HHsearch alignment for GI: 254780301 and conserved domain: TIGR01224

>TIGR01224 hutI imidazolonepropionase; InterPro: IPR005920 Imidazolonepropionase (3.5.2.7 from EC) catalyzes the third step in histidine degradation. 4-imidazolone-5-propanoate + H2O = N-formimino-L-glutamate ; GO: 0016812 hydrolase activity acting on carbon-nitrogen (but not peptide) bonds in cyclic amides, 0019556 histidine catabolic process to glutamate and formamide, 0005737 cytoplasm.
Probab=99.03  E-value=5.1e-10  Score=82.66  Aligned_cols=58  Identities=17%  Similarity=0.125  Sum_probs=45.1

Q ss_pred             CCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC-C--CEECCCCCCCEEEECCCC
Q ss_conf             221013678886765169899999998815179980999-9--724668726789986989
Q gi|254780301|r  332 IGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP-G--GTLQTGTAADIALIDLNY  389 (431)
Q Consensus       332 ~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~-~--G~I~~Gk~ADlvi~D~~~  389 (431)
T Consensus       325 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~g~~~~g~~~~~~~~~~~~  385 (409)
T TIGR01224       325 SPTLSLGLALSLACRLLKLTPEEALSAATLNAAYALGLGREGRGTLEAGKDADLVVWSAPS  385 (409)
T ss_pred             CHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCC
T ss_conf             2246788999988875203546766554321244514443233420025655357861777