HHsearch alignment for GI: 254780301 and conserved domain: COG3653

>COG3653 N-acyl-D-aspartate/D-glutamate deacylase [Secondary metabolites biosynthesis, transport, and catabolism].
Probab=99.89  E-value=1.9e-21  Score=156.33  Aligned_cols=66  Identities=21%  Similarity=0.328  Sum_probs=56.6

Q ss_pred             CCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCC
Q ss_conf             62699642999988885000108997999998317865566678877998879889517271411478
Q gi|254780301|r    2 TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLT   69 (431)
Q Consensus         2 ~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~   69 (431)
T Consensus         6 YD~ViR~g~ifDGtGnp~f~tdvgIrDGvIaav~kg~~dg--~~~~eevDaagriVaPGFIDvHtHyD   71 (579)
T COG3653           6 YDVVIRDGLIFDGTGNPPFTTDVGIRDGVIAAVAKGALDG--TGCPEEVDAAGRIVAPGFIDVHTHYD   71 (579)
T ss_pred             EEEEEEECEEEECCCCCCCCCCCCCCCCEEEEEECCCCCC--CCCCEEECCCCCEECCCEEEEEECCC
T ss_conf             2478850359857999864122122355589986133335--68873552668675266777554156