Query         gi|254780301|ref|YP_003064714.1| dihydroorotase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 431
No_of_seqs    506 out of 8152
Neff          13.2
Searched_HMMs 39220
Date          Sun May 29 18:43:30 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780301.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK09059 dihydroorotase; Valid 100.0       0       0  387.5  28.6  428    1-429     2-429 (429)
  2 PRK07627 dihydroorotase; Provi 100.0       0       0  372.3  28.4  424    1-429     1-424 (425)
  3 PRK09357 pyrC dihydroorotase;  100.0       0       0  364.6  28.3  424    1-429     1-425 (425)
  4 PRK07575 dihydroorotase; Provi 100.0       0       0  357.7  26.4  420    1-430     1-422 (439)
  5 PRK09236 dihydroorotase; Revie 100.0       0       0  354.5  27.1  423    1-430     1-429 (444)
  6 PRK02382 dihydroorotase; Provi 100.0       0       0  354.1  26.2  414    1-429     1-418 (440)
  7 PRK07369 dihydroorotase; Provi 100.0       0       0  354.2  25.8  418    1-421     1-419 (419)
  8 PRK08044 allantoinase; Provisi 100.0       0       0  351.8  26.7  422    1-430     1-436 (449)
  9 PRK06189 allantoinase; Provisi 100.0       0       0  350.3  27.0  421    1-429     1-432 (433)
 10 PRK13404 dihydropyrimidinase;  100.0       0       0  349.4  26.6  422    1-430     2-447 (476)
 11 PRK09060 dihydroorotase; Valid 100.0       0       0  347.3  27.2  414    3-429     6-424 (444)
 12 TIGR03178 allantoinase allanto 100.0       0       0  348.1  26.3  420    3-429     1-429 (442)
 13 cd01315 L-HYD_ALN L-Hydantoina 100.0       0       0  340.7  26.2  422    3-429     1-434 (447)
 14 PRK08323 dihydropyrimidinase;  100.0       0       0  340.3  26.0  420    1-429     1-441 (463)
 15 cd01314 D-HYD D-hydantoinases  100.0       0       0  330.9  25.4  420    4-430     1-438 (447)
 16 COG0044 PyrC Dihydroorotase an 100.0       0       0  325.3  26.6  421    3-431     2-424 (430)
 17 PRK04250 dihydroorotase; Provi 100.0 1.4E-45       0  311.6  25.9  392    1-430     1-392 (408)
 18 TIGR00857 pyrC_multi dihydroor 100.0 4.2E-45       0  308.5  22.3  409   20-430     4-459 (459)
 19 TIGR02033 D-hydantoinase dihyd 100.0   7E-45       0  307.4  20.6  425    4-430     1-452 (466)
 20 PRK01211 dihydroorotase; Provi 100.0 5.6E-43       0  295.0  24.5  390    8-430     6-395 (413)
 21 PRK08417 dihydroorotase; Provi 100.0 3.8E-43       0  296.0  22.8  386   24-429     1-387 (387)
 22 PRK00369 pyrC dihydroorotase;  100.0   3E-39 7.6E-44  271.0  22.9  372    3-429     3-375 (393)
 23 cd01297 D-aminoacylase D-amino 100.0 1.2E-38 2.9E-43  267.2  19.8   69    3-75      1-69  (415)
 24 cd01317 DHOase_IIa Dihydroorot 100.0 4.8E-38 1.2E-42  263.2  19.7  373   46-419     1-374 (374)
 25 cd01308 Isoaspartyl-dipeptidas 100.0 5.1E-37 1.3E-41  256.6  24.3   98    1-103     1-101 (387)
 26 PRK10657 isoaspartyl dipeptida 100.0 1.3E-35 3.2E-40  247.6  24.2   95    1-99      1-98  (384)
 27 PRK06038 N-ethylammeline chlor 100.0   6E-37 1.5E-41  256.2  15.8   66    1-70      1-68  (432)
 28 cd01298 ATZ_TRZ_like TRZ/ATZ f 100.0 1.6E-36 4.1E-41  253.4  16.8   81  344-429   326-407 (411)
 29 cd01318 DHOase_IIb Dihydroorot 100.0 7.4E-36 1.9E-40  249.1  19.0  360   54-423     1-361 (361)
 30 PRK08204 hypothetical protein; 100.0 5.5E-37 1.4E-41  256.4  12.0   67    1-71      1-69  (451)
 31 KOG2584 consensus              100.0   2E-36 5.1E-41  252.8  14.6  424    3-431    15-457 (522)
 32 PRK07228 N-ethylammeline chlor 100.0 8.8E-37 2.2E-41  255.1  12.2   67    1-71      1-68  (445)
 33 PRK09237 dihydroorotase; Provi 100.0 1.3E-34 3.3E-39  241.1  21.4   91    1-97      2-92  (384)
 34 PRK09061 D-glutamate deacylase 100.0 1.8E-34 4.5E-39  240.2  20.2   66    2-72      4-69  (496)
 35 PRK08203 hydroxydechloroatrazi 100.0 1.8E-35 4.5E-40  246.7  13.7   70    1-71      3-75  (456)
 36 cd00854 NagA N-acetylglucosami 100.0 1.2E-33 2.9E-38  235.0  19.4   88    4-96      1-91  (374)
 37 PRK06687 chlorohydrolase; Vali 100.0 2.5E-34 6.4E-39  239.3  15.5   69    3-72      1-71  (422)
 38 PRK12393 amidohydrolase; Provi 100.0 4.6E-35 1.2E-39  244.0  11.7   68    1-71      1-72  (459)
 39 PRK08393 N-ethylammeline chlor 100.0 1.2E-34   3E-39  241.4  13.6   63    4-70      1-63  (419)
 40 PRK09045 N-ethylammeline chlor 100.0 2.1E-34 5.4E-39  239.7  14.8   69    3-71      9-79  (444)
 41 PRK06151 N-ethylammeline chlor 100.0 2.5E-34 6.4E-39  239.2  14.5   78  347-429   353-431 (480)
 42 PRK09356 imidazolonepropionase 100.0 1.5E-34 3.8E-39  240.7  12.9   72    1-74      1-79  (401)
 43 PRK12394 putative metallo-depe 100.0 1.3E-33 3.4E-38  234.6  17.7   90    1-97      2-92  (387)
 44 PRK06380 metal-dependent hydro 100.0   4E-34   1E-38  237.9  14.2   78  347-429   322-401 (418)
 45 PRK11170 nagA N-acetylglucosam 100.0 3.1E-32   8E-37  225.7  20.6   94    5-102     3-103 (381)
 46 cd01302 Cyclic_amidohydrolases 100.0 1.2E-32 3.2E-37  228.3  16.7  330   55-419     1-337 (337)
 47 PRK09228 guanine deaminase; Pr 100.0 1.7E-31 4.2E-36  221.1  15.8   70    1-70      1-80  (429)
 48 COG1228 HutI Imidazolonepropio 100.0 8.6E-32 2.2E-36  222.9  12.7   70    3-75     11-80  (406)
 49 PRK08418 chlorohydrolase; Prov 100.0 1.6E-32 4.2E-37  227.5   8.9   68    1-71      1-70  (407)
 50 PRK07203 putative chlorohydrol 100.0 9.9E-32 2.5E-36  222.5  12.0   67    4-70      2-70  (442)
 51 TIGR03179 gua_deam guanine dea 100.0 6.6E-33 1.7E-37  230.1   4.7   55   16-70     24-79  (427)
 52 TIGR03314 Se_ssnA putative sel 100.0 5.7E-31 1.5E-35  217.6  11.8   68    4-71      1-70  (441)
 53 PRK07213 chlorohydrolase; Prov 100.0 1.1E-30 2.7E-35  215.9  13.1   81  338-424   296-377 (378)
 54 TIGR03583 EF_0837 probable ami 100.0 8.2E-30 2.1E-34  210.2  16.6   84    2-97      1-85  (365)
 55 cd01309 Met_dep_hydrolase_C Me 100.0   8E-31   2E-35  216.7   9.3   70  338-427   288-359 (359)
 56 cd01307 Met_dep_hydrolase_B Me 100.0 4.3E-29 1.1E-33  205.5  17.8   70   23-98      1-70  (338)
 57 cd01316 CAD_DHOase The eukaryo 100.0 8.4E-29 2.1E-33  203.6  18.4  333   55-429     2-334 (344)
 58 PRK10027 cryptic adenine deami 100.0 1.1E-28 2.8E-33  202.9  18.7   90    3-99     31-120 (588)
 59 cd01293 Bact_CD Bacterial cyto 100.0 9.7E-31 2.5E-35  216.1   7.8   60    5-70      1-60  (398)
 60 cd01303 GDEase Guanine deamina 100.0 1.9E-30 4.7E-35  214.3   6.0   61   10-70     15-76  (429)
 61 PRK05985 cytosine deaminase; P 100.0 4.4E-29 1.1E-33  205.5  12.1   63    1-71      2-64  (398)
 62 COG1820 NagA N-acetylglucosami 100.0 5.1E-28 1.3E-32  198.6  16.5   95    4-103     2-100 (380)
 63 COG1001 AdeC Adenine deaminase 100.0 1.8E-27 4.6E-32  195.0  18.4   88    3-99     25-113 (584)
 64 cd01296 Imidazolone-5PH Imidaz 100.0 5.6E-29 1.4E-33  204.8   7.2   66  344-423   304-371 (371)
 65 COG1574 Predicted metal-depend 100.0   3E-27 7.7E-32  193.6  15.6   74    2-75      5-79  (535)
 66 PRK09229 N-formimino-L-glutama  99.9   5E-26 1.3E-30  185.8  14.8   78  347-429   355-434 (457)
 67 cd01312 Met_dep_hydrolase_D Me  99.9   3E-27 7.7E-32  193.6   5.1   69  347-424   313-381 (381)
 68 TIGR03121 one_C_dehyd_A formyl  99.9 1.9E-24 4.8E-29  175.6  18.4   91    3-98      1-120 (556)
 69 TIGR02318 phosphono_phnM phosp  99.9 5.4E-26 1.4E-30  185.5   9.8   82  324-427   305-391 (391)
 70 cd01304 FMDH_A Formylmethanofu  99.9 1.6E-24   4E-29  176.1  13.2   87    6-98      1-116 (541)
 71 cd01313 Met_dep_hydrolase_E Me  99.9 2.3E-25   6E-30  181.5   7.7   73  347-424   344-418 (418)
 72 COG0402 SsnA Cytosine deaminas  99.9 5.1E-24 1.3E-28  172.9  14.3   68    1-71      1-69  (421)
 73 TIGR01975 isoAsp_dipep beta-as  99.9 2.3E-23 5.9E-28  168.6   9.8  138    4-143     2-143 (391)
 74 PRK13308 ureC urease subunit a  99.9 2.7E-22 6.8E-27  161.8  14.7   70    3-73     69-147 (569)
 75 cd01300 YtcJ_like YtcJ_like me  99.9 2.3E-23 5.8E-28  168.6   8.6   49   23-71      1-50  (479)
 76 TIGR01792 urease_alph urease,   99.9 1.1E-23 2.8E-28  170.7   6.1  174    3-192    73-262 (605)
 77 COG3653 N-acyl-D-aspartate/D-g  99.9 1.9E-21 4.7E-26  156.3  17.2   66    2-69      6-71  (579)
 78 PRK07572 cytosine deaminase; V  99.9 1.4E-23 3.7E-28  169.9   5.8   60    3-70      2-61  (425)
 79 TIGR02967 guan_deamin guanine   99.9 6.4E-23 1.6E-27  165.7   9.0   53   18-70      3-64  (426)
 80 COG3964 Predicted amidohydrola  99.9 8.7E-23 2.2E-27  164.9   9.4   71    1-75      3-73  (386)
 81 PRK07583 cytosine deaminase; V  99.9 6.1E-22 1.5E-26  159.5  12.4   66    3-71     12-87  (437)
 82 PRK13207 ureC urease subunit a  99.9 1.2E-21 3.1E-26  157.5  13.5   82    3-96     68-157 (568)
 83 PRK13985 UreB urease subunit b  99.9 1.7E-21 4.3E-26  156.6  14.1   68    3-72     66-142 (568)
 84 cd00375 Urease_alpha Urease al  99.9 1.6E-21   4E-26  156.8  13.9   68    3-72     66-142 (567)
 85 PRK13309 ureC urease subunit a  99.9 1.3E-21 3.2E-26  157.4  13.4   84    3-96     69-161 (572)
 86 cd01299 Met_dep_hydrolase_A Me  99.9 8.6E-23 2.2E-27  164.9   7.1   52  337-388   281-334 (342)
 87 PRK13206 ureC urease subunit a  99.9 2.1E-21 5.5E-26  155.9  14.2   83    3-96     72-163 (573)
 88 cd01295 AdeC Adenine deaminase  99.9 3.9E-21 9.9E-26  154.3  13.1   69  339-430   224-293 (422)
 89 PRK09230 cytosine deaminase; P  99.9 5.1E-22 1.3E-26  160.0   8.4   65    1-71      1-67  (426)
 90 COG3454 Metal-dependent hydrol  99.9 1.6E-21 4.2E-26  156.7  10.1   76  330-427   300-377 (377)
 91 KOG3968 consensus               99.9 5.5E-21 1.4E-25  153.3  12.7   77  347-428   355-438 (439)
 92 COG1229 FwdA Formylmethanofura  99.8 5.4E-19 1.4E-23  140.4  15.3   66    1-71      2-68  (575)
 93 pfam01979 Amidohydro_1 Amidohy  99.8 1.2E-19 3.1E-24  144.7   9.7   52  335-386   254-307 (307)
 94 COG0804 UreC Urea amidohydrola  99.8 2.3E-18 5.9E-23  136.4   9.7   68    3-72     68-142 (568)
 95 PRK06846 deaminase; Validated   99.8 3.5E-17   9E-22  128.8  13.9   68    1-70      3-78  (410)
 96 KOG3892 consensus               99.7 8.6E-16 2.2E-20  119.8  15.9   79  327-430   326-406 (407)
 97 cd01306 PhnM PhnM is believed   99.5   2E-14 5.1E-19  111.0   7.9   77  325-423   248-325 (325)
 98 pfam07969 Amidohydro_3 Amidohy  99.4 1.6E-13   4E-18  105.3   5.3   40  345-384   351-392 (392)
 99 TIGR02022 hutF formiminoglutam  99.4 3.3E-13 8.5E-18  103.2   4.1   74  350-428   364-443 (466)
100 cd01294 DHOase Dihydroorotase   99.4 1.3E-11 3.3E-16   92.9  11.8  105  297-412   227-333 (335)
101 TIGR01178 ade adenine deaminas  99.1 6.1E-10 1.6E-14   82.1   8.9   71    3-73      1-75  (575)
102 TIGR00221 nagA N-acetylglucosa  99.1   2E-09 5.1E-14   78.8  11.2   71    3-74      4-76  (408)
103 TIGR01224 hutI imidazoloneprop  99.0 5.1E-10 1.3E-14   82.7   6.1   58  332-389   325-385 (409)
104 cd01305 archeal_chlorohydrolas  97.8 1.3E-05 3.4E-10   54.2   2.8   21  346-366   243-263 (263)
105 PRK06886 hypothetical protein;  96.9 0.00011 2.7E-09   48.4  -1.4   21  350-370   308-328 (328)
106 pfam00449 Urease_alpha Urease   96.6  0.0023 5.8E-08   39.8   3.6   33    3-37     67-99  (121)
107 cd01292 metallo-dependent_hydr  96.6  0.0071 1.8E-07   36.6   6.0   22  345-366   254-275 (275)
108 pfam07908 D-aminoacyl_C D-amin  79.8     1.7 4.3E-05   21.3   2.8   15  416-430    20-34  (48)
109 cd01310 TatD_DNAse TatD like p  65.9     5.2 0.00013   18.1   2.5   34  335-368   218-251 (251)
110 pfam01423 LSM LSM domain. The   58.8      11 0.00027   16.1   4.8   32    4-35     34-65  (66)
111 cd01731 archaeal_Sm1 The archa  54.2      13 0.00032   15.7   4.5   33    4-36     36-68  (68)
112 PTZ00240 60S ribosomal protein  53.3      13 0.00034   15.6   3.8   59  365-430   146-209 (323)
113 PRK05451 dihydroorotase; Provi  52.1      14 0.00035   15.4  10.6   55   56-116     5-59  (345)
114 cd01721 Sm_D3 The eukaryotic S  50.4      15 0.00037   15.3   4.5   33    1-34     34-66  (70)
115 TIGR01020 rpsE_arch ribosomal   49.6       4  0.0001   18.9  -0.4   34   24-62     19-54  (220)
116 TIGR02303 HpaG-C-term 4-hydrox  45.0      15 0.00039   15.2   2.0   28  357-385   205-234 (249)
117 TIGR01830 3oxo_ACP_reduc 3-oxo  44.1     7.1 0.00018   17.3   0.2   10   56-65    174-183 (238)
118 PTZ00135 ribosomal phosphoprot  43.5      19 0.00048   14.6   3.4   59  365-430   139-202 (312)
119 PRK06361 hypothetical protein;  42.4      19 0.00049   14.5   3.8   33  337-369   183-215 (216)
120 cd01311 PDC_hydrolase 2-pyrone  40.7      12  0.0003   15.8   0.9   14   60-73      1-14  (263)
121 TIGR01406 dnaQ_proteo DNA poly  40.0      21 0.00054   14.2   3.0   35   11-55      4-41  (246)
122 PRK00737 small nuclear ribonuc  35.7      25 0.00062   13.8   4.3   14   22-35     58-71  (72)
123 COG2131 ComEB Deoxycytidylate   35.2      25 0.00064   13.8   3.2   21   19-39     28-48  (164)
124 TIGR01286 nifK nitrogenase mol  33.8      12 0.00032   15.7   0.1   10   58-67    185-194 (526)
125 TIGR00491 aIF-2 translation in  33.5      18 0.00047   14.6   1.0   47   22-69    487-556 (1145)
126 PRK00912 ribonuclease P protei  32.1      28 0.00071   13.4   3.9   43  336-378   186-231 (237)
127 TIGR00399 metG_C_term methiony  32.1      28 0.00072   13.4   1.8   40  350-389    88-140 (149)
128 COG3618 Predicted metal-depend  30.8      15 0.00039   15.1   0.2   16   57-72      5-20  (279)
129 TIGR03378 glycerol3P_GlpB glyc  30.4      30 0.00076   13.3   5.5   15   55-69     36-50  (419)
130 cd01733 LSm10 The eukaryotic S  29.0      31  0.0008   13.1   4.4   10   23-32     64-73  (78)
131 cd01723 LSm4 The eukaryotic Sm  28.7      32 0.00081   13.1   4.4   34    1-35     35-69  (76)
132 TIGR01901 adhes_NPXG filamento  28.4      31 0.00078   13.2   1.4   18  372-389    57-75  (97)
133 KOG0203 consensus               26.5      26 0.00066   13.7   0.8   17  372-388   734-750 (1019)
134 TIGR00856 pyrC_dimer dihydroor  26.4      35 0.00089   12.8   1.5   67   62-133     8-74  (364)
135 cd00600 Sm_like The eukaryotic  25.4      37 0.00093   12.7   4.2   31    4-34     32-62  (63)
136 TIGR01194 cyc_pep_trnsptr cycl  24.8      37 0.00095   12.6   2.9   52  372-427   316-372 (555)
137 TIGR02903 spore_lon_C ATP-depe  24.1      39 0.00098   12.5   1.3   51  352-411   378-440 (616)
138 pfam02457 DisA_N DisA bacteria  24.1      39 0.00099   12.5   2.4   24   12-36     48-71  (122)
139 KOG2902 consensus               23.6      35  0.0009   12.8   1.0   58   57-119     6-63  (344)
140 TIGR01517 ATPase-IIB_Ca calciu  22.9      41   0.001   12.4   1.7   22   45-66    224-246 (885)
141 COG4464 CapC Capsular polysacc  22.7      41   0.001   12.4   4.1   41   61-101     1-44  (254)
142 PRK03642 hypothetical protein;  22.6      41  0.0011   12.4   2.8   12   23-34     60-71  (432)
143 TIGR00747 fabH 3-oxoacyl-(acyl  21.8      43  0.0011   12.3   1.2   13  371-386   302-314 (329)
144 smart00651 Sm snRNP Sm protein  21.4      44  0.0011   12.2   4.3   32    4-35     34-66  (67)
145 TIGR02428 pcaJ_scoB_fam 3-oxoa  21.3      41   0.001   12.4   0.9   41   19-62     35-79  (208)
146 pfam04457 DUF504 Protein of un  21.3      44  0.0011   12.2   2.1   15  415-429    41-56  (56)
147 COG1240 ChlD Mg-chelatase subu  21.3      44  0.0011   12.2   2.3   21  347-367   151-171 (261)
148 PRK01424 S-adenosylmethionine:  20.9      29 0.00075   13.3   0.1   28  349-385   276-304 (366)
149 TIGR03221 muco_delta muconolac  20.9      45  0.0011   12.1   3.0   42  348-389    12-59  (90)
150 TIGR01978 sufC FeS assembly AT  20.6      45  0.0012   12.1   2.4   33    5-37      2-35  (248)
151 cd00530 PTE Phosphotriesterase  20.4      46  0.0012   12.1   3.7   33  335-367   261-293 (293)
152 PRK09875 putative hydrolase; P  20.4      46  0.0012   12.1   3.8   32  337-368   261-292 (292)
153 COG0809 QueA S-adenosylmethion  20.2      37 0.00094   12.7   0.5   10   19-28     50-59  (348)
154 pfam09987 DUF2226 Uncharacteri  20.1      46  0.0012   12.0   3.6   25   11-35     35-59  (252)

No 1  
>PRK09059 dihydroorotase; Validated
Probab=100.00  E-value=0  Score=387.55  Aligned_cols=428  Identities=45%  Similarity=0.755  Sum_probs=235.3

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899983114378
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNIT   80 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~   80 (431)
                      |++||||||+||||.+.+.+.+||+|+||||++||+++.....|++.++|||+|++|+|||||+|+|++.||..++++++
T Consensus         2 ~~~llikn~~iv~p~~~~~~~~dI~I~dGkI~~ig~~~~~~~~p~~~eiIDa~G~~vlPG~ID~HvH~~~pg~~~~e~~~   81 (429)
T PRK09059          2 MRPILLANARIVDPSRGLDEIGTVLIANGVIRAAGKGAGNQGVPEGAEIVDCAGKAVAPGLVDARVFVGEPGAEHRETIA   81 (429)
T ss_pred             CCCEEEECEEEECCCCCCCCEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
T ss_conf             86868978499899768451447999899999805785545788888689789998948989886256998854434488


