCCCHHHCCCCCCCCCEEEEECCCCCCCCCHH-----HCCEEEEECCCCEEEECCEEE
Q ss_conf             9998-5-08788987301200100054426600155212355445888887866-----543027864896689845146
Q gi|254780299|r  161 MVAL-M-TTPRVHKDWAPKIFSREYDPTNKAPMQKTSVAIGLGLTEKRGGTDIA-----AITSQGQKISDGIYCLSGHKW  233 (562)
Q Consensus       161 ~~~L-~-~~~e~~~~~lp~l~s~~~~~~~~~~~~k~g~~~~~~lTEp~~GSDv~-----~~~T~A~~~gdg~y~LnG~Kw  233 (562)
                      +..+ . ++++++++|+|++++++.           .+++++++|||++|||+.     +++|+|++++|+ |+|||+|+
T Consensus       101 ~~~l~~~g~~~~~~~~l~~l~~g~g-----------~~~~~~a~sEp~~Gsd~~~~~~~~~~t~a~~~g~~-~~lnG~K~  168 (439)
T 2c12_A          101 LMPVILCDSPSLQEKFLKPFISGEG-----------EPLASLMHSEPNGTANWLQKGGPGLQTTARKVGNE-WVISGEKL  168 (439)
T ss_dssp             HHHHHHSSCHHHHHHHTGGGGSSCS-----------CCCEEEECCCTTCSTTTTCTTSCCCSCEEEEETTE-EEEEEEEE
T ss_pred             HHHHHHHCCHHHHHHHHHHCCCCCH-----------HEEEEECCCCCCCCCCCCCCCCCCCEEEEEEECCE-EEEEEEEE
T ss_conf             9999984999999999862135441-----------20102123434543223455654535899980997-89844798


Q ss_pred             EEEC-CCCC-----EEEEEEECC--------------CCCEEEEEECCCCCCC-CCCEEEEEECCCCCCCCCCEEEEEEC
Q ss_conf             8634-2115-----799970469--------------9617999877589884-03478863047554565772799986
Q gi|254780299|r  234 FLSS-PMSD-----AFIMLAQVE--------------GRVGCFLVPRLLEDGS-PNGLCYQRLKNKIGNRSNATVELEFS  292 (562)
Q Consensus       234 f~sa-~~ad-----~~lVlArt~--------------~Gls~FlVp~~~pgg~-~n~v~i~r~~~klG~r~~~t~ei~f~  292 (562)
                      |+|+ +.+|     +++|++++.              +++++|+||++.++.+ .+++.+...++++|+++++++++.|+
T Consensus       169 f~s~~~~ad~~~a~~~~v~a~~~~~~~~~~~~~~~~~~~~~~~lv~~~~~g~~~~~~~~~~~~~~~~G~~~~~~~~~~~~  248 (439)
T 2c12_A          169 WPSNSGGWDYKGADLACVVCRVSDDPSKPQDPNVDPATQIAVLLVTRETIANNKKDAYQILGEPELAGHITTSGPHTRFT  248 (439)
T ss_dssp             CCTTTTTTTSSCCSEEEEEEEECSCTTSCCCTTSCGGGGEEEEEECHHHHHTSCGGGEEEEECCCBSSCTTCCCCEEEEE
T ss_pred             EECCCCCCCHHHHHHHHEEEEECCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCEECCCCCCCCCCCCCCCCHHEE
T ss_conf             44688642124410322156851465666555557878448999845888865566510036534477766787401000


Q ss_pred             CEEE---EEECCCCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-CCHHHCCCHHHHHHHHHHHHH
Q ss_conf             9075---30077765799999-973013335799999999999999999984046222-423538888999999999999
Q gi|254780299|r  293 NTFG---FLLGDLNVSTGPVE-DMKILIYLDSAIMSVSGMRVSLAEAIHYARRRHVSG-GILIDQPVMKRAIADIALDIA  367 (562)
Q Consensus       293 ~~~~---~llG~~g~G~~~i~-~~l~~~Rl~~a~~~~G~ar~al~~A~~yA~~R~~fG-~~L~~~p~v~~~LAdm~~~~e  367 (562)
                      ++++   +++|+++.|...+. .+.+.+|+.+++.++|+++++++.+++|+++|++|| +||.++|.+|++|++|.++++
T Consensus       249 ~v~v~~~~~l~~~~~~~~~~~~~~~~~~~~~~aa~~~G~a~~al~~a~~y~~~R~~fg~~~l~~~~~vq~~la~~~~~l~  328 (439)
T 2c12_A          249 EFHVPHENLLCTPGLKAQGLVETAFAMSAALVGAMAIGTARAAFEEALVFAKSDTRGGSKHIIEHQSVADKLIDCKIRLE  328 (439)
T ss_dssp             EEEEEGGGBCSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCTTSSSCGGGSHHHHHHHHHHHHHHH
T ss_pred             ECCCCHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             03450330235766555411455666555778999999999978889999986440478772101278899999999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHCCHHHHHCCCCH
Q ss_conf             99999999998872011103677765567999999999999999956998852130004551889850012232204622
Q gi|254780299|r  368 AATALSFRLANSFDEAKSRSEEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYRESPANSILLGSG  447 (562)
Q Consensus       368 aa~~l~~~~A~~~D~~~~~~~~~a~arl~t~iaK~~~~e~a~~v~~~Aiqi~GG~Gy~ee~~leRl~RDA~v~~I~EGt~  447 (562)
                      +++++++++++.+|........   ....++++|+++++.+.+++++|+|++||.||++|+|++|+|||+++++|||||+
T Consensus       329 aar~l~~~aa~~~d~~~~~~~~---~~~~a~~~K~~ate~a~~v~~~a~q~~Gg~g~~~~~~l~r~~RDa~~~~i~eG~~  405 (439)
T 2c12_A          329 TSRLLVWKAVTTLEDEALEWKV---KLEMAMQTKIYTTDVAVECVIDAMKAVGMKSYAKDMSFPRLLNEVMCYPLFDGGN  405 (439)
T ss_dssp             HHHHHHHHHHHHHTCTTSCHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHCGGGGBTTSSHHHHHHHHTTTTTSSSCT
T ss_pred             HHHHHHHHHHHHHHHCCCCCCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCEEECCHH
T ss_conf             9999999999999807987653---4999999999999999999999999831788726877999996413762774705


Q ss_pred             HHHHHHHH-HHHC
Q ss_conf             27899999-9831
Q gi|254780299|r  448 NAMVLDVL-NLLE  459 (562)
Q Consensus       448 ~I~aldv~-r~l~  459 (562)
                      +++....+ |.+.
T Consensus       406 ~~~~~~~~~r~l~  418 (439)
T 2c12_A          406 IGLRRRQMQRVMA  418 (439)
T ss_dssp             TTTHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHC
T ss_conf             9999999999973