RPSBLAST alignment for GI: 254780299 and conserved domain: pfam08028

>gnl|CDD|149227 pfam08028, Acyl-CoA_dh_2, Acyl-CoA dehydrogenase, C-terminal domain. Length = 134
 Score = 46.1 bits (110), Expect = 3e-05
 Identities = 30/111 (27%), Positives = 43/111 (38%), Gaps = 11/111 (9%)

Query: 332 LAEAIHYARRRH--VSGGILIDQPVMKRAIADIALDIAAATALSFRLANSFDEAKSRS-- 387
           LA  I  AR R     G  L + P  +  +A+ A +I AA  L  R A+       R   
Sbjct: 15  LAAFIERARERVRAYGGAPLAEDPATQTRLAEAAAEIDAARLLLERAADRIWAHADRGDE 74

Query: 388 ---EEAAYARIMAPITKYWCCKMAPAVIAEAMECIGGSGYIEERSIARHYR 435
              EE A AR           ++A A +       GGS   ++  + R +R
Sbjct: 75  VTPEERARAR----RDAALAAELAVAAVDRLFRAAGGSALFKDSPLQRFWR 121