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999870787321245455664333166777767766431012232100013443222222210000011222234333
Q gi|254780301|r   81 TLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPM  160 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (431)
                      ++++++..||++....++...+....... ..................................................
T Consensus        82 t~s~AA~~GGvTtv~~mPnt~P~~~~~~~-~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~l~e~~~l~~~g~~~f~~~~~  160 (429)
T PRK09059         82 SASRAAAAGGVTSIIMMPDTDPVIDNVAL-VEFVKRTARDTAIVNIHPAAAITKGLAGEEMTEFGLLRAAGAVAFTDGRR  160 (429)
T ss_pred             HHHHHHHHCCCEEEEECCCCCCCCCCHHH-HHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHCCEEEECCCCC
T ss_conf             89999982890799975799888884999-99999860321553401378852488722345567898669067504863


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             22221101245676542101222233322222221124675310012222100001235555665432000111222333
Q gi|254780301|r  161 SIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS  240 (431)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (431)
                      ..........+.++..........|..............+..................................+..+..
T Consensus       161 ~~~~~~~l~~~~~~~~~~~~~~~~h~Ed~~l~~~~~~~eg~~~~~~~~~~~P~~~E~~av~r~i~la~~~~~~vhi~HiS  240 (429)
T PRK09059        161 SVANAQVMRRALTYARDFDAVIVHETEDPDLGGNGVMNEGLFASWLGLSGIPREAEVIPLERDLRLAALTRGRYHAAQIS  240 (429)
T ss_pred             CCCCHHHHHHHHHHHHHCCCEEEECCCCHHHHHCHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECC
T ss_conf             56899999999999986698479888898888442432542000138999998999999999999999859858986317


Q ss_pred             CHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11211001111001222322222222222322221110000001112222222222222334431111344454543222
Q gi|254780301|r  241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTK  320 (431)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  320 (431)
                      ........................+...................+.......................+...++......
T Consensus       241 s~~~~~~I~~ak~~G~~vt~ev~phhL~l~~~~~~~~~~~~k~~PPLR~~~d~~~L~~~l~~G~Id~i~SDHaP~~~~~K  320 (429)
T PRK09059        241 CAESADALRRAKDRGLKVTAGVSINHLSLNENDIGEYRTFFKLSPPLRTEEDRLAMVEAVASGTIDVIVSDHDPQDVDTK  320 (429)
T ss_pred             CHHHHHHHHHHHHCCCCEEEEEEHHHHCCCHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCHHHC
T ss_conf             26779999999973996899960575228855744236722348999998999999999977997099969999997776


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEEECHHHHHC
Q ss_conf             23433322222221013678886765169899999998815179980999972466872678998698978853778520
Q gi|254780301|r  321 LLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSS  400 (431)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s  400 (431)
                      .........+.......++....++.++++|++++++++|.||||+||+++|+|++|++||||||||+++|+|+.++++|
T Consensus       321 ~~~f~~a~~G~~gve~~lp~~~~~v~~~~isl~~~v~~~s~nPAki~Gl~kG~i~~G~dADlvi~D~~~~~~v~~~~~~s  400 (429)
T PRK09059        321 RLPFAEAAAGAIGLETLLAAALRLYHNGEVPLLRLIEALSTRPAELFGLPAGTLKPGAPADIIVIDLDEPWVVDPEDLKS  400 (429)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCEEECHHHCCC
T ss_conf             59863236785607659999999998599999999999969999996998886179981688999599988988577707


Q ss_pred             CCCCCCCCCEEEEEEEEEEEECCEEEEEE
Q ss_conf             24886567727822889999999999862
Q gi|254780301|r  401 IHKNTVFDKEFFTGKVVRTYISGKQVYTL  429 (431)
Q Consensus       401 ~~~~tp~~g~~~~g~V~~tiv~G~iVy~~  429 (431)
                      +++||||+|++++|+|.+||++|++||+.
T Consensus       401 ~~~~sp~~G~~l~G~v~~ti~rG~~v~e~  429 (429)
T PRK09059        401 RSKNTPFEEARFQGRVVRTIVAGKTVYEA  429 (429)
T ss_pred             CCCCCCCCCCEEEEEEEEEEECCEEEEEC
T ss_conf             58977855978888999999999999879


No 2  
>PRK07627 dihydroorotase; Provisional
Probab=100.00  E-value=0  Score=372.27  Aligned_cols=424  Identities=32%  Similarity=0.511  Sum_probs=220.1

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899983114378
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNIT   80 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~   80 (431)
                      |+ +|||||+||||.++..+.+||+|+||||++||+...   ..++.++|||+|++|+|||||+|+|+..|+.++++++.
T Consensus         1 m~-l~I~nG~vvdp~~~~~~~~dI~I~dGkI~aIg~~~~---~~~a~~~IDA~G~~V~PG~ID~HvH~~~pg~~~~e~~~   76 (425)
T PRK07627          1 MK-IHIKGGRLIDPAAGTDRQADLYIAAGKIAAIGSAPA---GFNADKTIDASGLIVAPGLVDLSARLREPGYEYKATLE   76 (425)
T ss_pred             CC-EEEECEEEECCCCCCEEEEEEEEECCEEEECCCCCC---CCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
T ss_conf             91-999674998998885058799998999988567788---89888489899999978999777556889854101055


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999870787321245455664333166777767766431012232100013443222222210000011222234333
Q gi|254780301|r   81 TLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPM  160 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (431)
                      ++++++..||++....++...+........... ..............................................
T Consensus        77 s~~~AA~~GGvTtv~~~p~t~p~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~l~e~~~l~~~G~~~f~~~~~  155 (425)
T PRK07627         77 SEMAAAVAGGVTSLVCPPDTDPVLDEPGLVEML-KFRARNLNQAHVYPLGALTVGLKGEVLTEMVELTEAGCVGFSQANV  155 (425)
T ss_pred             HHHHHHHHCCEEEEEECCCCCCCCCCHHHHHHH-HHHHHHCCCCCEEEECCEECCCCCCHHHHHHHHHHCCCEEEECCCC
T ss_conf             278999718878998579888888878999999-9999855898799855434588820243078898648647603663


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             22221101245676542101222233322222221124675310012222100001235555665432000111222333
Q gi|254780301|r  161 SIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS  240 (431)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (431)
                      ..........+.++..........|..............+....+.............................+..+..
T Consensus       156 ~~~d~~~l~~~~~~a~~~g~~~~~h~ed~~~~~~~~~~~g~~~~~~gl~~~p~~aE~~ai~~~~~la~~~g~~~hi~His  235 (425)
T PRK07627        156 PVVDTQVLLRALQYASTFGFTVWLRPLDAFLGRGGVAASGAVASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLS  235 (425)
T ss_pred             CCCCHHHHHHHHHHHCCCCCEEEEECCCHHHHCCCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             35799999998876403695799715657886187554664033228988983440345889999998729968997058


Q ss_pred             CHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11211001111001222322222222222322221110000001112222222222222334431111344454543222
Q gi|254780301|r  241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTK  320 (431)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  320 (431)
                      ........................+...................+.......................+...+.......
T Consensus       236 s~~~l~~I~~ak~~G~~vt~Et~ph~L~l~~~~~~~~~~~~k~~PPLR~~~d~eaL~~~l~~G~Id~i~SDH~p~~~~~K  315 (425)
T PRK07627        236 SAAGLALVRAAKAEGLPVTCDVGVNHVHLIDVDIGYFDSQFRLDPPLRSQRDRDAIRAALADGTIDAICSDHTPVDDDEK  315 (425)
T ss_pred             CHHHHHHHHHHHHCCCCEEEEEECCHHCCCHHHHCCCCCCEECCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCHHHC
T ss_conf             79999999989877995799971753027767856567624324887977889999878646987899648888897676


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEEECHHHHHC
Q ss_conf             23433322222221013678886765169899999998815179980999972466872678998698978853778520
Q gi|254780301|r  321 LLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSS  400 (431)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s  400 (431)
                      .........+................++++|++++++.+|.||||+||+++|+|++|++||||||||+++|+|+.++++|
T Consensus       316 ~~~~~~~~~G~~G~e~~lpl~l~~~~~~~lsL~~~v~~~s~nPAk~~Gl~kG~i~~G~dADlvi~Dp~~~~~v~~~~~~s  395 (425)
T PRK07627        316 LLPFAEATPGATGLELLLPLTLKWADEARVPLARALARITSAPARVLGLPAGRLAEGAPADLCVFDPDAHWRVEPRALKS  395 (425)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCEEECHHHCCC
T ss_conf             58703287974807659999999998169899999999979999996999885079996429999489978988366607


Q ss_pred             CCCCCCCCCEEEEEEEEEEEECCEEEEEE
Q ss_conf             24886567727822889999999999862
Q gi|254780301|r  401 IHKNTVFDKEFFTGKVVRTYISGKQVYTL  429 (431)
Q Consensus       401 ~~~~tp~~g~~~~g~V~~tiv~G~iVy~~  429 (431)
                      +++||||+|++++|+|.+||++||+||+|
T Consensus       396 ~~~~sp~eG~~~~G~v~~ti~rG~~v~e~  424 (425)
T PRK07627        396 QGKNTPFLGYELPGRVRATLVAGQVAFER  424 (425)
T ss_pred             CCCCCCCCCCEEEEEEEEEEECCEEEEEC
T ss_conf             68857833978888999999999999968


No 3  
>PRK09357 pyrC dihydroorotase; Validated
Probab=100.00  E-value=0  Score=364.59  Aligned_cols=424  Identities=37%  Similarity=0.615  Sum_probs=198.5

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899983114378
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNIT   80 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~   80 (431)
                      |+ ||||||+|+||.+...+.+||+|+||||++||+++.   .+++.++|||+|++|+|||||+|+|++.|+.++++++.
T Consensus         1 M~-llIkNg~Vvdp~~~~~~~~dI~I~~gkI~~Ig~~i~---~~~~~~vIDA~G~~V~PGfID~H~H~~~pg~~~~~~~~   76 (425)
T PRK09357          1 MM-ILIKNGRVIDPKSGLDQVADILIDDGKIAAIGAAIE---AFEGAEVIDATGLVVAPGLVDLHVHLREPGQEYKETIE   76 (425)
T ss_pred             CC-EEEECEEEECCCCCCEEEEEEEEECCEEEEECCCCC---CCCCCEEEECCCCEECCCEEECCCCCCCCCCCCCHHHH
T ss_conf             92-999780998998885058799998999989468899---88999799899999924989777167889976300366


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999870787321245455664333166777767766431012232100013443222222210000011222234333
Q gi|254780301|r   81 TLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPM  160 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (431)
                      ++++++..+|++....++...+....... ..................................................
T Consensus        77 ~g~~aa~~gGvTtv~~~p~~~p~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~l~~~~~l~~~g~~~~s~~~~  155 (425)
T PRK09357         77 TGTRAAAAGGFTTVVAMPNTNPVIDTPEV-VEYVLDLAKEAGVVDVLPVGAITKGLAGEELTEFGALAEAGVVAFSDDGI  155 (425)
T ss_pred             HHHHHHHHCCEEEEECCCCCCCCCCCHHH-HHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHCCEEEEECCCC
T ss_conf             76899985780589616898777785999-99999864204851146752135776504567777654257479813992


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             22221101245676542101222233322222221124675310012222100001235555665432000111222333
Q gi|254780301|r  161 SIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS  240 (431)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (431)
                      ..........+.++..........|..............+..................................+..+..
T Consensus       156 ~~~~~~~l~~~~~~a~~~~~~~~~h~e~~~l~~~~~~~~g~~~~~~~~~~~p~~~E~~~i~r~~~la~~~g~~~hi~H~s  235 (425)
T PRK09357        156 PVQDARLMRRALEYAKKLDLLIAQHCEDPSLTEGGVMNEGIVAARLGLPGIPEVAEEVAIARDVLLAEETGARYHICHVS  235 (425)
T ss_pred             EECCHHHHHHHHHHHHHCCCEEEECCCCHHHHHCHHHCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             30458999999988864595699742523344220224686312038999976788989999999887619926875146


Q ss_pred             CHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11211001111001222322222222222322221110000001112222222222222334431111344454543222
Q gi|254780301|r  241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTK  320 (431)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  320 (431)
                      ............................................+.......................+...++......
T Consensus       236 s~~~le~i~~ak~~G~~vt~e~~p~~l~~t~~~~~~~~~~~k~~PpLr~~~~~~~l~~~l~~g~i~~i~tDh~P~~~~~k  315 (425)
T PRK09357        236 TAGSVELIRFAKALGIKVTAEVTPHHLLLTDEDLLTYDGNYKVNPPLRSKEDREALIEALKDGTIDAIATDHAPHAEEEK  315 (425)
T ss_pred             CHHHHHHHHHHHHCCCCCEEEECHHHHHCCHHHHHCCCCCEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHH
T ss_conf             16589999999983897523414556528985762368632207986525569999999966988999968888886773


Q ss_pred             CCCCCCCCCCCCCCCHHHHH-HHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEEECHHHHH
Q ss_conf             23433322222221013678-88676516989999999881517998099997246687267899869897885377852
Q gi|254780301|r  321 LLPFAEASFGSIGLETMLSA-ALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMS  399 (431)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~  399 (431)
                      .................+.. ...++.++.+|++++++++|.||||+||+++|+|++|++||||||||+++|+|+.++++
T Consensus       316 ~~~~~~~~~G~~g~e~~~~~~~~~~v~~~~lsle~~v~~~T~nPAk~lGl~~G~i~~G~dADivi~Dp~~~~~v~~~~~~  395 (425)
T PRK09357        316 ECEFEAAPFGITGLETALSLLYTTLVKTGLLDLEQLLEKLSINPARILGLPAGPLAEGEPADLVIFDPEAEWTVDGEDFA  395 (425)
T ss_pred             CCCHHHCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCEEECHHHCC
T ss_conf             44500077898747768999999998759999999999997999999599877648999466899939997898756661


Q ss_pred             CCCCCCCCCCEEEEEEEEEEEECCEEEEEE
Q ss_conf             024886567727822889999999999862
Q gi|254780301|r  400 SIHKNTVFDKEFFTGKVVRTYISGKQVYTL  429 (431)
Q Consensus       400 s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~  429 (431)
                      |+++||||+|++++|+|.+||+||++||+.
T Consensus       396 s~~~~sp~~g~~~~g~v~~ti~~G~~v~~~  425 (425)
T PRK09357        396 SKGKNTPFIGMKLKGKVVYTIVDGKIVYQD  425 (425)
T ss_pred             CCCCCCCCCCCEEEEEEEEEEECCEEEEEC
T ss_conf             768978815978888999999999999979


No 4  
>PRK07575 dihydroorotase; Provisional
Probab=100.00  E-value=0  Score=357.75  Aligned_cols=420  Identities=22%  Similarity=0.285  Sum_probs=214.8

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899983114378
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNIT   80 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~   80 (431)
                      |++||||||+|+||++.+. .+||+|+||||++|++++.   .+++.++|||+|++|+|||||+|+|++.||.++++++.
T Consensus         1 M~~llIkn~~vv~p~g~~~-~~DI~I~dGkI~~I~~~~~---~~~~~~vIDa~G~~vlPG~ID~HvH~~~pg~~~ked~~   76 (439)
T PRK07575          1 MSSLLIRNARILLPSGELL-LGDVLIRDGKIVAIAPEIS---ATAVDTVIDAEGLTLLPGVIDPQVHFREPGLEHKEDLF   76 (439)
T ss_pred             CCCEEEECEEEECCCCCEE-EEEEEEECCEEEEECCCCC---CCCCCEEEECCCCEEECCEEECCCCCCCCCCCCHHHHH
T ss_conf             9628996949999999988-7149998999998068899---88888699899999955889765255899875220476


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999870787321245455664333166777767766431012232100013443222222210000011222234333
Q gi|254780301|r   81 TLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPM  160 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (431)
                      ++++++..||++....++...+.............. .......................................... 
T Consensus        77 tgs~AAa~GGvTtv~~mpnt~P~~~~~~~~~~~~~~-~~~~~~v~~~~~~g~~~~~~~el~~~~~~~g~k~f~~~~~~~-  154 (439)
T PRK07575         77 TASRACAKGGVTSFLEMPNTKPLTTTQAALDDKLAR-AAEKCLVNYGFFIGATPDNLPDLLTANPTCGIKIFMGSSHGP-  154 (439)
T ss_pred             HHHHHHHHCCEEEEEECCCCCCCCCCHHHHHHHHHH-HHHCCEECCCEEEECCCCCHHHHHHHCCCCCEEEEECCCCCC-
T ss_conf             658999849878999657888775548999999998-601672334235411585689999742237467861257786-


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             2222110124567654210122223332222222-112467531001222210000123555566543200011122233
Q gi|254780301|r  161 SIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSR-GVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI  239 (431)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  239 (431)
                        ......................|......... .....+..................................+..+.
T Consensus       155 --~~~~~~~~l~~i~~~~~~~i~~H~Ed~~~i~~~~~~~~g~~~~~~~~~~~~~~~e~~ai~~~~~la~~~~~~~hi~hi  232 (439)
T PRK07575        155 --LLVDDEAALERIFAEGRRLIAVHAEDQARIRARRELFAGITDPAIHSQIQDEEAALLATRLALKLSKKYQRRLHILHL  232 (439)
T ss_pred             --EECCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEEC
T ss_conf             --203659999999974797189834665799977887479888567055588999999999999999984981899951


Q ss_pred             CCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             31121100111100122232222222222232222111000000111222222222222233443111134445454322
Q gi|254780301|r  240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDT  319 (431)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  319 (431)
                      ..............  .........+...................+.......................+...++.....
T Consensus       233 Ss~~s~~~i~~ak~--~~Vt~ev~phhL~l~~~~~~~~~~~~k~~PPLRs~~d~~aL~~~l~~G~Id~i~sDH~P~~~~~  310 (439)
T PRK07575        233 STGDEAELLRQDKP--AWVTAEVTPQHLLLNTDAYAKIGSLAQMNPPLRSPEDNEVLWQALLDGVIDFIATDHAPHTLEE  310 (439)
T ss_pred             CCHHHHHHHHHHCC--CCCEEEECHHHHHCCHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHH
T ss_conf             74899999876435--8811123210210686574446845998899999799999998860897689994999889788


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC-CCEECCCCCCCEEEECCCCCEEECHHHH
Q ss_conf             223433322222221013678886765169899999998815179980999-9724668726789986989788537785
Q gi|254780301|r  320 KLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP-GGTLQTGTAADIALIDLNYQWTVKADDM  398 (431)
Q Consensus       320 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~-~G~I~~Gk~ADlvi~D~~~~~~i~~~~~  398 (431)
                      ..........+........+.......++++|++++++++|.||||+||+. +|+|++|++||||||||+.+|+|+.+++
T Consensus       311 K~~~~~~a~~G~~g~e~~lpl~~~~~~~~~i~l~~~v~~~s~nPAkilgl~~kG~i~~G~dADlvl~D~~~~~~v~~~~~  390 (439)
T PRK07575        311 KAQPYPNSPSGMPGVETSLPLMLTAAMAGKCTVAQVVRWMSTAVARAYGIPNKGRIAPGYDADLVLVDLNTYRPVRREEL  390 (439)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHCHHHHHCCCCCCCCCCCCCCCEEEECCCCCEEECHHHC
T ss_conf             24798767767321888999999999828802999999972354986497988867789846889983999889875775


Q ss_pred             HCCCCCCCCCCEEEEEEEEEEEECCEEEEEEC
Q ss_conf             20248865677278228899999999998624
Q gi|254780301|r  399 SSIHKNTVFDKEFFTGKVVRTYISGKQVYTLE  430 (431)
Q Consensus       399 ~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~e  430 (431)
                      +|+++||||+|++++|+|.+||++|++||+..
T Consensus       391 ~sk~~~sp~~g~~~~G~v~~ti~~G~~v~~~g  422 (439)
T PRK07575        391 LTKCGWSPFEGWNLTGWPVTTIVGGQIVFDRG  422 (439)
T ss_pred             CCCCCCCCCCCCEEEEEEEEEEECCEEEEECC
T ss_conf             46688578579788878999999999999999


No 5  
>PRK09236 dihydroorotase; Reviewed
Probab=100.00  E-value=0  Score=354.52  Aligned_cols=423  Identities=22%  Similarity=0.285  Sum_probs=201.9

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899983114378
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNIT   80 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~   80 (431)
                      |+|||||||+|||+.+.  ..+||+|+||||++|++++.   .+++.+||||+|++|+|||||+|+|+..|+.++++++.
T Consensus         1 M~dllIkn~~vv~~~~~--~~adI~I~dGkI~~I~~~i~---~~~a~~vIDA~G~~v~PG~ID~H~H~~epg~~~ke~~~   75 (444)
T PRK09236          1 MKSLLIKNARIVNEGRI--FDGDVLIEGGRIAKIAGSIP---AKSADEVIDAAGRYLLPGMIDDQVHFREPGLTHKGDIA   75 (444)
T ss_pred             CCCEEEECEEEECCCCC--EEEEEEEECCEEEEECCCCC---CCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
T ss_conf             97579969599999986--78239998999998057789---99988799899999936889722254899975435266


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999870787321245455664333166777767766431012232100013443222222210000011222234333
Q gi|254780301|r   81 TLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPM  160 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (431)
                      ++++++..||++....++...+............ .........+.... ..............................
T Consensus        76 s~s~aA~~GGvTtv~~mp~t~p~~~~~~~l~~~~-~~a~~~~~~~~~~~-~g~~~~~~~~i~~l~~~~~~g~k~f~g~s~  153 (444)
T PRK09236         76 SESRAAVAGGITSFMDMPNTNPPTTTLEALEAKY-DIAAGRSWANYSFY-FGATNDNLDEIKALDPKRVCGVKVFMGAST  153 (444)
T ss_pred             HHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHH-HHHCCCCEEEEEEE-ECCCCCCHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             7789998489139973588899867899999999-98534870459976-065588699998655534866999932678


