HHsearch alignment for GI: 254780301 and conserved domain: PRK09357

>PRK09357 pyrC dihydroorotase; Validated.
Probab=100.00  E-value=0  Score=364.59  Aligned_cols=424  Identities=37%  Similarity=0.615  Sum_probs=198.5

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899983114378
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNIT   80 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~   80 (431)
T Consensus         1 M~-llIkNg~Vvdp~~~~~~~~dI~I~~gkI~~Ig~~i~---~~~~~~vIDA~G~~V~PGfID~H~H~~~pg~~~~~~~~   76 (425)
T PRK09357          1 MM-ILIKNGRVIDPKSGLDQVADILIDDGKIAAIGAAIE---AFEGAEVIDATGLVVAPGLVDLHVHLREPGQEYKETIE   76 (425)
T ss_pred             CC-EEEECEEEECCCCCCEEEEEEEEECCEEEEECCCCC---CCCCCEEEECCCCEECCCEEECCCCCCCCCCCCCHHHH
T ss_conf             92-999780998998885058799998999989468899---88999799899999924989777167889976300366


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999870787321245455664333166777767766431012232100013443222222210000011222234333
Q gi|254780301|r   81 TLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPM  160 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (431)
T Consensus        77 ~g~~aa~~gGvTtv~~~p~~~p~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~l~~~~~l~~~g~~~~s~~~~  155 (425)
T PRK09357         77 TGTRAAAAGGFTTVVAMPNTNPVIDTPEV-VEYVLDLAKEAGVVDVLPVGAITKGLAGEELTEFGALAEAGVVAFSDDGI  155 (425)
T ss_pred             HHHHHHHHCCEEEEECCCCCCCCCCCHHH-HHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHCCEEEEECCCC
T ss_conf             76899985780589616898777785999-99999864204851146752135776504567777654257479813992


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             22221101245676542101222233322222221124675310012222100001235555665432000111222333
Q gi|254780301|r  161 SIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS  240 (431)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (431)
T Consensus       156 ~~~~~~~l~~~~~~a~~~~~~~~~h~e~~~l~~~~~~~~g~~~~~~~~~~~p~~~E~~~i~r~~~la~~~g~~~hi~H~s  235 (425)
T PRK09357        156 PVQDARLMRRALEYAKKLDLLIAQHCEDPSLTEGGVMNEGIVAARLGLPGIPEVAEEVAIARDVLLAEETGARYHICHVS  235 (425)
T ss_pred             EECCHHHHHHHHHHHHHCCCEEEECCCCHHHHHCHHHCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             30458999999988864595699742523344220224686312038999976788989999999887619926875146


Q ss_pred             CHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11211001111001222322222222222322221110000001112222222222222334431111344454543222
Q gi|254780301|r  241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTK  320 (431)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  320 (431)
T Consensus       236 s~~~le~i~~ak~~G~~vt~e~~p~~l~~t~~~~~~~~~~~k~~PpLr~~~~~~~l~~~l~~g~i~~i~tDh~P~~~~~k  315 (425)
T PRK09357        236 TAGSVELIRFAKALGIKVTAEVTPHHLLLTDEDLLTYDGNYKVNPPLRSKEDREALIEALKDGTIDAIATDHAPHAEEEK  315 (425)
T ss_pred             CHHHHHHHHHHHHCCCCCEEEECHHHHHCCHHHHHCCCCCEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHH
T ss_conf             16589999999983897523414556528985762368632207986525569999999966988999968888886773


Q ss_pred             CCCCCCCCCCCCCCCHHHHH-HHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEEECHHHHH
Q ss_conf             23433322222221013678-88676516989999999881517998099997246687267899869897885377852
Q gi|254780301|r  321 LLPFAEASFGSIGLETMLSA-ALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMS  399 (431)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~  399 (431)
T Consensus       316 ~~~~~~~~~G~~g~e~~~~~~~~~~v~~~~lsle~~v~~~T~nPAk~lGl~~G~i~~G~dADivi~Dp~~~~~v~~~~~~  395 (425)
T PRK09357        316 ECEFEAAPFGITGLETALSLLYTTLVKTGLLDLEQLLEKLSINPARILGLPAGPLAEGEPADLVIFDPEAEWTVDGEDFA  395 (425)
T ss_pred             CCCHHHCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCEEECHHHCC
T ss_conf             44500077898747768999999998759999999999997999999599877648999466899939997898756661


Q ss_pred             CCCCCCCCCCEEEEEEEEEEEECCEEEEEE
Q ss_conf             024886567727822889999999999862
Q gi|254780301|r  400 SIHKNTVFDKEFFTGKVVRTYISGKQVYTL  429 (431)
Q Consensus       400 s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~  429 (431)
T Consensus       396 s~~~~sp~~g~~~~g~v~~ti~~G~~v~~~  425 (425)
T PRK09357        396 SKGKNTPFIGMKLKGKVVYTIVDGKIVYQD  425 (425)
T ss_pred             CCCCCCCCCCCEEEEEEEEEEECCEEEEEC
T ss_conf             768978815978888999999999999979