HHsearch alignment for GI: 254780301 and conserved domain: cd01308

>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid. Formation of this bond is a spontaneous nonenzymatic reaction in nature and can profoundly effect the function of the protein. Isoaspartyl dipeptidase is an octameric enzyme that contains a binuclear zinc center in the active site of each subunit and shows a strong preference of hydrolyzing Asp-Leu dipeptides.
Probab=100.00  E-value=5.1e-37  Score=256.59  Aligned_cols=98  Identities=20%  Similarity=0.262  Sum_probs=71.6

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCC---CCC
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899983---114
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDE---YSK   77 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~---~~~   77 (431)
T Consensus         1 ~~--LIKng~v~~~~~--~~~~DVlI~~GkI~~I~~~~~~-~~~~~~evIDa~G~~v~PG~ID~HvH~~~~g~~~~~~~~   75 (387)
T cd01308           1 FT--LIKNAEVYAPEY--LGKKDILIAGGKILAIEDQLNL-PGYENVTVVDLHGKILVPGFIDQHVHIIGGGGEGGPSTR   75 (387)
T ss_pred             CE--EEECCEEECCCC--CCCCCEEEECCEEEEECCCCCC-CCCCCCEEEECCCCEECCCEEEECCCCCCCCCCCCCCCC
T ss_conf             96--997969988987--6354489989999994388888-888998899899999885875512266688888775557


Q ss_pred             CHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             37889999870787321245455664
Q gi|254780301|r   78 NITTLSKEAVAGGITSIILMPLGMSS  103 (431)
Q Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~~~~~  103 (431)
T Consensus        76 ~~~~~~~~~~~~G~Tt~~~~~~t~~~  101 (387)
T cd01308          76 TPEVTLSDLTTAGVTTVVGCLGTDGI  101 (387)
T ss_pred             CHHHHHHHHHHCCCEEEECCCCCCCC
T ss_conf             88999999997795189705788864