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCC-CHHHHHHHHHHHHHHCCCCCC
Q ss_conf             22221101245676542101222233322222221----1246753100122221000-012355556654320001112
Q gi|254780301|r  161 SIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRG----VINEGIIANYLGLVGIPSI-SETVPLARDLLIAQHTGGHYH  235 (431)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~  235 (431)
                      ............+...........|..........    ....+.............. ....................+
T Consensus       154 g~~~~~~~~~l~~~~~~~~~~~~~H~e~~~~i~~~~~~~~~~~g~~~~~~~h~~~r~~~a~~~~~~~ai~la~~~g~~lh  233 (444)
T PRK09236        154 GNMLVDNPETLERIFRDSPTLIATHCEDTPTIKANEAKYREKYGEDLPAELHPLIRSREACYKSSSLAVSLAKKHGTRLH  233 (444)
T ss_pred             CCCCCCCHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             87404649999999975898699946885899988999998728888832255547677899999999999986099789


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22333112110011110012223222222222223222211100000011122222222222223344311113444545
Q gi|254780301|r  236 ASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPR  315 (431)
Q Consensus       236 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  315 (431)
                      ..+..........................+...................+.......................+...++.
T Consensus       234 i~Hist~~~l~li~~a~~~g~~it~e~~~h~L~~~~~~~~~~~~~~k~~Pplr~~~d~~aL~~al~~g~id~I~sDHaP~  313 (444)
T PRK09236        234 VLHLSTAKELSLFENGPLEEKRITAEVCVHHLWFDDSDYARLGNLIKCNPAIKTASDREALRQALANGRIDVIATDHAPH  313 (444)
T ss_pred             EEECCCHHHHHHHHHHHHHCCCCCCEECCCEECCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCC
T ss_conf             99568589999999989818987403011110468778864497101368758567799999997479679997688776


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC-CCEECCCCCCCEEEECCCCCEEEC
Q ss_conf             4322223433322222221013678886765169899999998815179980999-972466872678998698978853
Q gi|254780301|r  316 HMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP-GGTLQTGTAADIALIDLNYQWTVK  394 (431)
Q Consensus       316 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~-~G~I~~Gk~ADlvi~D~~~~~~i~  394 (431)
                      ..............+.......++....++.+++||++++++++|.|||++|||+ +|+|++|++||||||||+.+|+|+
T Consensus       314 ~~~~K~~~~~~a~~G~~gle~~lp~~l~~v~~g~lsl~~~v~~~s~nPA~i~GL~~kG~I~~G~dADlvl~Dp~~~~~v~  393 (444)
T PRK09236        314 TWEEKQGPYFQAPSGLPLVQHALVALLELVHEGKLSLEQVVEKTAHAPAELFAIEDRGFIREGYWADLVLVDPNSPWTVT  393 (444)
T ss_pred             CHHHCCCCHHHCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCCEEEC
T ss_conf             77672488401999841699999999999980874699999998576999849898886689984538999199978988


Q ss_pred             HHHHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEEC
Q ss_conf             778520248865677278228899999999998624
Q gi|254780301|r  395 ADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLE  430 (431)
Q Consensus       395 ~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~e  430 (431)
                      +++++|+++||||+|++++|+|.+||++|++||+..
T Consensus       394 ~~~~~s~~~~sp~~G~~~~G~v~~t~~~G~~v~~~g  429 (444)
T PRK09236        394 RENILSKCGWSPFEGTTFRSRVATTFVNGQLVWHGG  429 (444)
T ss_pred             HHHCCCCCCCCCCCCCEEEEEEEEEEECCEEEEECC
T ss_conf             243736688788479788779999999999999999


No 6  
>PRK02382 dihydroorotase; Provisional
Probab=100.00  E-value=0  Score=354.07  Aligned_cols=414  Identities=25%  Similarity=0.308  Sum_probs=208.0

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899983114378
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNIT   80 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~   80 (431)
                      |+|+|||||+|+++++  ...+||+|+||||++||+++.    +++.+||||+|++|+|||||+|+|+..+|.++++++.
T Consensus         1 M~DllIkng~vv~~~~--~~~~DI~I~dGkI~~Ig~~~~----~~~~~vIDa~G~~v~PG~ID~HvH~~~pg~~~~ed~~   74 (440)
T PRK02382          1 MRDALLKDGRVYYNNS--LQPRDIRIDGGKITAIGKDLD----SSDEEVIDARGALTLPGGIDVHVHFREPGMEHKETWY   74 (440)
T ss_pred             CCCEEEECCEEECCCC--CEEEEEEEECCEEEEECCCCC----CCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
T ss_conf             9858997909985998--288649998999988468899----9998699899999968999745066989865435565


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCC--CC
Q ss_conf             8999987078732124545566433316677776776643101223210001344322222221000001122223--43
Q gi|254780301|r   81 TLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFI--QS  158 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~  158 (431)
                      ++++++..||++....++...+............ .............................  ..........  ..
T Consensus        75 tgs~aAa~GGvTTvv~~p~t~p~~~~~~~~~~~~-~~~~~~~~vd~~~~~~~t~~~~~~~l~~~--g~~~~~~~~~~~~~  151 (440)
T PRK02382         75 TGSCSAAAGGVTTVVDQPNTDPPTTDAESFKEKL-ALAARKSIVDFGINGGVTGNWELEELWRL--GLFAFGEIFMAEST  151 (440)
T ss_pred             HHHHHHHHCCCEEEECCCCCCCCCCCHHHHHHHH-HHHCCCCEEEEEEEEEECCCCCHHHHHHC--CCCCEEEEEEECCC
T ss_conf             6689998299259935778899947799999999-98566865689888763599788999756--77723169997389


Q ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             3322221101245676542101222233322222221-124675310012222100001235555665432000111222
Q gi|254780301|r  159 PMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRG-VINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS  237 (431)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  237 (431)
                      ............+.+...........|.......... ....+..................................+..
T Consensus       152 ~~~~~~~~~l~~~l~~~~~~~~~v~~H~Ed~~~~~~~~~~~~~~~~~~~~~~~rp~~~E~~av~r~i~la~~~g~~vhi~  231 (440)
T PRK02382        152 GGMGIDEELFAEALKEITRLDALATIHAEDEDMRLELEKLLKGDDSADAHSAYRPNAAEISAVERALEVARELGARIHIC  231 (440)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             87472999999999999865986999338878999867875688686770366988999999999999887539935877


Q ss_pred             CCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             33311211001111001222322222222222322221110000001112222222222222334431111344454543
Q gi|254780301|r  238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHM  317 (431)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (431)
                      +..............     .......+...................+.......................+...++...
T Consensus       232 H~st~~~v~~ir~a~-----vt~ev~ph~L~l~~~~~~~~~~~~k~~PPlR~~~d~~aL~~~l~~G~id~iasDhaP~~~  306 (440)
T PRK02382        232 HISTPEGVDLIREPG-----VTCEVTPHHLFLSRRDWDRLGTFGKMNPPLRSEHRRKALWNRLNDGTIDMVASDHAPHTE  306 (440)
T ss_pred             ECCCHHHHHHHHCCE-----EEEEECCCHHHCCHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCH
T ss_conf             548689996543554-----899972135548716666507630137888868899999998755992188438888786


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC-CCEECCCCCCCEEEECCCCCEEECHH
Q ss_conf             22223433322222221013678886765169899999998815179980999-97246687267899869897885377
Q gi|254780301|r  318 DTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP-GGTLQTGTAADIALIDLNYQWTVKAD  396 (431)
Q Consensus       318 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~-~G~I~~Gk~ADlvi~D~~~~~~i~~~  396 (431)
                      ....................++.....+.+++||++++++++|.||||+||++ +|+|++|++||||||||++.|+|+.+
T Consensus       307 ~~K~~~~~~a~~G~~g~et~lp~~~~~v~~~~lsle~~v~~~s~nPAki~Gl~~KG~I~~G~dADlvi~Dp~~~~~v~~~  386 (440)
T PRK02382        307 AEKDADIWDAPSGVPGVETMLPLMLAAVRKNELPLERVIDVTSANPADIFGLDGKGHIAAGYDADLVIVDPDDARPIKGD  386 (440)
T ss_pred             HHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCEEECHH
T ss_conf             77367802166898639999999999887289689999999988899985989885007999777899949998898868


Q ss_pred             HHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEE
Q ss_conf             852024886567727822889999999999862
Q gi|254780301|r  397 DMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTL  429 (431)
Q Consensus       397 ~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~  429 (431)
                      +++|+++||||+|++++ ++.+||++|++||+.
T Consensus       387 ~~~s~~~~sp~~G~~~~-~~~~ti~rG~~v~~~  418 (440)
T PRK02382        387 MLHSKAGWTPFEGMDAV-FPEMTLVRGTVVWDG  418 (440)
T ss_pred             HCCCCCCCCCCCCCEEE-EEEEEEECCEEEEEC
T ss_conf             85442798883795830-279999899999999


No 7  
>PRK07369 dihydroorotase; Provisional
Probab=100.00  E-value=0  Score=354.20  Aligned_cols=418  Identities=30%  Similarity=0.441  Sum_probs=235.0

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899983114378
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNIT   80 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~   80 (431)
                      |+++|||||||+||.++..+.+||+|+||||++|++++.  ..+++.++|||+|++|+||+||.|+|++.||.+++|++.
T Consensus         1 M~~~likn~rvv~p~~~~~~~aDI~I~dGkI~~i~~~~~--~~~~~~~vIDa~G~~vlPG~ID~HvH~~~pg~~~ked~~   78 (419)
T PRK07369          1 MSNVLLRQVRVLDPVSQTDRIADVLIEDGRIQAIEPHLA--PIPPDTQIIDASGLILGPGLVDLYSHSGEPGFEERETLA   78 (419)
T ss_pred             CCCEEEECEEEECCCCCCCCEEEEEEECCEEEEECCCCC--CCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCHHH
T ss_conf             975788580998998787626689998999999567877--899998799789998979999787457999864304298


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999870787321245455664333166777767766431012232100013443222222210000011222234333
Q gi|254780301|r   81 TLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPM  160 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (431)
                      ++++++..||++....++...+...................................................... ...
T Consensus        79 tgt~AAa~GGvTtv~~mPnt~p~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~l~el~~l~~~Gv~~f~-~~~  157 (419)
T PRK07369         79 SLAAAAAAGGFTRVAILPDTSPPLDNPATLARLQQQLQGPSPPPQLLFWGALTLGGQGKQLTELAELAAAGVVGFT-DGQ  157 (419)
T ss_pred             HHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEEEEEECCCCHHHHHHHHHHHHCCCEEEC-CCC
T ss_conf             8999998189769998989999988599999999996006997399997124538624567766667607968904-896


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             22221101245676542101222233322222221124675310012222100001235555665432000111222333
Q gi|254780301|r  161 SIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS  240 (431)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (431)
                      ..........+.++..........|..............+..................................+..+..
T Consensus       158 ~~~~~~~l~~~l~~~~~~~~~v~~h~ed~~l~~~~~~~~g~~~~~~~~~~rP~~~E~~av~r~i~lA~~~g~~lhi~HvS  237 (419)
T PRK07369        158 PLENLALLRRLLEYLAPLGKPVALWPCDRQLAGNGVMREGPDALRLGLPGIPASAETAALAALLELVAAIGTPVHLMRVS  237 (419)
T ss_pred             CCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHCHHHHCCCCCHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             54899999999999986399189950689887272654486402028998844554699999999988753848996168


Q ss_pred             CHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11211001111001222322222222222322221110000001112222222222222334431111344454543222
Q gi|254780301|r  241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTK  320 (431)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  320 (431)
                      ...+....................+...................+.......................+...++......
T Consensus       238 s~~~~e~i~~ak~~G~~vt~Et~phhL~l~~~~~~~~~~~~k~~PPLR~~~d~~aLw~al~~G~Id~i~SDHaP~~~~eK  317 (419)
T PRK07369        238 TARSVELIAQAKARGLPITASTTWMHLLLNTEALASYDPNLRLDPPLGNPSDRQALIEGIRTGIIDAIAIDHTPYTYEEK  317 (419)
T ss_pred             CHHHHHHHHHHHHCCCCEEECCCHHHHHCCHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCHHHC
T ss_conf             58999999988863980896462575547897872757757985899898899999878736976799828889998884


Q ss_pred             CCCCCCCCCCCCCCCHHHHHH-HHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEEECHHHHH
Q ss_conf             234333222222210136788-8676516989999999881517998099997246687267899869897885377852
Q gi|254780301|r  321 LLPFAEASFGSIGLETMLSAA-LRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMS  399 (431)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~~~-~~~~~~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~  399 (431)
                      .........+.......+... ..++.++.||+.+++++++.||||+||+..|+|++|++||||||||+++|+|+.++++
T Consensus       318 ~~~f~~ap~G~~Gve~~lpll~~~~V~~g~lsl~~~v~~~s~nPAki~gl~~g~I~~G~dADlvi~Dp~~~~~v~~~~~~  397 (419)
T PRK07369        318 TVAFAEAPPGAIGLELALPLLWQNLVETGELSALQLWQALSTNPARCLGLEPPSLEPGHPAELILFDPQKTWTVSAQTLH  397 (419)
T ss_pred             CCCHHHCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCEEECHHHCC
T ss_conf             48853489983438879999999998749989999999977789998399999727999777899929998898824360


Q ss_pred             CCCCCCCCCCEEEEEEEEEEEE
Q ss_conf             0248865677278228899999
Q gi|254780301|r  400 SIHKNTVFDKEFFTGKVVRTYI  421 (431)
Q Consensus       400 s~~~~tp~~g~~~~g~V~~tiv  421 (431)
                      |+++||||+|++++|+|.+|||
T Consensus       398 s~~~~sPfeG~~l~G~V~~T~v  419 (419)
T PRK07369        398 SRSRNTPWLGQTLTGRVLQTWV  419 (419)
T ss_pred             CCCCCCCCCCCEEEEEEEEEEC
T ss_conf             7689888579788779999889


No 8  
>PRK08044 allantoinase; Provisional
Probab=100.00  E-value=0  Score=351.84  Aligned_cols=422  Identities=24%  Similarity=0.358  Sum_probs=217.6

Q ss_pred             CC-CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCH
Q ss_conf             96-26996429999888850001089979999983178655666788779988798895172714114789998311437
Q gi|254780301|r    1 MT-SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNI   79 (431)
Q Consensus         1 M~-~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~   79 (431)
                      |+ |||||||+|+++++.  ..+||+|+||||++||++.     +++.++|||+|++|+|||||.|+|++.|+.++++++
T Consensus         1 m~~DllIkng~Vv~~~~~--~~~DI~I~dGkI~~I~~~~-----~~~~~vIDa~G~~v~PG~ID~HvH~~~pg~~~~e~~   73 (449)
T PRK08044          1 MSFDLIIKNGTVILENEA--RVVDIAVKGGKIAAIGQDL-----GDAKNVMDATGLVVSPGMVDAHTHISEPGRSHWEGY   73 (449)
T ss_pred             CCCCEEEECCEEECCCCC--EEEEEEEECCEEEECCCCC-----CCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCHH
T ss_conf             976689989799849983--8976999899999806888-----988859989999896788977505699986431048


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCC--
Q ss_conf             889999870787321245455664333166777767766431012232100013443222222210000011222234--
Q gi|254780301|r   80 TTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQ--  157 (431)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--  157 (431)
                      .++++++..||++....++..................................... .....................  
T Consensus        74 ~t~s~AA~~GGvTtv~~mP~n~~p~~~~~~~~~~~~~~~~~~~~vd~~~~~g~~~~-~~~~i~~l~~~g~~~~k~f~~~~  152 (449)
T PRK08044         74 ETGTRAAAKGGITTMIEMPLNQLPATVDRESIELKFDAAKGKLTIDAAQLGGLVSY-NLDRLHELDEVGVVGFKCFVATC  152 (449)
T ss_pred             HHHHHHHHHCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCC-CHHHHHHHHHCCCCEEEEEEECC
T ss_conf             88889997468557997878999875529999999998636754328998120478-77889988762665256763035


Q ss_pred             ------CCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             ------333222211012456765421012222333222222---21124675310012222100001235555665432
Q gi|254780301|r  158 ------SPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGS---RGVINEGIIANYLGLVGIPSISETVPLARDLLIAQ  228 (431)
Q Consensus       158 ------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  228 (431)
                            ...............+...........|........   ......+............................
T Consensus       153 g~~~i~~~~~~~~d~~l~~~~~~~~~~g~~v~~H~E~~~i~~~~~~~~~~~g~~~~~~~~~~rP~~aE~~av~r~~~la~  232 (449)
T PRK08044        153 GDRGIDNDFRDVNDWQFYKGAQKLGELGQPVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAK  232 (449)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCHHHCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             76322477666798999999999985399699979987999999999987699653344477988999999999999888


Q ss_pred             HCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             00011122233311211001111001222322222222222322221110000001112222222222222334431111
Q gi|254780301|r  229 HTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII  308 (431)
Q Consensus       229 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  308 (431)
                      ......+..+..........................+...................+.......................
T Consensus       233 ~~g~~~hi~HiSs~~~~~~I~~ak~~G~~vt~Ev~ph~L~l~~~~~~~~~~~~k~~PPLR~~~d~~aL~~al~~G~Id~i  312 (449)
T PRK08044        233 VAGCRLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIRDQENQKGMWEKLFNGEIDCL  312 (449)
T ss_pred             HCCCCEEECCCCCHHHHHHHHHHHHCCCCCCEEECHHHHCCCHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHCCCCEEE
T ss_conf             71983884453547789999999976998401203555618998984269548888999997899999999857995099


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH-HHHHCCCCCHHHHHHHHHHHHHHHCCC-CCCEECCCCCCCEEEEC
Q ss_conf             3444545432222343332222222101367888-676516989999999881517998099-99724668726789986
Q gi|254780301|r  309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRPAQIFNL-PGGTLQTGTAADIALID  386 (431)
Q Consensus       309 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~gls~~eal~~aT~npA~~lgl-~~G~I~~Gk~ADlvi~D  386 (431)
                      +...++...............+.......+.... .++.++++|++++++++|.||||+||+ ++|+|++|++|||||||
T Consensus       313 ~SDHaP~~~~~K~~~~~~a~~Gi~g~et~l~ll~~~~v~~~~lsl~~~v~~~s~nPAki~gl~~KG~I~~G~dADlvi~D  392 (449)
T PRK08044        313 VSDHSPCPPEMKAGNIMEAWGGIAGLQNCMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLQQKGRIAPGKDADFVFIQ  392 (449)
T ss_pred             EECCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEE
T ss_conf             85999999789188766488986515447999999999749989999999981639998598988841799966689995


Q ss_pred             CCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEEC
Q ss_conf             98978853778520248865677278228899999999998624
Q gi|254780301|r  387 LNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLE  430 (431)
Q Consensus       387 ~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~e  430 (431)
                      |+++|+|+.++++|+++||||+|++++|+|.+||++|++||+.+
T Consensus       393 ~~~~~~v~~~~~~s~~~~sp~~G~~~~G~v~~Ti~rG~~v~~~~  436 (449)
T PRK08044        393 PNSSYVLKNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIE  436 (449)
T ss_pred             CCCCEEECHHHCCCCCCCCCCCCCEEEEEEEEEEECCEEEEECC
T ss_conf             89978988787727588678469888889999999999999999


No 9  
>PRK06189 allantoinase; Provisional
Probab=100.00  E-value=0  Score=350.25  Aligned_cols=421  Identities=27%  Similarity=0.371  Sum_probs=197.9

Q ss_pred             CC-CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCH
Q ss_conf             96-26996429999888850001089979999983178655666788779988798895172714114789998311437
Q gi|254780301|r    1 MT-SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNI   79 (431)
Q Consensus         1 M~-~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~   79 (431)
                      |+ |||||||+|+||++.  ..+||+|+||||++||+++.    .++.++|||+|++|+|||||+|+|+..++...++++
T Consensus         1 M~~DllIkng~Vvd~~g~--~~aDV~I~dGrI~~Ig~~i~----~~a~~~IDa~G~~V~PG~ID~H~H~~~pg~~~~e~~   74 (433)
T PRK06189          1 MAYDLIIRGAKLVTEGGT--ERADLAVVNGIIAEITPEIS----SDAGEAIDADGLHVFPGAVDCHVHFNEPGRTEWEGF   74 (433)
T ss_pred             CCCCEEEECCEEECCCCC--EEEEEEEECCEEEEECCCCC----CCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCH
T ss_conf             975599979599889986--88639998999999368889----999848989999996688971427799984320207


Q ss_pred             HHHHHHHHCCCCCCCCCCCC-CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCC---CCCCCCCCCC
Q ss_conf             88999987078732124545-5664333166777767766431012232100013443222222210---0000112222
Q gi|254780301|r   80 TTLSKEAVAGGITSIILMPL-GMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMR---LLQEQGIVSF  155 (431)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~  155 (431)
                      .++++++..||++....++. ..+..... ........................... .........   ..........
T Consensus        75 ~tg~~aa~~GGvTt~~~~p~~~~p~~~~~-~~~~~~~~~~~~~~~~d~~~~~~~~~~-~~~~l~~l~~~g~~g~k~~~~~  152 (433)
T PRK06189         75 ETGSQALAAGGCTTYFDMPLNSIPPTLTR-EELEAKAQLAEEKSLVDFALWGGLVPG-NIDHLRDLAEAGAIGFKAFMSH  152 (433)
T ss_pred             HHHHHHHHCCCEEEEECCCCCCCCCCCHH-HHHHHHHHHHHCCCCCCEEEEECCCCC-HHHHHHHHHHCCCEEEEEEEEC
T ss_conf             77899998088078613656789984479-999999997550176322457414332-4555455453375389998621


Q ss_pred             C-CCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             3-4333222211012456765421012222333222222---21124675310012222100001235555665432000
Q gi|254780301|r  156 I-QSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGS---RGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTG  231 (431)
Q Consensus       156 ~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  231 (431)
                      . ............................|........   ......+...............................
T Consensus       153 ~~~~~~~~~~~~~l~~~~~~~~~~g~~v~~h~e~~~~~~~l~~~~~~~g~~~~~~~~~~rp~~ae~~av~~~~~la~~~g  232 (433)
T PRK06189        153 SGTDEFQSADDRTLLKGMKEIAALGLILALHAESDAITRALTTIAREEGKLGVRDYLESRPEVAELEAVQRALLFAQLTG  232 (433)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             45775556898999999999985599899947987999999999997489775554475887899999999999999749


