>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.

Probab=99.88 E-value=8.6e-23 Score=164.91 Aligned_cols=52 Identities=21% Similarity=0.356 Sum_probs=44.2 Q ss_pred HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCC--CEECCCCCCCEEEECCC Q ss_conf 36788867651698999999988151799809999--72466872678998698 Q gi|254780301|r 337 MLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPG--GTLQTGTAADIALIDLN 388 (431) Q Consensus 337 ~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~--G~I~~Gk~ADlvi~D~~ 388 (431) T Consensus 281 ~~~~~~~~~~~~gl~~~eal~~aT~n~A~~lgl~~~~GsL~~Gk~ADlVv~D~d 334 (342) T cd01299 281 WNARELELLVKAGGTPAEALRAATANAAELLGLSDELGVIEAGKLADLLVVDGD 334 (342) T ss_pred HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCEECCCCCCCEEEECCC T ss_conf 999999999983999999999999999999689999770698985448998898

HHsearch alignment for GI: 254780301 and conserved domain: cd01299