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11122233311211001111001222322222222222322221110000001112222222222222334431111344
Q gi|254780301|r  232 GHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSD  311 (431)
Q Consensus       232 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  311 (431)
                      ...+..+..........................+...................+.......................+..
T Consensus       233 ~~lhi~h~st~~~~~~i~~ak~~G~~vt~e~~p~~l~~~~~~~~~~~~~~k~~PpLr~~~~~~~L~~~l~~g~id~i~sD  312 (433)
T PRK06189        233 CPLHLVHVSTGKAVKLIKEAKQEGVDVSVETCPHYLLFSGEDFERIGAVAKCAPPLRDRQEVEELWDGLMAGHIDTVSSD  312 (433)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCCEEECHHHHHCCHHHHHHCCCCEEECCCCCCHHHHHHHHHHHHCCCEEEEECC
T ss_conf             74784113637788999999974997623663102516887886169623877888997899999987616964699738


Q ss_pred             CCCCCCCCCC-CCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCC-CCCEECCCCCCCEEEECCCC
Q ss_conf             4545432222-343332222222101367888676516989999999881517998099-99724668726789986989
Q gi|254780301|r  312 HTPRHMDTKL-LPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNL-PGGTLQTGTAADIALIDLNY  389 (431)
Q Consensus       312 ~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl-~~G~I~~Gk~ADlvi~D~~~  389 (431)
                      .+........ .........................+.++|++++++++|.||||+||+ ++|+|++|++||||||||++
T Consensus       313 h~p~~~~~k~~~~~~~~~~G~~g~e~~l~~l~~~~~~~~l~l~~~v~~~s~nPA~~~gL~~kG~i~~G~dADlvi~Dp~~  392 (433)
T PRK06189        313 HSPSLPDLKTEDDFFEVWGGISGGQSTLLVMLTEGHERGLPLEQIARLLATAPAKRFGLPQKGRLEVGADADFVLVDLNE  392 (433)
T ss_pred             CCCCCHHHHCCCCHHHCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCC
T ss_conf             99999778447775542477763566899999999866999999999997889998298988872799966389994999


Q ss_pred             CEEECHHHHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEE
Q ss_conf             7885377852024886567727822889999999999862
Q gi|254780301|r  390 QWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTL  429 (431)
Q Consensus       390 ~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~  429 (431)
                      +|+|+.++++|+++||||+|++++|+|.+||++||+||+.
T Consensus       393 ~~~v~~~~~~s~~~~sp~~G~~~~G~v~~t~~~G~~v~~~  432 (433)
T PRK06189        393 PYTLTAEDLYYRHKQSPYEGQTFRGRVKATYLRGQCVYQD  432 (433)
T ss_pred             CEEECHHHCCCCCCCCCCCCCEEEEEEEEEEECCEEEEEC
T ss_conf             8898746664668867857988878999999999999858


No 10 
>PRK13404 dihydropyrimidinase; Provisional
Probab=100.00  E-value=0  Score=349.36  Aligned_cols=422  Identities=19%  Similarity=0.244  Sum_probs=207.0

Q ss_pred             CC-CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC---CCCCC
Q ss_conf             96-269964299998888500010899799999831786556667887799887988951727141147899---98311
Q gi|254780301|r    1 MT-SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS---PDEYS   76 (431)
Q Consensus         1 M~-~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~---~~~~~   76 (431)
                      |+ |+|||||+|+|+.+.+  .+||+|+||||++||++.     ++++++|||+|++|+|||||+|+|++.|   |.+++
T Consensus         2 m~yDLlIkng~Vv~p~~~~--~~DI~I~dGkI~~Ig~~~-----~~~~~vIDA~G~~V~PG~ID~HvH~~~p~~~G~~~~   74 (476)
T PRK13404          2 MAFDTVIRGGTVVTATDTF--QADIGIRGGRIAALGEGL-----GGAAREIDATGRLVLPGGVDSHCHIDQPSSDGIMMA   74 (476)
T ss_pred             CCCCEEEECCEEECCCCCE--EEEEEEECCEEEEECCCC-----CCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCC
T ss_conf             8678899898998899858--975999899998806899-----999808989999890788872357798766884522


Q ss_pred             CCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCC---CCCCCCCCCCCCCC
Q ss_conf             437889999870787321245455664333166777767766431012232100013443222---22221000001122
Q gi|254780301|r   77 KNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGK---EISEMRLLQEQGIV  153 (431)
Q Consensus        77 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~  153 (431)
                      +++.++++++..||++....+....+........... ..........+..............   ..............
T Consensus        75 ed~~tgs~aAa~GGvTtvv~~~~~~~~~~~~~~~~~~-~~~a~~~~~vd~~~~~~~~~~~~~~~~~~l~~l~~~G~~~~k  153 (476)
T PRK13404         75 DDFESGTVSAAFGGTTTVIPFAAQHRGQSLRAAVEDY-HARAAGNAVIDYAFHLIVADPTPEVLEEELPALIARGYTSFK  153 (476)
T ss_pred             CHHHHHHHHHHHCCEEEEECCCCCCCCCCHHHHHHHH-HHHHCCCCEEEEEEEEEEECCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             3099999999858814997168899998769999999-998436855876457787348744689999999977966699


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             2234333222211012456765421012222333222222---2112467531001222210000123555566543200
Q gi|254780301|r  154 SFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGS---RGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT  230 (431)
Q Consensus       154 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  230 (431)
                      .................+.+...........|........   ......+..............................
T Consensus       154 ~~~~~~~~~~~d~~l~~~~~~a~~~g~~v~~HaE~~~~~~~~~~~~~~~G~~~~~~~~~~rP~~~E~~ai~r~~~la~~t  233 (476)
T PRK13404        154 VFMTYDLLKLGDREILDVLTVARRHGAMVMVHAENNDCIAWLTKRLLAAGLTAPKYHAISRPMLAEREATHRAISLAELV  233 (476)
T ss_pred             EEECCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             98548996338299999999998639879994488789999999998668975101545588999999999999999985


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             0111222333112110011110012223222222222223222211---1000000111222222222222233443111
Q gi|254780301|r  231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEM---YNSLRKVLPPLRSETERMSMVEALEKGDIDI  307 (431)
Q Consensus       231 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  307 (431)
                      ....+..+..........................+...........   ........+......................
T Consensus       234 g~~lhi~HiSs~~~~~~i~~ak~~G~~Vt~Et~ph~L~lt~~d~~~~~~~g~~~~~~PPlR~~~d~~aL~~~l~~G~id~  313 (476)
T PRK13404        234 DVPILIVHVSTREAAEQIRRARGRGLKIFAETCPQYLFLTAEDLDRPGMEGAKYICSPPPRDAANQEALWQGLELGTFES  313 (476)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEECCCHHHHCCHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCEE
T ss_conf             99768996587999999999998699132321400320889896766755632571699887667999997562597349


Q ss_pred             CCCCCCCCCCCC--------CCCCCCCCCCCCCCCCHHHHHHH-HHHHCCCCCHHHHHHHHHHHHHHHCCC-C-CCEECC
Q ss_conf             134445454322--------22343332222222101367888-676516989999999881517998099-9-972466
Q gi|254780301|r  308 IVSDHTPRHMDT--------KLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRPAQIFNL-P-GGTLQT  376 (431)
Q Consensus       308 ~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~gls~~eal~~aT~npA~~lgl-~-~G~I~~  376 (431)
                      .+...+......        ..................+.... .+..++.+|++++++++|.||||+||| + +|+|++
T Consensus       314 i~sDHaP~~~~~~~~~~~~~~~~~f~~~~~Gipg~e~~lp~l~~~~v~~g~lsl~~~v~~~s~nPAki~Gl~~~KG~i~~  393 (476)
T PRK13404        314 FSSDHAPFRFDDTAGKLAAGAEPSFPQIANGIPGVETRLPLLFSEGVVKGRISLNQFVALTSTNPAKLYGLYPRKGAIAI  393 (476)
T ss_pred             EECCCCCCCCCCHHHHHCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             97265641131101112046778853478988405678999989999829986999999998889998398878874468


Q ss_pred             CCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEEC
Q ss_conf             872678998698978853778520248865677278228899999999998624
Q gi|254780301|r  377 GTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLE  430 (431)
Q Consensus       377 Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~e  430 (431)
                      |++||||||||+++|+|+.++++|+++||||+|++++|+|.+|||+|++||+..
T Consensus       394 G~dADlvI~Dp~~~~~v~~~~~~sk~~~sp~~G~~~~G~v~~Tiv~G~~v~~~g  447 (476)
T PRK13404        394 GADADIAIWDPDEEVTISNADLHHAADYTPFEGMRVTGWPVTVLSRGRVVVEDG  447 (476)
T ss_pred             CCCCEEEEECCCCCEEECHHHCCCCCCCCCCCCCEEEEEEEEEEECCEEEEECC
T ss_conf             984329999399868988255625388788079888889999999999999999


No 11 
>PRK09060 dihydroorotase; Validated
Probab=100.00  E-value=0  Score=347.31  Aligned_cols=414  Identities=22%  Similarity=0.310  Sum_probs=215.3

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHH
Q ss_conf             26996429999888850001089979999983178655666788779988798895172714114789998311437889
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTL   82 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~~~   82 (431)
                      |||||||+|+|+++.  ..+||+|+||||++||...    ..++.++|||+|++|+|||||+|+|++.||.++++++.++
T Consensus         6 DllIkng~vv~p~~~--~~~DI~I~dGkI~~Ig~~~----~~~a~~vIDa~G~~v~PG~ID~HvH~~ePG~~~ked~~sg   79 (444)
T PRK09060          6 DLILKGGTVVNPDGE--GRADIGIRDGRIAAIGDLG----GASAGEVIDARGLHVLPGVIDSQVHFREPGLEHKEDLETG   79 (444)
T ss_pred             EEEEECCEEECCCCC--EEEEEEEECCEEEECCCCC----CCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHH
T ss_conf             399979399999985--8962999899999846888----9998849989999995798975505799997652446553


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC
Q ss_conf             99987078732124545566433316677776776643101223210001344322222221000-00112222343332
Q gi|254780301|r   83 SKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLL-QEQGIVSFIQSPMS  161 (431)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~  161 (431)
                      ++++..||+|....++...+............ .........+.......... ........... ..............
T Consensus        80 s~AAa~GGvTtv~~mPnt~P~~~~~~~~~~~~-~~a~~~~~vd~~~~~g~~~~-~~~~l~el~~~~g~~~~k~f~~~s~g  157 (444)
T PRK09060         80 SRAAVLGGVTAVFEMPNTNPLTTTAEALADKL-ARARHRMHCDFAFYVGGTRD-NADELAELERLPGCAGVKVFMGSSTG  157 (444)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCCHHHHHHHH-HHHHCCCCCEEEEEEEECCC-CHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             49898099379997778899968899999999-98742654115677743278-77899999851036548998417778


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             222110124567654210122223332222222--112467531001222210000123555566543200011122233
Q gi|254780301|r  162 IHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSR--GVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI  239 (431)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  239 (431)
                      ...........+...........|.........  .....+....+.  ..........................+..+.
T Consensus       158 ~~~~~d~~~l~~~~~~~~~~~~~H~Ed~~~l~~~~~~~~~g~~~~~~--~~r~~~~e~~ai~r~i~la~~tg~~lhi~Hv  235 (444)
T PRK09060        158 DLLVEDDEGLRRILRNGRRRAAFHSEDEYRLRERKGLRVEGDPRSHP--VWRDEEAALLATRRLVRLARETGRRIHVLHV  235 (444)
T ss_pred             CEEECCHHHHHHHHHHCCCCEEEECCCHHHHHHCHHHCCCCCHHHCC--CCCCHHHHHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             61006999999999854873387347889986222321279976745--5588899999999999999987993799955


Q ss_pred             CCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             31121100111100122232222222222232222-11100000011122222222222223344311113444545432
Q gi|254780301|r  240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDV-EMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMD  318 (431)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  318 (431)
                      ...............   .......+......... ..........+.......................+...++....
T Consensus       236 St~~~~~~i~~ak~~---vt~E~~ph~L~l~~~d~~~~~g~~~k~~PPLR~~~d~~aL~~~l~~G~ID~I~SDH~P~~~~  312 (444)
T PRK09060        236 STAEEIDFLADHKDV---ATVEVTPHHLTLAAPDCYERLGTLAQMNPPVRDARHRDALWRGVRQGIVDVLGSDHAPHTLE  312 (444)
T ss_pred             CCHHHHHHHHHHCCC---CEEEEECHHHCCCHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCEEECCCCCCCHH
T ss_conf             869999999970887---58999620520851666514496399748989979999999998669960997089788978


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC-CCEECCCCCCCEEEECCCCCEEECHHH
Q ss_conf             2223433322222221013678886765169899999998815179980999-972466872678998698978853778
Q gi|254780301|r  319 TKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP-GGTLQTGTAADIALIDLNYQWTVKADD  397 (431)
Q Consensus       319 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~-~G~I~~Gk~ADlvi~D~~~~~~i~~~~  397 (431)
                      ...........+.......++.....+.++.||++++++.+|.||||+|||. +|+|++|++||||||||+.+|+|+.++
T Consensus       313 ~K~~~f~~a~~G~~glEt~lplll~~v~~g~lsl~~~v~~~s~nPAki~GL~~kG~i~~G~dADlvi~Dp~~~~~v~~~~  392 (444)
T PRK09060        313 EKAKPYPASPSGMTGVQTLVPVMLDHVNAGRLSLERFVDLTSAGPARIFGIAGKGRIAVGYDADFTIVDLKRRETITNEW  392 (444)
T ss_pred             HCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCCEEECHHH
T ss_conf             85787641138973088799999999982983299999997174999849898873579996658999599978988465


Q ss_pred             HHCCCCCCCCCCEEEEEEEEEEEECCEEEEEE
Q ss_conf             52024886567727822889999999999862
Q gi|254780301|r  398 MSSIHKNTVFDKEFFTGKVVRTYISGKQVYTL  429 (431)
Q Consensus       398 ~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~  429 (431)
                      ++|+++||||+|++++|+|.+||++|++||+.
T Consensus       393 ~~sk~~~spf~G~~l~G~v~~Ti~rG~~V~~d  424 (444)
T PRK09060        393 IASRAGWTPYDGKEVTGWPVGTIVRGQRVMWD  424 (444)
T ss_pred             CCCCCCCCCCCCCEEEEEEEEEEECCEEEEEC
T ss_conf             65768867767988876899999999999999


No 12 
>TIGR03178 allantoinase allantoinase. This enzyme carries out the first step in the degradation of allantoin, a ring-opening hydrolysis. The seed members of this model are all in the vicinity of other genes involved in the processes of xanthine/urate/allantoin catabolism. Although not included in the seed, many eukaryotic homologs of this family are included above the trusted cutoff. Below the noise cutoff are related hydantoinases.
Probab=100.00  E-value=0  Score=348.12  Aligned_cols=420  Identities=26%  Similarity=0.357  Sum_probs=193.9

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHH
Q ss_conf             26996429999888850001089979999983178655666788779988798895172714114789998311437889
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTL   82 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~~~   82 (431)
                      |||||||+|+||++.  ..+||+|+||||++||++.    .+++.+||||+|++|+|||||+|+|+..++..+++++.++
T Consensus         1 DLlIkng~Vv~~~~~--~~~dV~I~dGkI~aIg~~~----~~~~~~vIDa~G~~V~PGfID~H~H~~~pg~~~~e~~~t~   74 (442)
T TIGR03178         1 DLAIRGGRVVTPEGE--READVGVAGGKIAAIGPDI----IPPGAKIIDAGGLVVFPGVVDTHVHINEPGRTEWEGFETG   74 (442)
T ss_pred             CEEEECEEEECCCCC--EEEEEEEECCEEEEECCCC----CCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHH
T ss_conf             979968099989986--7877999899999958888----9999879989999895799985658899985431426677


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCC----CC
Q ss_conf             99987078732124545566433316677776776643101223210001344322222221000001122223----43
Q gi|254780301|r   83 SKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFI----QS  158 (431)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~  158 (431)
                      ++++..+|++....+...................................... ....................    ..
T Consensus        75 ~~aa~~gGvTtv~~~~~~~~p~~~~~~~l~~~~~~~~~~~~vd~~~~~~~~~~-~~~~l~~l~~~g~~~~k~~~~~~~~~  153 (442)
T TIGR03178        75 TRAAAAGGITTFIDMPLNSIPPTTTREALEAKAEAAKGKLAVDVGFWGGLVPG-NLDDLRALAEAGVVGFKAFLSPSGVD  153 (442)
T ss_pred             HHHHHCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCC-HHHHHHHHHHCCCEEEEEEEECCCCC
T ss_conf             89996599889996877898886536899999997225650334344144531-36666553433761788996125677


Q ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             3322221101245676542101222233322222221---1246753100122221000012355556654320001112
Q gi|254780301|r  159 PMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRG---VINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYH  235 (431)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  235 (431)
                      ..............+...........|..........   ....+..................................+
T Consensus       154 ~~~~~~~~~l~~~~~~~~~~g~~~~~h~e~~~~~~~~~~~~~~~~~~~~~~~~~~rp~~~e~~av~~~~~~a~~~g~~~h  233 (442)
T TIGR03178       154 EFPHVDDRTLYKGMREIARAGKLLAVHAESPAITSALGEEAPPQGGVSARAYLASRPVAAEVEAVARTLAFAKDTGCRVH  233 (442)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCEE
T ss_conf             65567999999999999866986999558989999999999862896566613668889999999999999997299454


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22333112110011110012223222222222223222211100000011122222222222223344311113444545
Q gi|254780301|r  236 ASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPR  315 (431)
Q Consensus       236 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  315 (431)
                      ..+..........................+...................+...........................+..
T Consensus       234 i~Hiss~~~l~~i~~ak~~G~~vt~e~~p~~l~l~~~~~~~~~~~~k~~pplr~~~~~~~l~~~l~~g~id~i~sDh~p~  313 (442)
T TIGR03178       234 VVHISSAEAVALIREAKQEGLDVTVETCPHYLTFTAEEVPDGGTVFKCAPPIRDRQNQERLWEALLAGDIDFVVSDHSPC  313 (442)
T ss_pred             ECCCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHCHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             12247488999999999859926899664255304676605783353185336788899999876269548998389999


Q ss_pred             CCCCCCC-CCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC-CCEECCCCCCCEEEECCCCCEEE
Q ss_conf             4322223-433322222221013678886765169899999998815179980999-97246687267899869897885
Q gi|254780301|r  316 HMDTKLL-PFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP-GGTLQTGTAADIALIDLNYQWTV  393 (431)
Q Consensus       316 ~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~-~G~I~~Gk~ADlvi~D~~~~~~i  393 (431)
                      ....... ........................+.+||++++++++|.||||+|||+ +|+|++|++||||||||+++|+|
T Consensus       314 ~~~~k~~~~~~~~~~g~~g~e~~l~~~~~~~~~~glsl~~av~~~s~nPA~~lGL~~kG~l~~G~dADlvi~Dp~~~~~v  393 (442)
T TIGR03178       314 TPDLKRSGDFFKAWGGISGLQFTLPVMWDEARQRGLPLEDIARLMATNPAKRFGLAQKGRIAPGKDADFVFVDDDESYTL  393 (442)
T ss_pred             CHHHHCCCCHHHCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCEEE
T ss_conf             97894457654545787518889999999998568779999999978799985989888768898455899939998898


Q ss_pred             CHHHHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEE
Q ss_conf             377852024886567727822889999999999862
Q gi|254780301|r  394 KADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTL  429 (431)
Q Consensus       394 ~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~  429 (431)
                      +.++++|+++||||+|++++|+|.+||++||+||+.
T Consensus       394 ~~~~~~s~~~~sp~~g~~~~g~v~~t~~~G~~v~~~  429 (442)
T TIGR03178       394 TKDMLYHRHKISPYEGRTIGGRVRATYLRGQCIYDD  429 (442)
T ss_pred             CHHHCCCCCCCCCCCCCEEEEEEEEEEECCEEEEEC
T ss_conf             857770668857768978988999999999999999


No 13 
>cd01315 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology). But L-HYDs differ by having an L-enantio specificity and by lacking activity on possible natural substrates such as dihydropyrimidines. Allantoinase catalyzes the hydrolytic cleavage of the five-member ring of allantoin (5-ureidohydantoin) to form allantoic acid.
Probab=100.00  E-value=0  Score=340.66  Aligned_cols=422  Identities=26%  Similarity=0.316  Sum_probs=188.9

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHH
Q ss_conf             26996429999888850001089979999983178655666788779988798895172714114789998311437889
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTL   82 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~~~   82 (431)
                      |||||||+|+|+++.  .++||+|+||||++||++..   .+++.+||||+|++|+|||||+|+|+..++...++++.++
T Consensus         1 DllIkng~Vv~~~~~--~~~dV~I~dGkI~~Ig~~~~---~~~a~~vIDa~G~~V~PGfID~H~H~~~pg~~~~e~~~~~   75 (447)
T cd01315           1 DLVIKNGRVVTPDGV--READIAVKGGKIAAIGPDIA---NTEAEEVIDAGGLVVMPGLIDTHVHINEPGRTEWEGFETG   75 (447)
T ss_pred             CEEEECEEEECCCCC--EEEEEEEECCEEEEECCCCC---CCCCCEEEECCCCEECCCEEECCCCCCCCCCCCCCCHHHH
T ss_conf             979968399889997--88679998999999788899---9999989989999990386877758898874420406667


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCC--CCCCCCCCCCCCCCC-CCC
Q ss_conf             99987078732124545566433316677776776643101223210001344322222--221000001122223-433
Q gi|254780301|r   83 SKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEI--SEMRLLQEQGIVSFI-QSP  159 (431)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~-~~~  159 (431)
                      ++++..+|++....++...........................................  ............... ...
T Consensus        76 ~~aa~~gGvTtv~~~p~~~~p~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~l~~~~~~g~~g~k~~~~~~~~~~  155 (447)
T cd01315          76 TKAAAAGGITTIIDMPLNSIPPTTTVENLEAKLEAAQGKLHVDVGFWGGLVPGNLDQLRPLDEAGVVGFKCFLCPSGVDE  155 (447)
T ss_pred             HHHHHHCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHCCCEEEEEEECCCCCCC
T ss_conf             99998389338996767889875649999999998642466210145122464067689988628627888831565776


Q ss_pred             CCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             322221101245676542101222233322222221---12467531001222210000123555566543200011122
Q gi|254780301|r  160 MSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRG---VINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHA  236 (431)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  236 (431)
                      .............+...........|..........   ....+..................................+.
T Consensus       156 ~~~~~~~~l~~~~~~~~~~~~~~~~h~e~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~e~~ai~~~~~~a~~~g~~~~i  235 (447)
T cd01315         156 FPAVDDEQLEEAMKELAKTGSVLAVHAENPEITEALQEQAKAKGKRDYRDYLASRPVFTEVEAIQRILLLAKETGCRLHI  235 (447)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             55589999999999998559879996588699999898998638864666414487379999999999998862993698


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             23331121100111100122232222222222232222111000000111222222222222233443111134445454
Q gi|254780301|r  237 SVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRH  316 (431)
Q Consensus       237 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  316 (431)
                      .+..........................+...................+............................+..
T Consensus       236 ~H~s~~~~~~~i~~a~~~G~~vt~e~~ph~l~l~~~~~~~~~~~~k~~pplr~~~~~~~l~~~l~~g~i~~i~sDh~p~~  315 (447)
T cd01315         236 VHLSSAEAVPLIREARAEGVDVTVETCPHYLTFTAEDVPDGGTEFKCAPPIRDAANQEQLWEALENGDIDMVVSDHSPCT  315 (447)
T ss_pred             EECCCHHHHHHHHHHHHCCCCEEEEECCCHHCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCC
T ss_conf             62377778999999997499655786222220899898504963101721154455999999874498179994899999


Q ss_pred             CCCCCCC---CCCC-CCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC--CCEECCCCCCCEEEECCCCC
Q ss_conf             3222234---3332-2222221013678886765169899999998815179980999--97246687267899869897
Q gi|254780301|r  317 MDTKLLP---FAEA-SFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP--GGTLQTGTAADIALIDLNYQ  390 (431)
Q Consensus       317 ~~~~~~~---~~~~-~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~--~G~I~~Gk~ADlvi~D~~~~  390 (431)
                      .......   .... .................+.++++|++++++++|.||||+||++  +|+|++||+||||||||+++
T Consensus       316 ~~~k~~~~~~~~~~~~g~~g~~~~l~~~~~~~~~~~~l~le~~v~~~T~nPA~~lgl~~~kG~I~~G~dADlvi~D~~~~  395 (447)
T cd01315         316 PELKLLGKGDFFKAWGGISGLQLGLPVMLTEAVNKRGLSLEDIARLMCENPAKLFGLSHQKGRIAVGYDADFVVWDPEEE  395 (447)
T ss_pred             HHHHHCCCCCHHHHCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCCCC
T ss_conf             88961356866551378741777899999999982999999999999788999849888877607898467899919998


Q ss_pred             EEECHHHHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEE
Q ss_conf             885377852024886567727822889999999999862
Q gi|254780301|r  391 WTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTL  429 (431)
Q Consensus       391 ~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~  429 (431)
                      |+++.++++|+++||||+|++++|+|.+|||+|++||+.
T Consensus       396 ~~v~~~~~~s~~~~sp~~G~~~~g~v~~tiv~G~~v~~~  434 (447)
T cd01315         396 FTVDAEDLYYKNKISPYVGRTLKGRVHATILRGTVVYQD  434 (447)
T ss_pred             EEECHHHCCCCCCCCCCCCCEEEEEEEEEEECCEEEEEC
T ss_conf             898868843758978837988877899999999999999


No 14 
>PRK08323 dihydropyrimidinase; Validated
Probab=100.00  E-value=0  Score=340.32  Aligned_cols=420  Identities=22%  Similarity=0.279  Sum_probs=192.3

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC--CCCCCCC
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899--9831143
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS--PDEYSKN   78 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~--~~~~~~~   78 (431)
                      |+ +|||||+|+|+++..  .+||+|+||||++||++..    +++.++|||+|++|+|||||+|+|+..|  +....++
T Consensus         1 M~-llIkng~Vv~~~~~~--~aDI~I~dGkI~~Ig~~~~----~~~~~vIDa~G~~V~PG~ID~H~H~~~p~~g~~~~ed   73 (463)
T PRK08323          1 MS-TLIKGGTVVTADDTY--KADILIEDGKIAAIGENLP----PSGDEVIDATGCYVMPGGIDPHTHMEMPFGGTVAADD   73 (463)
T ss_pred             CC-EEEECEEEECCCCCE--EEEEEEECCEEEEECCCCC----CCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCCH
T ss_conf             96-899791998799868--8669998999999368899----9999699899999954889744476888899605431


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCC----CCCCCCCCC
Q ss_conf             7889999870787321245455664333166777767766431012232100013443222222210----000011222
Q gi|254780301|r   79 ITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMR----LLQEQGIVS  154 (431)
Q Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~  154 (431)
                      +.++++++..+|+|....+....+........... ..........+... ................    .........
T Consensus        74 ~~tgt~aA~~GGvTtv~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~d~~~-~~~~~~~~~~~l~e~~~~~~~~G~~~fk~  151 (463)
T PRK08323         74 FETGTRAAAAGGTTTIIDFALPPKGQSLREALEAW-HGKAAGKAVIDYSF-HMAITDWNEAVLDEMLELVVEEGITSFKH  151 (463)
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHH-HHHHCCCCEEEEEE-EEEECCCCHHHHHHHHHHHHHCCCCCEEE
T ss_conf             88899999739828984357899998859999999-99741685676633-67762687768999999998579550102


Q ss_pred             CCC-CCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             234-333222211012456765421012222333222222---2112467531001222210000123555566543200
Q gi|254780301|r  155 FIQ-SPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGS---RGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT  230 (431)
Q Consensus       155 ~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  230 (431)
                      ... ...............+...........|........   ......+..............................
T Consensus       152 ~~~~~~~~~~~d~~l~~~~~~a~~~g~~~~~H~E~~~~i~~l~~~~~~~G~~~~~~~~~~rp~~~E~~av~r~i~la~~~  231 (463)
T PRK08323        152 FMAYKGALMLDDDELLRSLQRAAELGALPMVHAENGDAIAELQAKLLAAGKTGPEYHALSRPPEVEGEATNRAIMIAELA  231 (463)
T ss_pred             EECCCCCEEECHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             30268960217689999999998649979994777479999999999758966244645488899999999999999996


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             011122233311211001111001222322222222222322221----1100000011122222222222223344311
Q gi|254780301|r  231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVE----MYNSLRKVLPPLRSETERMSMVEALEKGDID  306 (431)
Q Consensus       231 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  306 (431)
                      ....+..+..........................+..........    .........+.....................
T Consensus       232 g~~~hi~Hvss~~~~~~I~~ak~~G~~Vt~e~~ph~L~l~~~~~~~~~~~~~~~~~~~PPlR~~~d~~aL~~~l~~G~id  311 (463)
T PRK08323        232 GVPLYIVHVSCKEALEAIRRARARGQRVFGETCPQYLLLDESEYRGPDWDEGAKYVMSPPLRDKEHQDALWRGLQSGSLQ  311 (463)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCHHCCCHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCE
T ss_conf             99534210472778999999987699842662200211899997089854464178768768878999999887529800


Q ss_pred             CCCCCCCCCCCCCCCC----CCCCCCCCCCCCCHHHH-HHHHHHHCCCCCHHHHHHHHHHHHHHHCCC-C-CCEECCCCC
Q ss_conf             1134445454322223----43332222222101367-888676516989999999881517998099-9-972466872
Q gi|254780301|r  307 IIVSDHTPRHMDTKLL----PFAEASFGSIGLETMLS-AALRLFHGQQISLKKLIRALSTRPAQIFNL-P-GGTLQTGTA  379 (431)
Q Consensus       307 ~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~-~~~~~~~~~gls~~eal~~aT~npA~~lgl-~-~G~I~~Gk~  379 (431)
                      ..+...++........    ................. ....++.++.||++++++++|.||||+||| + +|+|++|++
T Consensus       312 ~i~sDH~P~~~~~~~~~~~~~f~~~p~G~~g~e~~l~~l~~~~V~~g~lsl~~~v~~~s~nPA~~lGL~~~KG~i~~G~d  391 (463)
T PRK08323        312 VVATDHCPFCFAEQKQLGRGDFSKIPNGTPGVEDRMPLLFSEGVMTGRITLNRFVELTSTNPAKIFGLYPRKGTIAVGAD  391 (463)
T ss_pred             EEECCCCCCCHHHHHHCCCCCHHHCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             99758776671443322678976787998504677999999999839999999999986629998397888866468985


Q ss_pred             CCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEE
Q ss_conf             67899869897885377852024886567727822889999999999862
Q gi|254780301|r  380 ADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTL  429 (431)
Q Consensus       380 ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~  429 (431)
                      ||||||||+.+|+|+.++++|+++||||+|++++|+|.+|||+||+||+.
T Consensus       392 ADlvi~Dp~~~~~v~~~~~~s~~~~sp~~G~~~~G~v~~tiv~G~~v~~~  441 (463)
T PRK08323        392 ADIVIWDPNATKTISAKTLHSNVDYNPFEGFEVTGWPVHTLSRGEVVVED  441 (463)
T ss_pred             CCEEEECCCCCEEECHHHCCCCCCCCCCCCCEEEEEEEEEEECCEEEEEC
T ss_conf             41899939986898835463558878878978876899999999999999


No 15 
>cd01314 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin. The hydrolysis of dihydropyrimidines is the second step of reductive catabolism of pyrimidines in human. The hydrolysis of 5-substituted hydantoins in microorganisms leads to enantiomerically pure N-carbamyl amino acids, which are used for the production of antibiotics, peptide hormones, pyrethroids, and pesticides. HYDs are classified depending on their stereoselectivity. This family also includes collapsin response regulators (CRMPs), cytosolic proteins involved in neuronal differentiation and axonal guidance which have strong homology to DHPases, but lack most of the active site residues.
Probab=100.00  E-value=0  Score=330.91  Aligned_cols=420  Identities=23%  Similarity=0.283  Sum_probs=186.2

Q ss_pred             EEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC--CCCCCCCHHH
Q ss_conf             69964299998888500010899799999831786556667887799887988951727141147899--9831143788
Q gi|254780301|r    4 FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS--PDEYSKNITT   81 (431)
Q Consensus         4 llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~--~~~~~~~~~~   81 (431)
                      ||||||+|+|+++..  .+||+|+||||++||++..   .+++.+||||+|++|+|||||+|+|+..+  +....+++.+
T Consensus         1 llIkNg~Vv~~~~~~--~~DI~I~~GkI~~Ig~~~~---~~~~~~vIDa~G~~V~PGfID~H~H~~~~~~~~~~~e~~~~   75 (447)
T cd01314           1 LIIKNGTIVTADGSF--KADILIEDGKIVAIGPNLE---APGGVEVIDATGKYVLPGGIDPHTHLELPFMGTVTADDFES   75 (447)
T ss_pred             CEEECEEEECCCCCE--EEEEEEECCEEEEECCCCC---CCCCCEEEECCCCEECCCEEECCCCCCCCCCCCCCCCHHHH
T ss_conf             989694998599878--8679998999999478899---88999799899999940889877257888788645022889


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCC---CCCCCCCCCCCCCC-
Q ss_conf             99998707873212454556643331667777677664310122321000134432222222---10000011222234-
Q gi|254780301|r   82 LSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISE---MRLLQEQGIVSFIQ-  157 (431)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~-  157 (431)
                      +++++..+|+|....+....+............. ............ ..............   .............. 
T Consensus        76 g~~aa~~gGvTtv~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~d~~~-~~~~~~~~~~~~~~~~~l~~~G~~~~k~~~~~  153 (447)
T cd01314          76 GTRAAAAGGTTTIIDFAIPNKGQSLLEAVEKWRG-KADGKSVIDYGF-HMIITDWTDSVIEELPELVKKGISSFKVFMAY  153 (447)
T ss_pred             HHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHH-HHCCCCEEEEEE-EEEEECCCHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             9999996891699516889999878999999999-853786355546-89995488779999999998387867787403


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             3332222110124567654210122223332222222---1124675310012222100001235555665432000111
Q gi|254780301|r  158 SPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSR---GVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHY  234 (431)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  234 (431)
                      ...............+...........|.........   .....+..................................
T Consensus       154 ~~~~~~~~~~l~~~~~~a~~~~~~~~~h~e~~~~~~~~~~~~~~~G~~~~~~h~~~rp~~~e~~av~r~~~la~~~g~~~  233 (447)
T cd01314         154 KGLLMVDDEELLDVLKRAKELGALVMVHAENGDVIAELQKKLLAQGKTGPEYHALSRPPEVEAEATARAIRLAELAGAPL  233 (447)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCE
T ss_conf             79623587999999999986399799925885799999999986588764546566889999999999999999809968


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2223331121100111100122232222222222232222---1110000001112222222222222334431111344
Q gi|254780301|r  235 HASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDV---EMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSD  311 (431)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  311 (431)
                      ...+....................................   ..........+..........................
T Consensus       234 ~i~His~~~~~~~i~~ar~~G~~v~~e~~~~~l~~~~~~~~~~~~~~~~~~~~pplr~~~~~~~l~~~l~~G~i~~i~sD  313 (447)
T cd01314         234 YIVHVSSKEAADEIARARKKGLPVYGETCPQYLLLDDSDYWKDWFEGAKYVCSPPLRPKEDQEALWDGLSSGTLQTVGSD  313 (447)
T ss_pred             EEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHCCCHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECC
T ss_conf             99960768899999999976992889734103317898963467533378606766998899999877635973588647


Q ss_pred             CCCCCCCCCCC---CCCCCCCCCCCCCH-HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCC-C-CCEECCCCCCCEEEE
Q ss_conf             45454322223---43332222222101-367888676516989999999881517998099-9-972466872678998
Q gi|254780301|r  312 HTPRHMDTKLL---PFAEASFGSIGLET-MLSAALRLFHGQQISLKKLIRALSTRPAQIFNL-P-GGTLQTGTAADIALI  385 (431)
Q Consensus       312 ~~~~~~~~~~~---~~~~~~~~~~~~~~-~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl-~-~G~I~~Gk~ADlvi~  385 (431)
                      .+.........   .............. ........+.++.||++++++++|.||||+||+ + +|+|++||+||||||
T Consensus       314 h~p~~~~~k~~~~~~f~~~~~G~~g~e~~l~~~~~~~v~~g~lsl~~~v~~~T~nPAk~lGl~~~kGsI~~G~dADlvi~  393 (447)
T cd01314         314 HCPFNFAQKARGKDDFTKIPNGVPGVETRMPLLWSEGVAKGRITLEKFVELTSTNPAKIFGLYPRKGTIAVGSDADLVIW  393 (447)
T ss_pred             CCCCCHHHHHHCCCCHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEE
T ss_conf             76667778763568764476998761121899999999828999999999983899998498888876378997778999


Q ss_pred             CCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEEC
Q ss_conf             698978853778520248865677278228899999999998624
Q gi|254780301|r  386 DLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLE  430 (431)
Q Consensus       386 D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~e  430 (431)
                      |||++|++++++++|+++||||+|++++|+|.+||++||+||+..
T Consensus       394 Dp~~~~~v~~~~~~s~~~~sp~~g~~~~g~v~~ti~~G~~v~~~g  438 (447)
T cd01314         394 DPNAEKTISADTHHHNVDYNIFEGMKVKGWPVVTISRGKVVVEDG  438 (447)
T ss_pred             ECCCCEEECHHHCCCCCCCCCCCCCEEEEEEEEEEECCEEEEECC
T ss_conf             599988988566746588377679799889999999999999999


No 16 
>COG0044 PyrC Dihydroorotase and related cyclic amidohydrolases [Nucleotide transport and metabolism]
Probab=100.00  E-value=0  Score=325.27  Aligned_cols=421  Identities=36%  Similarity=0.565  Sum_probs=275.7

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHH
Q ss_conf             26996429999888850001089979999983178655666788779988798895172714114789998311437889
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTL   82 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~~~   82 (431)
                      +++|+|++++++  +..+.+||+|+||+|++||+.+...   ++.++||++|++|+|||||.|+|+++||.+++|+++++
T Consensus         2 ~~lIk~~~iv~~--~~~~~~di~i~~g~I~~Ig~~l~~~---~~~~iiD~~g~~v~PG~ID~HVH~repg~~~ke~~~tg   76 (430)
T COG0044           2 DLLIKNARVVDP--GEDEVADILIKDGKIAAIGKNLEPT---SGAEIIDAKGLLVLPGLVDLHVHFREPGFEHKETFETG   76 (430)
T ss_pred             CEEEEEEEEECC--CCEEEECEEEECCEEEEECCCCCCC---CCCEEEECCCCEECCCEEEEEEECCCCCCCHHHHHHHH
T ss_conf             569962099789--9705707799888898841577777---88717977898777777566773389984135568769


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99987078732124545566433316677776776643101223210001344322-22222100000112222343332
Q gi|254780301|r   83 SKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEG-KEISEMRLLQEQGIVSFIQSPMS  161 (431)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~  161 (431)
                      ++++..||++...+++...+............. ........+............. ........  ......+......
T Consensus        77 s~AAa~GG~Ttv~dmPnt~P~~~~~~~~~~~~~-~a~~~~~vd~~~~~~it~~~~~~~~~~~~~~--~~g~~~F~~~~~~  153 (430)
T COG0044          77 SRAAAAGGVTTVVDMPNTKPPIDTAEALEDKLE-RAKGKSVVDYAFYGGLTKGNLGKLELTERGV--EAGFKGFMDDSTG  153 (430)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHH-HHHCCCEEEEEEEEEEECCCCHHHHHHHHHH--CCCEEEEECCCCC
T ss_conf             999975892699977789999887999999998-6403754789998764126510477664211--1546999569876


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             22211012456765421012222333222222211246753100122221000012355556654320001112223331
Q gi|254780301|r  162 IHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI  241 (431)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  241 (431)
                      .........+.++..........|..............+..................................+..+...
T Consensus       154 ~~~~~~~~~~~~~~~~~~~~~~~H~Ed~~~~~~~~~~~g~~~~~~~~~~~p~~aE~~~iar~~~la~~~g~~vhi~HiSt  233 (430)
T COG0044         154 ALDDDVLEEALEYAAELGALILVHAEDDDLIAEGVMNEGLRAPELGLAGRPPIAEASAIARDLELARATGARVHICHIST  233 (430)
T ss_pred             CCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHCCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             56889999999999855986999717803555567515865321034689837789999999999998699689995485


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             12110011110012223222222222223222211100000011122222222222223344311113444545432222
Q gi|254780301|r  242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKL  321 (431)
Q Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  321 (431)
                      ..+....................+...................+.......................+...++.......
T Consensus       234 ~~sv~li~~ak~~g~~vt~EvtphHL~l~~~~~~~~~~~~k~nPPLR~~~dr~aL~~~l~~G~ID~iasDHaPht~eeK~  313 (430)
T COG0044         234 KESVELIRAAKAEGIRVTAEVTPHHLLLDEEDIEDLGTLAKVNPPLRDEEDREALWEALKDGVIDVIASDHAPHTLEEKR  313 (430)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCEECCHHHHHCCCCCEEECCCCCCHHHHHHHHHHHHCCCCCEEECCCCCCCHHHHC
T ss_conf             99999999987649955886272136656768532474024789999878999999998779876897689999978831


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC-CCEECCCCCCCEEEECCCCCEEECHHHHHC
Q ss_conf             3433322222221013678886765169899999998815179980999-972466872678998698978853778520
Q gi|254780301|r  322 LPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP-GGTLQTGTAADIALIDLNYQWTVKADDMSS  400 (431)
Q Consensus       322 ~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~-~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s  400 (431)
                      ........+........+....++.++.+|+.+++++.|.||||+||++ +|.|++|++|||+|||++++|+|+.++++|
T Consensus       314 ~~f~~ap~G~~glE~~lpl~l~lv~~g~lsl~~~v~~~S~nPA~ifgl~~~g~i~~G~~ADl~lvD~~~~~~i~~~~~~s  393 (430)
T COG0044         314 LPFEEAPSGIPGLETALPLLLTLVKKGRLSLERLVELLSTNPARIFGLPPKGAIEEGADADLVLVDPDEEWTIRAEELYS  393 (430)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHCCCCCCCCCCCCCCCEEEECCCCCEEECHHHHHC
T ss_conf             53200999873588899999999865887999999997419799839998874467997767998489870775366321


Q ss_pred             CCCCCCCCCEEEEEEEEEEEECCEEEEEECC
Q ss_conf             2488656772782288999999999986249
Q gi|254780301|r  401 IHKNTVFDKEFFTGKVVRTYISGKQVYTLES  431 (431)
Q Consensus       401 ~~~~tp~~g~~~~g~V~~tiv~G~iVy~~e~  431 (431)
                      +++||||+|++++|+|.+||++||+||+.+.
T Consensus       394 k~~~sPf~G~~~~g~v~~Ti~rG~~v~~~~~  424 (430)
T COG0044         394 KAKNSPFEGFELKGRVVATILRGKVVYEDGE  424 (430)
T ss_pred             CCCCCCCCCCEEEEEEEEEEECCEEEEECCC
T ss_conf             1479998897762247899999899995684


No 17 
>PRK04250 dihydroorotase; Provisional
Probab=100.00  E-value=1.4e-45  Score=311.59  Aligned_cols=392  Identities=25%  Similarity=0.330  Sum_probs=209.7

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899983114378
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNIT   80 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~   80 (431)
                      |.+| |+||+||++.+ + ..+||+|+||||++||...    .+.+.+++|++|++|+|||||+|+|++.++.++++++.
T Consensus         1 m~~l-i~~G~vv~~~~-~-~~adI~I~dGkI~~I~~~~----~~~~~~~~~~~G~~vlPG~ID~hvH~~~pg~~~ke~~~   73 (408)
T PRK04250          1 MMEL-VLVGKFLYKGE-I-IEGSIGIEDGKISKISLRE----LKGDEKIKVDKGKIILPGLIDVHVHLRDFEEKYKETIE   73 (408)
T ss_pred             CCEE-EECCEEEECCC-E-EEEEEEEECCEEEEECCCC----CCCCCEEEECCCCEEECCEEECCCCCCCCCCCHHHHHH
T ss_conf             9278-98629990898-8-9966999899998936888----99985799589998957889645067888853034688


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999870787321245455664333166777767766431012232100013443222222210000011222234333
Q gi|254780301|r   81 TLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPM  160 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (431)
                      ++++++..||++....++...+............ ..................... ...... ......   .......
T Consensus        74 sgs~AAa~GGvTtv~~mPnt~p~~~~~~~~~~~~-~~~~~~~~~d~~~~~~~~~~~-~~~~~~-~~~~~k---~~~~~~~  147 (408)
T PRK04250         74 TGTKAALHGGITTVFDMPNTKPPIMDEKTLKLRE-GIFEKKSYADYALGFLLAGNC-GEAKPV-KADFYK---IFMGAST  147 (408)
T ss_pred             HHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHH-HHHCCCCEEEEEEEEEEECCC-CHHHHH-HHHHHH---HEECCCC
T ss_conf             7899998389359976788999868799999999-984769757883079960773-036788-887763---2303466


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             22221101245676542101222233322222221124675310012222100001235555665432000111222333
Q gi|254780301|r  161 SIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS  240 (431)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (431)
                      ....   .................|........             ............................+..+..
T Consensus       148 ~~~~---~~~~~~~~~~~~~~~~vHaEd~~l~~-------------~~~~rP~~aE~~ai~r~~~la~~tg~~lhi~HvS  211 (408)
T PRK04250        148 GGIY---SENFEEDYACAPDIVSVHAEDPEIIR-------------RYPERPPEAEVRAIKKALEAAKKLKKPLHICHVS  211 (408)
T ss_pred             CCHH---HHHHHHHHHHCCCCEEECCCCHHHHH-------------CCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             5065---78799999865997899579978884-------------4899999999999999999999849969999458


Q ss_pred             CHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11211001111001222322222222222322221110000001112222222222222334431111344454543222
Q gi|254780301|r  241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTK  320 (431)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  320 (431)
                      ..............  ........+........... .......+................  .....+...++......
T Consensus       212 s~~~l~~I~~a~~~--~vt~Et~ph~L~l~~~~~~~-~~~~k~~PPLRs~~dr~aL~~~l~--~Id~i~SDH~P~~~e~K  286 (408)
T PRK04250        212 TKDGLKEILKSNLP--WVSFEVTPHHLFLTRKDYER-NPLLKVYPPLRSEEDRRALWENFS--RIPIIASDHAPHTLEDK  286 (408)
T ss_pred             CHHHHHHHHHHCCC--CEEEEEEHHHHHCCHHHHCC-CCCEEECCCCCCHHHHHHHHHHHC--CCCEEEECCCCCCHHHH
T ss_conf             89999999984179--83999812264478377575-687497899997888999998626--88889836888897883


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEEECHHHHHC
Q ss_conf             23433322222221013678886765169899999998815179980999972466872678998698978853778520
Q gi|254780301|r  321 LLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSS  400 (431)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s  400 (431)
                      .    ....+.......++....++.++.+|++++++.+|.||||+||++.|.|++|++||||||||+.+|+|++++++|
T Consensus       287 ~----~~~~G~~glEt~lpl~~~~v~~g~isl~~lv~~~s~nPAki~gl~~~~i~~G~dADlvi~Dp~~~~~v~~~~~~s  362 (408)
T PRK04250        287 E----AGAAGLPGLETEVALLLDAANKGMITLKDIVEKMHINPARIFGIKNKGFEEGKDADFTIVDMKKEWTIKAEEFYT  362 (408)
T ss_pred             C----CCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCHHHHHCCCCCCCCCCCCCCEEEECCCCCEEECHHHCCC
T ss_conf             4----477898708889999999998179889999999742759964978888479986758999499978988577526


Q ss_pred             CCCCCCCCCEEEEEEEEEEEECCEEEEEEC
Q ss_conf             248865677278228899999999998624
Q gi|254780301|r  401 IHKNTVFDKEFFTGKVVRTYISGKQVYTLE  430 (431)
Q Consensus       401 ~~~~tp~~g~~~~g~V~~tiv~G~iVy~~e  430 (431)
                      +++||||+|++++|+|.+||++|++||+..
T Consensus       363 ~~~~spf~G~~l~G~v~~Ti~~G~~V~~~g  392 (408)
T PRK04250        363 KAGWTPYEGWKVKGKVIMTILRGEVVMEED  392 (408)
T ss_pred             CCCCCCCCCCEEEEEEEEEEECCEEEEECC
T ss_conf             488578459788779999999999999999


No 18 
>TIGR00857 pyrC_multi dihydroorotase, multifunctional complex type; InterPro: IPR004722   Dihydroorotase belongs to MEROPS peptidase family M38 (clan MJ), where it is classified as a non-peptidase homologue. DHOase catalyses the third step in the de novo biosynthesis of pyrimidine, the conversion of ureidosuccinic acid (N-carbamoyl-L-aspartate) into dihydroorotate. Dihydroorotase binds a zinc ion which is required for its catalytic activity .   In bacteria, DHOase is a dimer of identical chains of about 400 amino-acid residues (gene pyrC). In higher eukaryotes, DHOase is part of a large multi-functional protein known as 'rudimentary' in Drosophila melanogaster and CAD in mammals and which catalyzes the first three steps of pyrimidine biosynthesis . The DHOase domain is located in the central part of this polyprotein. In yeasts, DHOase is encoded by a monofunctional protein (gene URA4). However, a defective DHOase domain  is found in a multifunctional protein (gene URA2) that catalyzes the first two steps of pyrimidine biosynthesis.   The comparison of DHOase sequences from various sources shows  that there are two highly conserved regions. The first located in the N-terminal extremity contains two histidine residues suggested  to be involved in binding the zinc ion. The second is found in the C-terminal part. Members of this family of proteins are predicted to adopt a TIM barrel fold .   Dihydroorotase 'multifunctional complex type' 3.5.2.3 from EC, in contrast to the homodimeric type of dihydroorotase found in Escherichia coli, tends to appear in a large multifunctional complex with aspartate transcarbamoylase. Homologous domains appear in multifunctional proteins of higher eukaryotes. In some species, including Pseudomonas putida and Pseudomonas aeruginosa, this protein is inactive but is required as a non-catalytic subunit of aspartate transcarbamoylase (ATCase). In these species, a second, active dihydroorotase is also present..
Probab=100.00  E-value=4.2e-45  Score=308.48  Aligned_cols=409  Identities=36%  Similarity=0.506  Sum_probs=315.5

Q ss_pred             EEEEEEEE----CCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCC
Q ss_conf             00108997----99999831786556667887799887988951727141147899983114378899998707873212
Q gi|254780301|r   20 EVGAIIVE----NGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSII   95 (431)
Q Consensus        20 ~~~~I~I~----~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~~~~~~~~~~~~~~~~   95 (431)
                      ..+||+|+    ||||++|+++.  ...+++++|||.+|.+|+|||||+|+||+++|.+++||+.||+++|..||++...
T Consensus         4 ~~~di~V~~Gvd~g~I~~i~~~~--~~~~~~~~vi~~~g~lvlPG~iD~HVHlRdpg~eyKEdi~~G~~AA~~GG~t~V~   81 (459)
T TIGR00857         4 VEVDILVESGVDDGKIKKIGDDK--LRIKADAEVIDAKGLLVLPGLIDLHVHLRDPGEEYKEDIESGSKAAIHGGFTTVA   81 (459)
T ss_pred             EEEEEEEEECCCCCEEEEECCCC--CCCCCCCEEECCCCCEECCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             55568997436898578853777--5578764155477747806004777621889874113188999997558715899


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHH---------------------CCCCCCCCEECCCCCCCC--CCCCCCCCCCCCC
Q ss_conf             45455664333166777767766431---------------------012232100013443222--2222100000112
Q gi|254780301|r   96 LMPLGMSSFLDEYTFIKYALEEIRVK---------------------SLINVYPTACLTSNMEGK--EISEMRLLQEQGI  152 (431)
Q Consensus        96 ~~~~~~~~~~~~~~~~~~~~~~~~~~---------------------~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~  152 (431)
                      +++++.+...................                     ..................  .............
T Consensus        82 dMPNT~PP~d~~~~~~~~~~~~~~~~GvnahhqPPGdPqaenrPdsa~vd~~~~~~vt~~~~gk~~~~~~~~~~~~~~~~  161 (459)
T TIGR00857        82 DMPNTKPPIDTPETLERKLQRLKKKSGVNAHHQPPGDPQAENRPDSALVDVLLYAGVTKGNKGKEIVRLTEAYELKEAGA  161 (459)
T ss_pred             ECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCCCEEEECCHHHHHCCCE
T ss_conf             85743137789899999999741014642346855587535588852554578645704445551011125056510643


Q ss_pred             C--CCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             2--223433322221101245676542101222233322222221-1246753100122221000012355556654320
Q gi|254780301|r  153 V--SFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRG-VINEGIIANYLGLVGIPSISETVPLARDLLIAQH  229 (431)
Q Consensus       153 ~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  229 (431)
                      .  .+...............+.++..........|.......... ....+.............................
T Consensus       162 ~G~~F~~d~~~~~~~~~~~~~le~a~~~Gv~~~~HaE~~~l~~~~~~~~~~~~~~~~gl~~rp~~aE~~~va~~~~l~~~  241 (459)
T TIGR00857       162 VGEVFIDDGSEVLDILSMRKALEYAAELGVLIVLHAEDPDLIAGGLVEYEGRSAAALGLKARPPEAEEVAVARLLELAKH  241 (459)
T ss_pred             EEEEEEECCHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHCCCCCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             68987645523420345678999885579369982588677326742122332475367888203379999999999986


Q ss_pred             CCCC-----CCCCCCCCHHHHHHHHHHHCC--CCCCCCCCCCCCCCCCCCCCCC--------CCCCCCCCCCCCCCCCCC
Q ss_conf             0011-----122233311211001111001--2223222222222223222211--------100000011122222222
Q gi|254780301|r  230 TGGH-----YHASVISIPQSIALIKHAKAH--NTKATCGISINNLILNENDVEM--------YNSLRKVLPPLRSETERM  294 (431)
Q Consensus       230 ~~~~-----~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~  294 (431)
                      ....     .+..+.....+..........  ..........+...........        ........+.........
T Consensus       242 ~g~~nkkPhvHicHiSTk~~~~~i~~~k~~~~Gi~~T~EVtPHHLlL~~~~~~~GlPPhtP~~~~~~kvNPPLR~~eDr~  321 (459)
T TIGR00857       242 AGCPNKKPHVHICHISTKESLELIKKAKKQLKGIKITAEVTPHHLLLSEEDVARGLPPHTPPLDTNLKVNPPLREEEDRL  321 (459)
T ss_pred             CCCCCCCCCEEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             18888888436998650015889998764004623899846730017868882688788888888501377988853599


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCC-CCCHHHHHHHHHHHHHHHCCCCC-C
Q ss_conf             222223344311113444545432222343332222222101367888676516-98999999988151799809999-7
Q gi|254780301|r  295 SMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQ-QISLKKLIRALSTRPAQIFNLPG-G  372 (431)
Q Consensus       295 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-gls~~eal~~aT~npA~~lgl~~-G  372 (431)
                      ..............+...++...............+.............++.++ -+|+.++++|+|.||||+||++. |
T Consensus       322 aL~~~~~~G~ID~iAsDHAPH~~eEK~~~~~~appG~pgle~~~p~~l~~~~kg~lis~~~~~~~~s~nParIfgl~~~G  401 (459)
T TIGR00857       322 ALIEGLKDGIIDIIASDHAPHTLEEKLKEVAAAPPGIPGLETVLPLLLQLLVKGNLISLKDLVRMLSINPARIFGLPDKG  401 (459)
T ss_pred             HHHHHHHCCCCCEEECCCCCCCHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCHHHCCCCCCC
T ss_conf             99776634720178557864212655021554678873388899999999754873268999999852655112279877


Q ss_pred             EECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEEC
Q ss_conf             2466872678998698978853778520248865677278228899999999998624
Q gi|254780301|r  373 TLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLE  430 (431)
Q Consensus       373 ~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~e  430 (431)
                      .|+.|+.|||+|||++++|+|+.++++|++.||||+|++++|+|.+||++||+||+.+
T Consensus       402 ~l~~G~~Ad~tv~Dl~k~~~i~~e~f~sKa~~TPf~G~~~~g~p~~Ti~rGk~~~~~~  459 (459)
T TIGR00857       402 TLEEGNPADLTVIDLKKEWTIKAETFYSKAKNTPFEGMSLKGKPIATILRGKVVYEDG  459 (459)
T ss_pred             CCCCCCCCCEEEECCCHHCEEEHHHCCCCCCCCCCCCEEECCEEEEEEEEEEEEEECC
T ss_conf             4136797762378741000530101432213775667446473589998018876219


No 19 
>TIGR02033 D-hydantoinase dihydropyrimidinase; InterPro: IPR011778    This entry represents the D-hydantoinase (dihydropyrimidinase) which primarily converts 5,6-dihydrouracil to 3-ureidopropanoate but also acts on dihydrothymine and hydantoin. The enzyme is a metalloenzyme ..
Probab=100.00  E-value=7e-45  Score=307.38  Aligned_cols=425  Identities=20%  Similarity=0.187  Sum_probs=292.9

Q ss_pred             EEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCC--CC--CCCCCCH
Q ss_conf             6996429999888850001089979999983178655666788779988798895172714114789--99--8311437
Q gi|254780301|r    4 FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG--SP--DEYSKNI   79 (431)
Q Consensus         4 llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~--~~--~~~~~~~   79 (431)
                      +|||||||++.++..  .+||+|+||+|++||++......+...++|||+|||||||+||+||||..  .|  ....+||
T Consensus         1 ~Li~GGTVV~a~~~~--~aDv~Ie~g~i~a~G~n~Pv~~~~~~~~~iDA~GkyVlPGGiD~HTHl~~~~~gG~~~t~DdF   78 (466)
T TIGR02033         1 ILIKGGTVVNADDVF--EADVLIEGGKIVAVGANIPVLLPPDAVKEIDATGKYVLPGGIDVHTHLEMPFGGGSTVTADDF   78 (466)
T ss_pred             CEEECCEEECCCCEE--EEEEEECCCEEEEECCCCCEEECCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCEEEECCCH
T ss_conf             953075478247707--885887087789805778256537872789861028689874621000100368536540460


Q ss_pred             HHHHHHHHCCCCCCCCC-CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEE-CCCCC-CCCCCCCCCCCCCCCCCCCC
Q ss_conf             88999987078732124-54556643331667777677664310122321000-13443-22222221000001122223
Q gi|254780301|r   80 TTLSKEAVAGGITSIIL-MPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTAC-LTSNM-EGKEISEMRLLQEQGIVSFI  156 (431)
Q Consensus        80 ~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~-~~~~~~~~~~~~~~~~~~~~  156 (431)
                      .+++++|..||+|...+ +...............+.................. ..... ..+...............+.
T Consensus        79 ~~Gt~AAa~GGTTtiIDhf~~~~~G~~L~~~~e~y~~~A~gKsviDY~FHm~i~~~~d~v~~e~~~~~~~~Gi~SfK~fM  158 (466)
T TIGR02033        79 FSGTKAAAAGGTTTIIDHFALPEKGKSLTEALETYHEKAEGKSVIDYGFHMVITDWNDEVLEEHESELVEEGISSFKVFM  158 (466)
T ss_pred             HHHHHHHHHCCCCEEECCCCCCCCCCCCHHHHHHHHHHHCCCCEEEHHHHHHHHHCCHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             05889984189851647604288887208899999998368866742246777632767899999999862540102554


Q ss_pred             CCCCC-CCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC-
Q ss_conf             43332-2221101245676542101222233322222221---124675310012222100001235555665432000-
Q gi|254780301|r  157 QSPMS-IHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRG---VINEGIIANYLGLVGIPSISETVPLARDLLIAQHTG-  231 (431)
Q Consensus       157 ~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  231 (431)
                      ..... .........+.............|..........   ....|............................... 
T Consensus       159 AY~~~l~~~D~~L~~~L~~~~~~GA~~~VHAENgd~ia~~~~~~~a~G~T~P~yHalSRP~e~EaEA~~R~I~~A~~a~n  238 (466)
T TIGR02033       159 AYKNLLMVDDEELFEILKRLKELGALLQVHAENGDVIAELQARLLAQGKTGPEYHALSRPPELEAEAVARAIKLAALADN  238 (466)
T ss_pred             HHCHHHCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             61422115757899999998751981786046305899999999964787888753347333257799999999999659


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC
Q ss_conf             11122233311211001111001222322222222222322----2211100000011122-222222222223344311
Q gi|254780301|r  232 GHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNEN----DVEMYNSLRKVLPPLR-SETERMSMVEALEKGDID  306 (431)
Q Consensus       232 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~  306 (431)
                      ......+.....+............................    ............++.. ........+.........
T Consensus       239 ~PLy~vHvS~~~a~~~i~~AR~~G~~V~~ETcp~YL~Ld~~~yd~~p~~~~AKyv~SPPLRP~~~~qd~Lw~~l~~G~Lq  318 (466)
T TIGR02033       239 APLYIVHVSTKDALDEIAEAREKGQPVYGETCPQYLLLDDTLYDDKPGFEAAKYVLSPPLRPEKEDQDALWQALSSGALQ  318 (466)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHCCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHCCCCC
T ss_conf             86589996377789999999853990899860672113467815877726550121800133876608999987618511


Q ss_pred             CCCCCCCCCCCCCC---CCCC-----CCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCC--CCCEECC
Q ss_conf             11344454543222---2343-----332222222101367888676516989999999881517998099--9972466
Q gi|254780301|r  307 IIVSDHTPRHMDTK---LLPF-----AEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNL--PGGTLQT  376 (431)
Q Consensus       307 ~~~~~~~~~~~~~~---~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl--~~G~I~~  376 (431)
                      ..+...+.......   ....     ............+...+...+.++.||+++.++..+.||||+|+|  +||+|.+
T Consensus       319 ~v~sDHC~F~~~~~Gkl~~~G~dDF~~iPNG~PGvE~Rm~~lf~~gV~~Gri~~e~FV~~TSt~~AK~F~lyP~KG~i~~  398 (466)
T TIGR02033       319 TVSSDHCTFNFAQKGKLKAIGKDDFRKIPNGLPGVEERMELLFDEGVAKGRITLEKFVELTSTNPAKIFNLYPRKGTIAV  398 (466)
T ss_pred             EEEECCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEECC
T ss_conf             03303366354356141128887645078845862111479887332658787667989988866887188986754502


Q ss_pred             CCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEEC
Q ss_conf             872678998698978853778520248865677278228899999999998624
Q gi|254780301|r  377 GTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLE  430 (431)
Q Consensus       377 Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~e  430 (431)
                      |.+||||||||+...+|..++.++..+||||||++++|+|..|+.+|++|++.-
T Consensus       399 GSDADivi~DP~~~~~I~~~~~h~~~dY~pfEG~~~~G~~~~VlSRG~~~~~~g  452 (466)
T TIGR02033       399 GSDADIVIWDPRRSTVISAETHHDNADYTPFEGFKVKGAVVSVLSRGRVVVEDG  452 (466)
T ss_pred             CCCCCEEEECCCCCEEHHHHHHHHHCCCCCCCCEEECCEEEEEEECCEEEEECC
T ss_conf             467356898899645302366653148860257055020799987580899978


No 20 
>PRK01211 dihydroorotase; Provisional
Probab=100.00  E-value=5.6e-43  Score=295.00  Aligned_cols=390  Identities=20%  Similarity=0.206  Sum_probs=199.7

Q ss_pred             CCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             42999988885000108997999998317865566678877998879889517271411478999831143788999987
Q gi|254780301|r    8 NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAV   87 (431)
Q Consensus         8 n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~~~~~~~~   87 (431)
                      -|+|+.  .+.++..||+|+||||++|++++      ++.+.||+.|+ |+|||||+|+|++.||.+++|++.++++++.
T Consensus         6 ~g~~~~--~g~~~~~DI~I~dGkI~~I~~~~------~~~~~id~~g~-VlPG~ID~HvH~rePG~~~kEd~~tgs~AAa   76 (413)
T PRK01211          6 CGNFYY--KGKFDYLEVDVNDGIITSIKKDA------GNVKKIKLNGA-VLPAATDIHVHFRTPGETYKEDFSTGSLSAI   76 (413)
T ss_pred             EEEEEE--CCEEEEEEEEEECCEEEEECCCC------CCCCEEEECCE-EECCEEECCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             158999--99488971999899998835889------99746985886-9398779960269999430320999999998


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             07873212454556643331667777677664310122321000134432222222100000112222343332222110
Q gi|254780301|r   88 AGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQV  167 (431)
Q Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  167 (431)
                      .||+|....++...+............. ................. ... ................  ...........
T Consensus        77 ~GGvTtv~~mPnt~ppi~~~~~~~~~~~-~~~~~~~~d~~~~~~~~-~~~-~~~~~~~~~g~k~f~~--~~~~~~~~~~i  151 (413)
T PRK01211         77 FGGTTTVMDMPNNKIPIDDYNAFSDKLG-IISRTSYCDFGLYSMET-GDN-SLIIDKRSIGLKVYLG--GSTNTNGTDVI  151 (413)
T ss_pred             CCCCEEEEECCCCCCCCCCHHHHHHHHH-HHHCCCEEEEEEEEEEC-CCC-HHHHHHHHCCEEEEEC--CCCCCCCCHHH
T ss_conf             2991899988999999677999999999-74047546788787123-742-5544313103144105--65555640454


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHH
Q ss_conf             12456765421012222333222222211246753100122221000012355556654320001112223331121100
Q gi|254780301|r  168 LLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL  247 (431)
Q Consensus       168 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  247 (431)
                      .....+...........|.....................  .......................   ...+........ 
T Consensus       152 ~~~~~~~~~~~~~~v~~HaEd~~~~~~~~~~~~~~~~~~--~~rp~~~e~~av~~~~~~~~~~~---~~~h~ss~e~~~-  225 (413)
T PRK01211        152 TNEEISKINELNVPVFFHGEDEECLKKHQFEAKNLREHN--LSRPIECEILAAEYVKNLDLKTK---IMAHVSSPDVIG-  225 (413)
T ss_pred             HHHHHHHHHHCCCCEEEECCCHHHHHHHHHCCCCHHHCC--CCCCHHHHHHHHHHHHHHHHHCC---EEEEEECHHHHH-
T ss_conf             599999998679928985358788764330456865631--55759999999999998764338---799994688987-


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11110012223222222222223222211100000011122222222222223344311113444545432222343332
Q gi|254780301|r  248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEA  327 (431)
Q Consensus       248 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  327 (431)
                        ....       ....+.....  ............+.......................+...++....... .....
T Consensus       226 --~i~~-------Et~pHhL~l~--de~~~g~~~k~nPPLRs~~d~~aL~~al~dG~ID~IaSDHaPh~~~eK~-~f~~a  293 (413)
T PRK01211        226 --EFLR-------EVTPHHLLLN--DEMPLGSYGKVNPPLRDRSTQSRLLNSYISGNFDILSSDHAPHTENDKT-EFEYA  293 (413)
T ss_pred             --HHHH-------EECCEEEECC--CCCCCCCCCEECCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHCC-CHHHC
T ss_conf             --7874-------2045048715--5201687616689998979999999987439988896378898946618-86458


Q ss_pred             CCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCC
Q ss_conf             22222210136788867651698999999988151799809999724668726789986989788537785202488656
Q gi|254780301|r  328 SFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVF  407 (431)
Q Consensus       328 ~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~  407 (431)
                      ..+.......++....++.++++|++++++.+|.||||+|||++|+|++|++||||||||+++|+|+.++++|+++||||
T Consensus       294 ~~G~~GlEt~lpl~l~~v~~g~l~l~~lv~~~s~nPAki~gl~kG~i~~G~dADlvI~D~~~~~~v~~~~~~Sk~~~tPf  373 (413)
T PRK01211        294 KSGIIGVETRIPLMLALVSKKILPLDVLYKTAIENPPSIFGIRKGKIENGYDADFMSFDFTNIKRLNDYRLHSKNPVSPF  373 (413)
T ss_pred             CCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCEEECHHHCCCCCCCCCC
T ss_conf             88987614389999999874897999999999999999959987650799987789984999889886884141799772


Q ss_pred             CCEEEEEEEEEEEECCEEEEEEC
Q ss_conf             77278228899999999998624
Q gi|254780301|r  408 DKEFFTGKVVRTYISGKQVYTLE  430 (431)
Q Consensus       408 ~g~~~~g~V~~tiv~G~iVy~~e  430 (431)
                      +|++++ ++.+||++|++||+..
T Consensus       374 eG~~~~-~p~~ti~rG~vv~~~g  395 (413)
T PRK01211        374 NGMDAI-FPSHVVMRGDVVIDNY  395 (413)
T ss_pred             CCEEEE-EEEEEEECCEEEEECC
T ss_conf             892871-2499998999999999


No 21 
>PRK08417 dihydroorotase; Provisional
Probab=100.00  E-value=3.8e-43  Score=296.04  Aligned_cols=386  Identities=28%  Similarity=0.434  Sum_probs=202.4

Q ss_pred             EEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             89979999983178655666788779988798895172714114789998311437889999870787321245455664
Q gi|254780301|r   24 IIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSS  103 (431)
Q Consensus        24 I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  103 (431)
                      |.|+||||++||+++      ++.++|||+|++|+|||||+|+|++.++.+. +++.++++++..||++....++...+.
T Consensus         1 I~I~~G~I~~Ig~~~------~~~~viDa~G~~vlPG~ID~HvH~~~~~~~~-~d~~tgs~AAa~GGvTtv~~mPnt~P~   73 (387)
T PRK08417          1 IRIKEGKITEIGSNL------KGEEIVDAKGMTLLPALVDLNVRVKNDKLSL-KNLKLLANEALKGGIGSIVLRPDSTPS   73 (387)
T ss_pred             CEEECCEEEEECCCC------CCCEEEECCCCEEECCEEECCCCCCCCCCCC-CHHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             978799997705999------9985898999989799896874789999774-359999999984687899989889999


Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             33316677776776643101223210001344322222221000001122223433322221101245676542101222
Q gi|254780301|r  104 FLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA  183 (431)
Q Consensus       104 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  183 (431)
                      ............ ................   .....................  ............+.++.........
T Consensus        74 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~---~~~~~~~~~~~l~~~g~~~~~--~~~~~~~~~~~~~~~~~~~~~~~v~  147 (387)
T PRK08417         74 IDNEISLELILS-NLAELPMQIFPSISAL---DKEGKLSNIAILLKKGAKAIY--LDSSLDANLLKRIAQYAQMLDVPIF  147 (387)
T ss_pred             CCCHHHHHHHHH-HHCCCCCEEEEEEEEE---CCCCCHHHHHHHHHCCCEEEE--CCCCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             999899999998-7305783289999971---588516779999877958996--5888986999999998886297799


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             23332222222112467531001222210000123555566543200011122233311211001111001222322222
Q gi|254780301|r  184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGIS  263 (431)
Q Consensus       184 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  263 (431)
                      .|..............+..................................+..+.........................
T Consensus       148 ~h~ed~~l~~~~~~~~g~~~~~~~l~~~P~~aE~~av~r~i~la~~~~~~~hi~HiSt~~~l~~i~~ak~~G~~it~Et~  227 (387)
T PRK08417        148 CRCEDSSFRDSGVMNDGELSFELGLPGIPKLSETKEVAKMIELAKFYKIKVLFDALSLPRSLELIDKARSEGPNVFAEVS  227 (387)
T ss_pred             EECCCHHHHHHHHHHCCCCCHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             90699899740687558633100799898799999999999999972996599972445667778998754872655541


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH-
Q ss_conf             2222223222211100000011122222222222223344311113444545432222343332222222101367888-
Q gi|254780301|r  264 INNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-  342 (431)
Q Consensus       264 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  342 (431)
                      .+...................+.......................+...++...............+.......++... 
T Consensus       228 phhL~l~~~~~~~~~~~~k~~PPLR~~~d~~aLw~~l~~G~Id~iaSDHaP~~~e~K~~~~~~~~~G~~Gve~~lpll~~  307 (387)
T PRK08417        228 IHHLILDDSSCKGFNTAAKLNPPLRSKEDRLALREALKEGKIDFLTSLHSAKSNSKKDVAFDEAAFGIDSLEEYFSLCYT  307 (387)
T ss_pred             HHHHHCCHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             87774799776366885076189989899999999974799888986888999787468720178985649999999999


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEEC
Q ss_conf             67651698999999988151799809999724668726789986989788537785202488656772782288999999
Q gi|254780301|r  343 RLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS  422 (431)
Q Consensus       343 ~~~~~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~  422 (431)
                      .+..++.+|+++++++++.||||+||+++|+|++|++||||||||+++|+++.       +||||+|++++|+|.+||++
T Consensus       308 ~~v~~g~isl~~~v~~~s~nPAki~gl~kG~i~~G~dADlvi~D~~~~~~v~~-------~~sp~eG~~~~G~v~~Ti~r  380 (387)
T PRK08417        308 KLIKSGFINMSELSRFTSKNPAEFLGLNSGVIEVGKEADLVLFDPNKKEIIDD-------KFSLYYGEELYGKIEAVIIK  380 (387)
T ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCEEECC-------CCCCCCCCEEEEEEEEEEEC
T ss_conf             99986998999999999788999959888750899957789992999879799-------87885698988899999999


Q ss_pred             CEEEEEE
Q ss_conf             9999862
Q gi|254780301|r  423 GKQVYTL  429 (431)
Q Consensus       423 G~iVy~~  429 (431)
                      |++||++
T Consensus       381 G~~V~e~  387 (387)
T PRK08417        381 GKLVLEK  387 (387)
T ss_pred             CEEEEEC
T ss_conf             9999879


No 22 
>PRK00369 pyrC dihydroorotase; Provisional
Probab=100.00  E-value=3e-39  Score=270.98  Aligned_cols=372  Identities=21%  Similarity=0.270  Sum_probs=192.2

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEE-ECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHH
Q ss_conf             269964299998888500010899-7999998317865566678877998879889517271411478999831143788
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIV-ENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITT   81 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I-~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~~   81 (431)
                      |++|||...++.  ++.   +|.+ .++||.+|+.+.       .+++|||+|++|+|||||+|+|+++||.+++|++.+
T Consensus         3 ~~~~~~~~~~~~--~~~---~~~~~~~~~i~~~~~~~-------~~~iidAkG~~VlPG~ID~HvH~rePG~~~kEd~~s   70 (393)
T PRK00369          3 DMWIKGKAYLGD--EIA---EICGNFDRRIKEIRFRC-------KPDLDLRRGSLILPGVIDMHVHLRGLKLSYKEDVAS   70 (393)
T ss_pred             CEEEECCCCCCC--CCE---EEEECCEEEHHHHHHCC-------CCCEEECCCCEEECCEEEECCCCCCCCCCCCCCHHH
T ss_conf             189975511088--535---99840003565443026-------765684789988069888044469999876575999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99998707873212454556643331667777677664310122321000134432222222100000112222343332
Q gi|254780301|r   82 LSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMS  161 (431)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (431)
                      +++++..||+|....++...+............ .........+........  ..   ................     
T Consensus        71 gt~AAaaGGvTtv~~mPnt~P~~~~~~~~~~~~-~~~~~~s~vd~~~~~~v~--~~---~~~l~~lg~~g~k~f~-----  139 (393)
T PRK00369         71 ATSEAAYGGITLVADMPNTVPPLNTPEAIKEKL-AELENYSRVDYGVYSGVT--KE---YEEVDKLPIAGYKIYP-----  139 (393)
T ss_pred             HHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHH-HHHCCCCCCCEEEEEECC--CC---HHHHHHCCCCEEEEEC-----
T ss_conf             999998099489998999999989899999999-985648724689994216--74---5557646697599988-----


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             22211012456765421012222333222222211246753100122221000012355556654320001112223331
Q gi|254780301|r  162 IHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI  241 (431)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  241 (431)
                        .........+...........|........      +...      ............  ...  ......+..+...
T Consensus       140 --~d~~~~~~~~~~~~~~~l~~~HaE~~~~~~------~~~~------~~r~~~~E~~ai--~~~--~~~ar~Hi~h~Ss  201 (393)
T PRK00369        140 --EDLEREETKRVLEKSKKLKILHPEIPLALK------GLRR------LRRNCWAEIAAL--ELV--KGAANVHITHASN  201 (393)
T ss_pred             --CCCCHHHHHHHHHHCCCCEEECCCCHHHHH------HHHH------HHCCHHHHHHHH--HHH--HHCCCEEEEECCC
T ss_conf             --888789999999867997099478877763------5255------207458999999--998--6149699993684


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             12110011110012223222222222223222211100000011122222222222223344311113444545432222
Q gi|254780301|r  242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKL  321 (431)
Q Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  321 (431)
                      .......   ....  .......+......    .........+.................  ....+...++.......
T Consensus       202 ~e~ir~A---K~~G--~t~Ev~phhL~l~~----e~~~~~kv~PPLR~~~D~~aL~~~l~d--ID~IaSDHaPh~~eeK~  270 (393)
T PRK00369        202 PETVRIA---KKLG--FTVDITPHHLLVDG----ERDCLSKVNPPIRDYGERLKLLKALFE--VDAVASDHAPHSSWEKW  270 (393)
T ss_pred             HHHHHHH---HHCC--CEEEEEEHHHHCCC----CCCCCCCCCCCCCCHHHHHHHHHHHCC--CCEEEECCCCCCHHHCC
T ss_conf             9999999---8669--90799756840255----356673138998997899999987447--78898178889978815


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEEECHHHHHCC
Q ss_conf             34333222222210136788867651698999999988151799809999724668726789986989788537785202
Q gi|254780301|r  322 LPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSI  401 (431)
Q Consensus       322 ~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~  401 (431)
                      ........+.......++....++.+++||++++++.+|.||||+||+++|+|++|++|||+|||+++ |++..  .+|+
T Consensus       271 ~~f~~ap~Gi~GlEt~lplll~~V~~g~lsl~~lv~l~s~nPAki~GL~kG~i~~G~dADlvi~D~~~-~~~~~--~~Sk  347 (393)
T PRK00369        271 MPFEICPPGIAALSFTPPFIYTLVFKGLLSIERAVSLTSTNPSRILGIPYGEIREGYRANFTVIQLER-WRYST--KYSK  347 (393)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCC-CEECC--CHHC
T ss_conf             65435468704078899999999983889999999999887999959888860799976089993875-56534--2105


Q ss_pred             CCCCCCCCEEEEEEEEEEEECCEEEEEE
Q ss_conf             4886567727822889999999999862
Q gi|254780301|r  402 HKNTVFDKEFFTGKVVRTYISGKQVYTL  429 (431)
Q Consensus       402 ~~~tp~~g~~~~g~V~~tiv~G~iVy~~  429 (431)
                      ++||||+|++++|+|.+||++|++||+.
T Consensus       348 ~~~tPfeG~~l~G~v~~TivrG~vV~~d  375 (393)
T PRK00369        348 VIETPLDGFSLDAAVYATIVEGKIAYLE  375 (393)
T ss_pred             CCCCCCCCCEEEEEEEEEEECCEEEEEC
T ss_conf             8988867968877899999999999999


No 23 
>cd01297 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics.
Probab=100.00  E-value=1.2e-38  Score=267.19  Aligned_cols=69  Identities=23%  Similarity=0.314  Sum_probs=59.3

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCC
Q ss_conf             2699642999988885000108997999998317865566678877998879889517271411478999831
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEY   75 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~   75 (431)
                      |||||||+|+|+.+...+.+||+|+||||++||+...    ++++++|||+|++|+|||||+|+|+..+....
T Consensus         1 DllIkna~i~d~~~~~~~~~DI~I~dgkI~~Ig~~~~----~~~~~vIDa~G~~v~PG~ID~H~H~~~~~~~~   69 (415)
T cd01297           1 DLVIRNGTVVDGTGAPPFTADVGIRDGRIAAIGPILS----TSAREVIDAAGLVVAPGFIDVHTHYDGQVFWD   69 (415)
T ss_pred             CEEEECCEEECCCCCCEEEEEEEEECCEEEEECCCCC----CCCCEEEECCCCEEECCHHHHHCCCCCCCCCC
T ss_conf             9899691998999993577799999999999688899----99997998999999558405646987534578


No 24 
>cd01317 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis. This subgroup also contains proteins that lack the active site, like unc-33, a C.elegans protein involved in axon growth.
Probab=100.00  E-value=4.8e-38  Score=263.23  Aligned_cols=373  Identities=38%  Similarity=0.585  Sum_probs=164.8

Q ss_pred             CCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             87799887988951727141147899983114378899998707873212454556643331667777677664310122
Q gi|254780301|r   46 SALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN  125 (431)
Q Consensus        46 ~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  125 (431)
                      +++||||+|++|+|||||+|+|+..++.+.++++.++++++..||++....+....+............. .........
T Consensus         1 ~~~vIDA~G~~v~PG~ID~H~H~~~pg~~~~e~~~t~t~aA~~GGvTtii~~p~~~p~~~~~~~~~~~~~-~~~~~~~~~   79 (374)
T cd01317           1 DAEVIDAEGKILAPGLVDLHVHLREPGFEYKETLESGAKAAAAGGFTTVVCMPNTNPVIDNPAVVELLKN-RAKDVGIVR   79 (374)
T ss_pred             CCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHHHHHHHHCCEEEEEECCCCCCCCCCHHHHHHHHH-HCCCCCCCC
T ss_conf             9879988999991486854503599997651449999999983995899978899999897999999999-703458830


Q ss_pred             CCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             32100013443222222210000011222234333222211012456765421012222333222222211246753100
Q gi|254780301|r  126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANY  205 (431)
Q Consensus       126 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  205 (431)
                      .............................................+.+...........|..............+.....
T Consensus        80 ~~~~~~~~~~~~~~~l~~~~~l~~~G~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~H~Ed~~~~~~~~~~~~~~~~~  159 (374)
T cd01317          80 VLPIGALTKGLKGEELTEIGELLEAGAVGFSDDGKPIQDAELLRRALEYAAMLDLPIIVHPEDPSLAGGGVMNEGKVASR  159 (374)
T ss_pred             EEEEEEEECCCCHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCCHHH
T ss_conf             47899845486332556578898608546734996345799999999988754985999379867865466505863152


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             12222100001235555665432000111222333112110011110012223222222222223222211100000011
Q gi|254780301|r  206 LGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLP  285 (431)
Q Consensus       206 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  285 (431)
                      .............................+..+..............................................+
T Consensus       160 ~~~~~~p~~~E~~ai~~~~~la~~~g~~vhi~Hiss~~~l~li~~ar~~G~~vt~e~~p~~L~~~~~~~~~~~~~~k~~P  239 (374)
T cd01317         160 LGLPGIPPEAETIMVARDLELAEATGARVHFQHLSTARSLELIRKAKAKGLPVTAEVTPHHLLLDDEALESYDTNAKVNP  239 (374)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECHHHHCCCHHHHHCCCCCCCCCC
T ss_conf             08999999999999999999999729848973435588999999998748977999725653588878606676524689


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH-HHHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             1222222222222233443111134445454322223433322222221013678-886765169899999998815179
Q gi|254780301|r  286 PLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSA-ALRLFHGQQISLKKLIRALSTRPA  364 (431)
Q Consensus       286 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~gls~~eal~~aT~npA  364 (431)
                      .......................+...+........................... ....+.++.+|++++++.+|.|||
T Consensus       240 Plr~~~d~~~L~~~l~~g~id~i~sDH~p~~~~~k~~~~~~a~~G~~g~e~~lp~l~~~~v~~~~lsle~~v~~~s~nPA  319 (374)
T cd01317         240 PLRSEEDREALIEALKDGTIDAIASDHAPHTDEEKDLPFAEAPPGIIGLETALPLLWTLLVKGGLLTLPDLIRALSTNPA  319 (374)
T ss_pred             CCCCHHHHHHHHHHHHCCCCEEEEECCCCCCHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             87855679999999973993499968988887774577654776786500469999999998599999999999979999


Q ss_pred             HHCCCCCCEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEE
Q ss_conf             9809999724668726789986989788537785202488656772782288999
Q gi|254780301|r  365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT  419 (431)
Q Consensus       365 ~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~t  419 (431)
                      |+||+++|+|++|++||||||||+++|+|+.++++|+++||||+|++++|+|.+|
T Consensus       320 k~lgl~~G~i~~G~dADlvi~Dp~~~~~v~~~~~~s~~~~sp~eG~~~~G~v~~T  374 (374)
T cd01317         320 KILGLPPGRLEVGAPADLVLFDPDAEWIVDEETFRSKSKNTPFDGQKLKGRVLAT  374 (374)
T ss_pred             HHHCCCCCCCCCCCCCCEEEEECCCCEEECHHHCCCCCCCCCCCCCEEEEEEEEC
T ss_conf             9969996864799847889995999889883557175886784598887899679


No 25 
>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid. Formation of this bond is a spontaneous nonenzymatic reaction in nature and can profoundly effect the function of the protein. Isoaspartyl dipeptidase is an octameric enzyme that contains a binuclear zinc center in the active site of each subunit and shows a strong preference of hydrolyzing Asp-Leu dipeptides.
Probab=100.00  E-value=5.1e-37  Score=256.59  Aligned_cols=98  Identities=20%  Similarity=0.262  Sum_probs=71.6

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCC---CCC
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899983---114
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDE---YSK   77 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~---~~~   77 (431)
                      |+  |||||+||++..  ..++||+|+||||++|+++... ...++++|||++|+||+|||||+|+|+++++..   ..+
T Consensus         1 ~~--LIKng~v~~~~~--~~~~DVlI~~GkI~~I~~~~~~-~~~~~~evIDa~G~~v~PG~ID~HvH~~~~g~~~~~~~~   75 (387)
T cd01308           1 FT--LIKNAEVYAPEY--LGKKDILIAGGKILAIEDQLNL-PGYENVTVVDLHGKILVPGFIDQHVHIIGGGGEGGPSTR   75 (387)
T ss_pred             CE--EEECCEEECCCC--CCCCCEEEECCEEEEECCCCCC-CCCCCCEEEECCCCEECCCEEEECCCCCCCCCCCCCCCC
T ss_conf             96--997969988987--6354489989999994388888-888998899899999885875512266688888775557


Q ss_pred             CHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             37889999870787321245455664
Q gi|254780301|r   78 NITTLSKEAVAGGITSIILMPLGMSS  103 (431)
Q Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~~~~~  103 (431)
                      +.+.....+..+|++.........+.
T Consensus        76 ~~~~~~~~~~~~G~Tt~~~~~~t~~~  101 (387)
T cd01308          76 TPEVTLSDLTTAGVTTVVGCLGTDGI  101 (387)
T ss_pred             CHHHHHHHHHHCCCEEEECCCCCCCC
T ss_conf             88999999997795189705788864


No 26 
>PRK10657 isoaspartyl dipeptidase; Provisional
Probab=100.00  E-value=1.3e-35  Score=247.62  Aligned_cols=95  Identities=23%  Similarity=0.345  Sum_probs=71.0

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCC---CC
Q ss_conf             962699642999988885000108997999998317865566678877998879889517271411478999831---14
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEY---SK   77 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~---~~   77 (431)
                      |+ +|||||+|+++.+  ...+||+|+||||++||++.. .+.+++++||||+|++|+|||||+|+|+.+++...   ..
T Consensus         1 M~-tlIkNg~Vv~~~~--~~~~DI~I~dgkI~~Ig~~~~-~~~~~~~~vIDa~G~~v~PG~ID~H~Hi~~~gg~~~~~~~   76 (384)
T PRK10657          1 MF-TLLKNAHVYAPED--LGKKDILIANGKIIAIADNIN-LDIVPDVEVIDLSGKILVPGFIDQHVHIIGGGGEGGFTTR   76 (384)
T ss_pred             CC-EEEECCEEECCCC--EEECCEEEECCEEEEECCCCC-CCCCCCCEEEECCCCEEECCHHHHHCCCCCCCCCCCCCCC
T ss_conf             96-8997949988987--165468998999999568888-8778999899899999914610042498888888776668


Q ss_pred             CHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             3788999987078732124545
Q gi|254780301|r   78 NITTLSKEAVAGGITSIILMPL   99 (431)
Q Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~   99 (431)
                      +.+...+.+..+|++.......
T Consensus        77 ~pe~~~~~~~~~GvTTv~~~~~   98 (384)
T PRK10657         77 TPEVQLSDLTEAGITTVVGLLG   98 (384)
T ss_pred             CCHHHHHHHHHCCCCEEECCCC
T ss_conf             9069999999759756945778


No 27 
>PRK06038 N-ethylammeline chlorohydrolase; Provisional
Probab=100.00  E-value=6e-37  Score=256.16  Aligned_cols=66  Identities=18%  Similarity=0.380  Sum_probs=58.2

Q ss_pred             CCCEEEECCEEECC--CCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCC
Q ss_conf             96269964299998--88850001089979999983178655666788779988798895172714114789
Q gi|254780301|r    1 MTSFVLNNTRIIDP--SRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG   70 (431)
Q Consensus         1 M~~llI~n~~iid~--~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~   70 (431)
                      |+|+|||||+|++.  ..+++++++|+|+||||++||+...    +++++|||++|++|+|||||+|+|+..
T Consensus         1 m~~ilI~na~V~T~d~~~~~i~~g~VlIe~g~I~~VG~~~~----~~~~~vIDa~G~~v~PGlIdaH~H~~~   68 (432)
T PRK06038          1 MADIIIKNAYVLTMDPDAGDIKNGSVVIEDGKITEISETTS----EDADTVIDATGKVVMPGLVNTHTHAAM   68 (432)
T ss_pred             CCCEEEECCEEEEECCCCCEECCCEEEEECCEEEEECCCCC----CCCCEEEECCCCEEEECHHHHHHCHHH
T ss_conf             97389979999997799997838189999999999799998----898989968999997571205458777


No 28 
>cd01298 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases. Atrazine, a chlorinated herbizide, can be catabolized by a variety of different bacteria. The first three steps of the atrazine dehalogenation pathway are catalyzed by atrazine chlorohydrolase (AtzA), hydroxyatrazine ethylaminohydrolase (AtzB), and N-isopropylammelide N-isopropylaminohydrolase (AtzC). All three enzymes belong to the superfamily of metal dependent hydrolases. AtzA and AtzB, beside other related enzymes are represented in this CD.
Probab=100.00  E-value=1.6e-36  Score=253.35  Aligned_cols=81  Identities=21%  Similarity=0.231  Sum_probs=64.0

Q ss_pred             HHHCCCCCHHHHHHHHHHHHHHHCCCCC-CEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEEC
Q ss_conf             7651698999999988151799809999-724668726789986989788537785202488656772782288999999
Q gi|254780301|r  344 LFHGQQISLKKLIRALSTRPAQIFNLPG-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS  422 (431)
Q Consensus       344 ~~~~~gls~~eal~~aT~npA~~lgl~~-G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~  422 (431)
                      .....+||++|+|+++|.||||+||+++ |+|++||+|||||||+|.+.....++.++...|.   .  .++.|++||++
T Consensus       326 ~~~~~~~s~~eal~~~T~n~A~~lgl~~~GsI~~Gk~ADlvi~D~d~~~~~~~~~~~~~~~~~---~--~~~~i~~v~~~  400 (411)
T cd01298         326 HGDPTALPAEEALEMATIGGAKALGLDEIGSLEVGKKADLILIDLDGPHLLPVHDPISHLVYS---A--NGGDVDTVIVN  400 (411)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCHHHHHHCC---C--CCCCCCEEEEC
T ss_conf             267778999999999999999994989975169998268899979997657866979997702---8--99983499999


Q ss_pred             CEEEEEE
Q ss_conf             9999862
Q gi|254780301|r  423 GKQVYTL  429 (431)
Q Consensus       423 G~iVy~~  429 (431)
                      ||+||+.
T Consensus       401 g~~v~~~  407 (411)
T cd01298         401 GRVVMED  407 (411)
T ss_pred             CEEEEEC
T ss_conf             9999999


No 29 
>cd01318 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis. This group contains the archeal members of the DHOase family.
Probab=100.00  E-value=7.4e-36  Score=249.10  Aligned_cols=360  Identities=26%  Similarity=0.344  Sum_probs=178.7

Q ss_pred             CCEEECCEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECC
Q ss_conf             98895172714114789998311437889999870787321245455664333166777767766431012232100013
Q gi|254780301|r   54 GLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLT  133 (431)
Q Consensus        54 G~~v~PGlID~H~Hl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  133 (431)
                      |++|+|||||+|+|+++||.+++|++.++++++..||++....++...+............ .........+........
T Consensus         1 G~~v~PG~ID~hvH~r~pg~~~~e~~~s~s~AA~aGGvTtv~~mPnt~p~~~~~~~~~~~~-~~a~~~~~vd~~~~~~~t   79 (361)
T cd01318           1 GLLILPGVIDIHVHFREPGLTYKEDFVSGSRAAAAGGVTTVMDMPNTKPPTTTAEALYEKL-RLAAAKSVVDYGLYFGVT   79 (361)
T ss_pred             CCEEECCEEECCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHH-HHHCCCCCEEEEEEEEEC
T ss_conf             9898368487241469999775150999999998489538998999989989999999999-973558810488886204


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             44322222221000001122223433322221101245676542101222233322222221124675310012222100
Q gi|254780301|r  134 SNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPS  213 (431)
Q Consensus       134 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  213 (431)
                      ....   .................... ...........+...........|.................  .........
T Consensus        80 ~~~~---~~~l~~~g~~~~k~f~~~~~-~~~~~~~~~l~~~~~~~~~~v~~H~Ed~~~~~~~~~~~~~~--~~~~~~~p~  153 (361)
T cd01318          80 GSED---LEELDKAPPAGYKIFMGDST-GDLLDDEETLERIFAEGSVLVTFHAEDEDRLRENRKELKGE--SAHPRIRDA  153 (361)
T ss_pred             CCCH---HHHHHHHHHCCEEEEEECCC-CCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHCCHHCCCCC--CCCCCCCCH
T ss_conf             7514---89999734164458860578-75102399999999707995999268988884301033431--235678989


Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             00123555566543200011122233311211001111001222322222222222322221110000001112222222
Q gi|254780301|r  214 ISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETER  293 (431)
Q Consensus       214 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  293 (431)
                      .....................+..+...............   ........+...................+........
T Consensus       154 ~aE~~av~r~l~la~~~g~~~hi~hvSt~~~l~~i~~a~~---~vt~et~ph~L~l~~~~~~~~~~~~k~~PPLR~~~dr  230 (361)
T cd01318         154 EAAAVATARALKLARRHGARLHICHVSTPEELKLIKKAKP---GVTVEVTPHHLFLDVEDYDRLGTLGKVNPPLRSREDR  230 (361)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCC---CCEEEECHHHHCCCHHHHCCCCCCEEECCCCCCHHHH
T ss_conf             9999999999999998599689994088999999997599---9658852365427813431568716635998977899


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC-CC
Q ss_conf             22222233443111134445454322223433322222221013678886765169899999998815179980999-97
Q gi|254780301|r  294 MSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP-GG  372 (431)
Q Consensus       294 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~-~G  372 (431)
                      ...............+...++...............+.......+.....++.++++|++++++.+|.||||+||+. +|
T Consensus       231 ~aL~~~l~~G~Id~i~SDH~P~~~~~K~~~f~~a~~Gi~g~e~~l~l~~~lv~~g~l~l~~~v~~~s~nPAki~gl~~kG  310 (361)
T cd01318         231 KALLQALADGRIDVIASDHAPHTLEEKRKGYPAAPSGIPGVETALPLMLTLVNKGILSLSRVVRLTSHNPARIFGIKNKG  310 (361)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHCCCCCCCCCCCEEHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999986599649972898889898368977577875109889999999987288149999999968899994989888


Q ss_pred             EECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEECC
Q ss_conf             246687267899869897885377852024886567727822889999999
Q gi|254780301|r  373 TLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG  423 (431)
Q Consensus       373 ~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G  423 (431)
                      +|++|++||||||||+.+|+|+.++++|+++||||+|++++|+|.+||++|
T Consensus       311 ~i~~G~dADlvl~Dp~~~~~v~~~~~~s~~~~sp~~G~~l~G~v~~ti~~G  361 (361)
T cd01318         311 RIAEGYDADLTVVDLKEERTIRAEEFHSKAGWTPFEGFEVTGFPVMTIVRG  361 (361)
T ss_pred             CCCCCCCCCEEEEECCCCEEECHHHCCCCCCCCCCCCCEEEEEEEEEEECC
T ss_conf             578899377899949997898825463758867837988888999999086


No 30 
>PRK08204 hypothetical protein; Provisional
Probab=100.00  E-value=5.5e-37  Score=256.40  Aligned_cols=67  Identities=22%  Similarity=0.341  Sum_probs=59.1

Q ss_pred             CCCEEEECCEEEC--CCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             9626996429999--8888500010899799999831786556667887799887988951727141147899
Q gi|254780301|r    1 MTSFVLNNTRIID--PSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         1 M~~llI~n~~iid--~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      |+++||+||+|++  +..+++++++|+|+||||++||+...    .+++++||++|++|+|||||+|+|+...
T Consensus         1 M~r~Li~~g~V~T~d~~~~~i~~g~VlI~~grI~~VG~~~~----~~~a~vID~~G~~vlPGlIDaH~H~~~~   69 (451)
T PRK08204          1 MKRTLIRGGTVLTMDPALGDLPKGDILIEGDRIAAVAPSID----APDAEIVDARGMIVMPGFVDTHRHTWQS   69 (451)
T ss_pred             CCCEEEECCEEEEECCCCCEECCCEEEEECCEEEEECCCCC----CCCCEEEECCCCEEEECHHHHHHCHHHH
T ss_conf             97589989899997799888778289999999999679999----9999899699998844368488686536


No 31 
>KOG2584 consensus
Probab=100.00  E-value=2e-36  Score=252.79  Aligned_cols=424  Identities=19%  Similarity=0.151  Sum_probs=217.3

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC--CCCCCCCHH
Q ss_conf             269964299998888500010899799999831786556667887799887988951727141147899--983114378
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS--PDEYSKNIT   80 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~--~~~~~~~~~   80 (431)
                      .++|||++|++.+..+  .+||+++||.|.+||+++   ..|.+.++||++|++|+||.||+|+|+..|  |.+.++|+.
T Consensus        15 rllikgg~vvN~d~~~--~aDV~vedGiI~~vg~~l---~ipgg~~~ida~g~~ViPGgID~Hthlq~p~~G~ts~DdF~   89 (522)
T KOG2584          15 RLLIKGGRVVNDDQSF--KADVYVEDGIIKEVGENL---IIPGGVKVIDATGKMVIPGGIDPHTHLQMPFMGMTSVDDFF   89 (522)
T ss_pred             CEEEECCEEECCCCCE--EEEEEECCCEEEEECCCE---ECCCCCEEEECCCCEEECCCCCCCCEECCCCCCCCCHHHHH
T ss_conf             3163087897368743--654773167788724617---74898168744776773586575210146557840223430


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCC--CCCCCCCCCCCCCCCCCCC-
Q ss_conf             8999987078732124545566433316677776776643101223210001344322--2222210000011222234-
Q gi|254780301|r   81 TLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEG--KEISEMRLLQEQGIVSFIQ-  157 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~-  157 (431)
                      .+++++.+||++...++.........................................  .............+..... 
T Consensus        90 ~GTkAAlaGGtTmiID~vlp~~~~slv~afe~wr~~Ad~k~cCDyglhv~It~W~~~v~eem~~l~~ekGvnsF~~fmay  169 (522)
T KOG2584          90 QGTKAALAGGTTMIIDFVLPDKGTSLVEAFEKWREWADPKVCCDYGLHVGITWWSPSVKEEMEILVKEKGVNSFKFFMAY  169 (522)
T ss_pred             CCCHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEEEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEEE
T ss_conf             22077763883599977548997308999999886227852554214676542574348899887654275327766320


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             3332222110124567654210122223332222222112---4675310012222100001235555665432000111
Q gi|254780301|r  158 SPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVI---NEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHY  234 (431)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  234 (431)
                      .............+.............|............   ..+..................................
T Consensus       170 k~~~~v~d~~lye~l~~~~~lgala~vHAEngd~iae~q~~~l~~gitgPEgh~lSRPee~EaEA~~rai~ia~~~ncPl  249 (522)
T KOG2584         170 KDLYMVRDSELYEALKVCAELGALAMVHAENGDAIAEGQQRLLELGITGPEGHELSRPEELEAEATNRAITIARQANCPL  249 (522)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCHHHEEHHHCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             55424478999999999864164313121164055543357887178686644335844666789999999988628982


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22233311211001111001222322222222----2223222211100000011122-222222222223344311113
Q gi|254780301|r  235 HASVISIPQSIALIKHAKAHNTKATCGISINN----LILNENDVEMYNSLRKVLPPLR-SETERMSMVEALEKGDIDIIV  309 (431)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~  309 (431)
                      ...+............................    ..................+... ....................+
T Consensus       250 yvvhVmsksaa~~Ia~aRk~g~~v~gepita~l~~dg~hy~~~~w~~Aa~~v~sPPlr~d~~t~~~L~~lLa~g~L~~tg  329 (522)
T KOG2584         250 YVVHVMSKSAADAIALARKKGRVVFGEPITASLGTDGSHYWSKDWDHAAAFVTSPPLRPDPTTPDGLMDLLAEGDLQLTG  329 (522)
T ss_pred             CEEEEEEHHHHHHHHHHHHCCCEEECCCCHHHHCCCCHHHCCCCHHHCCEEEECCCCCCCCCCHHHHHHHHHCCCCCEEE
T ss_conf             05888526378899998743846613410465446634323578102013545799888998878999998548420030


Q ss_pred             CCCCCCCCCCCCC----CCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCC--CCCEECCCCCCCEE
Q ss_conf             4445454322223----43332222222101367888676516989999999881517998099--99724668726789
Q gi|254780301|r  310 SDHTPRHMDTKLL----PFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNL--PGGTLQTGTAADIA  383 (431)
Q Consensus       310 ~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl--~~G~I~~Gk~ADlv  383 (431)
                      ...+..+......    +.............+...+...+..+.|++.+.+...+.|.||+|++  .+|+|++|.+||||
T Consensus       330 Sdhctf~~~qKalgKddFt~ip~GvnGvedrMsviwekgv~~G~md~~~fVavtstnaAkifnlYprKGrIavGsDADiV  409 (522)
T KOG2584         330 SDHCTFTTEQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIV  409 (522)
T ss_pred             CCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCEEEEEHHCCCCCCCCCCEEEEECCCCHHHEECCCCCCEECCCCCCCEE
T ss_conf             27877777887426676130877645420163233320002375673417999526634333405767503106877679


Q ss_pred             EECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEECC
Q ss_conf             986989788537785202488656772782288999999999986249
Q gi|254780301|r  384 LIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLES  431 (431)
Q Consensus       384 i~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~e~  431 (431)
                      ||||+..++|+.++.+++++++.|+|++++|.|+-||.+||+||+..+
T Consensus       410 Iwdp~at~tIS~~th~~~~d~NifEGm~~~G~plvtIsrGriv~eng~  457 (522)
T KOG2584         410 IWDPNATKTISAKTHHSANDFNIFEGMTVHGVPLVTISRGRVVYENGN  457 (522)
T ss_pred             EECCCCCEEECCCCCCCCCCCEEECCCEECCEEEEEEECCEEEEECCC
T ss_conf             987875468620010014443000585762605899957808985483


No 32 
>PRK07228 N-ethylammeline chlorohydrolase; Provisional
Probab=100.00  E-value=8.8e-37  Score=255.05  Aligned_cols=67  Identities=25%  Similarity=0.405  Sum_probs=57.1

Q ss_pred             CCCEEEECCEEECCCC-CEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             9626996429999888-8500010899799999831786556667887799887988951727141147899
Q gi|254780301|r    1 MTSFVLNNTRIIDPSR-DIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         1 M~~llI~n~~iid~~~-~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      |+ +|||||+|++.+. ..+.+++|+|+||||++||+...   .+++++|||++|++|+|||||+|+|+..+
T Consensus         1 m~-ilIkng~vvT~d~~~~i~~g~VlIe~grI~~VG~~~~---~~~~~~vIDa~g~~v~PGlIdaH~H~~~~   68 (445)
T PRK07228          1 MT-ILIKNGTIVTMNAKREILDGDVLIEDDRIAAVGSRLD---LEGADDVIDATGKVVIPGLIQGHIHLCQT   68 (445)
T ss_pred             CE-EEEECCEEEEECCCCEECCEEEEEECCEEEEECCCCC---CCCCCEEEECCCCEEEECHHHHHHCHHHH
T ss_conf             91-9998989998589977816289999999999768987---78899589689999974535087695304


No 33 
>PRK09237 dihydroorotase; Provisional
Probab=100.00  E-value=1.3e-34  Score=241.09  Aligned_cols=91  Identities=25%  Similarity=0.442  Sum_probs=74.2

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHH
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899983114378
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNIT   80 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~   80 (431)
                      |.|||||||+|+|+.+.....+||+|+||||++||++..   .+++.++|||+|++|+|||||+|+|+..++..+.++  
T Consensus         2 ~~DLlIkNg~Vvd~~~~~~~~~DV~I~dGkI~aIg~~~~---~~~a~evIDa~G~~V~PG~ID~HvH~~~~~~~~~~~--   76 (384)
T PRK09237          2 MFDLLLRGGRVVDPANGIDALTDIAIQDGKIAAVGPAIA---ASAAVKVIDLSGKYVSPGWIDLHVHVYPGSTIYGDE--   76 (384)
T ss_pred             CCEEEEECCEEECCCCCEECCEEEEEECCEEEEECCCCC---CCCCCEEEECCCCEECCCEEEECCCCCCCCCCCCCC--
T ss_conf             730999792998789886321489998999999568899---889987998999997768827233888888766768--


Q ss_pred             HHHHHHHCCCCCCCCCC
Q ss_conf             89999870787321245
Q gi|254780301|r   81 TLSKEAVAGGITSIILM   97 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~~   97 (431)
                       ..+.+..+|++...+.
T Consensus        77 -~~~~a~~~GvTTvvd~   92 (384)
T PRK09237         77 -PDEVGVKSGVTTVVDA   92 (384)
T ss_pred             -HHHHHHHCCCCEEEEC
T ss_conf             -6687875585178606


No 34 
>PRK09061 D-glutamate deacylase; Validated
Probab=100.00  E-value=1.8e-34  Score=240.23  Aligned_cols=66  Identities=30%  Similarity=0.488  Sum_probs=58.1

Q ss_pred             CCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCC
Q ss_conf             62699642999988885000108997999998317865566678877998879889517271411478999
Q gi|254780301|r    2 TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSP   72 (431)
Q Consensus         2 ~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~   72 (431)
                      .|+|||||+||||++.....+||+|+||||++||+..     .++.++|||+|++|+|||||+|+|...++
T Consensus         4 yDllIknG~VVdg~g~~~~~~DV~I~dGkI~aIg~~~-----~~a~~~IDA~G~~V~PGfID~HtH~~~~~   69 (496)
T PRK09061          4 YDLVIRNGRVVDPETGLDAIRNVGIKGGKIAAVSTAA-----IGGDRTIDATGLVVAPGFIDLHAHGQSLP   69 (496)
T ss_pred             CCEEEECEEEECCCCCCCCEEEEEEECCEEEEECCCC-----CCCCEEEECCCCEECCCCEEEEECCCCCC
T ss_conf             7889979299889989774758999899999936899-----99993898999998644004210689997


No 35 
>PRK08203 hydroxydechloroatrazine ethylaminohydrolase; Reviewed
Probab=100.00  E-value=1.8e-35  Score=246.68  Aligned_cols=70  Identities=24%  Similarity=0.429  Sum_probs=60.3

Q ss_pred             CCCEEEECCE-EE--CCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             9626996429-99--98888500010899799999831786556667887799887988951727141147899
Q gi|254780301|r    1 MTSFVLNNTR-II--DPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         1 M~~llI~n~~-ii--d~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      |+++|||||. |+  |+...++++|+|+|+||||++||+.... ...++++|||++|++|||||||+|+|+...
T Consensus         3 m~~~li~na~~vvT~D~~~~vi~~g~VlI~dgrI~~VG~~~~~-~~~~~~~viD~~g~~v~PGlVdaH~Hl~~~   75 (456)
T PRK08203          3 MTTLWIKNPLAIVTMDAARREIADGGLVVEDGRIVEVGPAGAL-PAAPADEVFDARGHVVTPGLVNTHHHFYQT   75 (456)
T ss_pred             CCCEEEECCCEEEEECCCCCEECCEEEEEECCEEEEECCCCCC-CCCCCCEEEECCCCEEEECCCCHHHCCCHH
T ss_conf             0153400898999858999877781899989999996787556-668999799689989964721086592002


No 36 
>cd00854 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate. This is the first committed step in the biosynthetic pathway to amino-sugar-nucleotides, which is needed for cell wall peptidoglycan and teichoic acid biosynthesis. Deacetylation of N-acetylglucosamine is also important in lipopolysaccharide synthesis and cell wall recycling.
Probab=100.00  E-value=1.2e-33  Score=234.98  Aligned_cols=88  Identities=31%  Similarity=0.510  Sum_probs=69.5

Q ss_pred             EEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCC---CCCCHH
Q ss_conf             69964299998888500010899799999831786556667887799887988951727141147899983---114378
Q gi|254780301|r    4 FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDE---YSKNIT   80 (431)
Q Consensus         4 llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~---~~~~~~   80 (431)
                      ||||||+|||+.+  ++++||+|+||||++||++.   ..+++++||||+|++|+|||||+|+|..++...   ..+.+.
T Consensus         1 llIkng~Vv~~~~--i~~~dV~I~dGkI~aIg~~~---~~~~~~~vIDa~G~~v~PGlID~H~H~~~g~~~~~~~~~~~~   75 (374)
T cd00854           1 LIIKNARILTPGG--LEDGAVLVEDGKIVAIGPED---ELEEADEIIDLKGQYLVPGFIDIHIHGGGGADFMDGTAEALK   75 (374)
T ss_pred             CEEECEEEECCCC--EEEEEEEEECCEEEEEECCC---CCCCCCEEEECCCCEEECCCCEECCCCCCCCCCCCCCHHHHH
T ss_conf             9897949987990--78638999899999972888---899999799899999988900100179988887778999999


Q ss_pred             HHHHHHHCCCCCCCCC
Q ss_conf             8999987078732124
Q gi|254780301|r   81 TLSKEAVAGGITSIIL   96 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~   96 (431)
                      +..+.+..+|++....
T Consensus        76 ~~~~~~~~~GvTt~~~   91 (374)
T cd00854          76 TIAEALAKHGTTSFLP   91 (374)
T ss_pred             HHHHHHHHCCCEEEEE
T ss_conf             9999999649459961


No 37 
>PRK06687 chlorohydrolase; Validated
Probab=100.00  E-value=2.5e-34  Score=239.26  Aligned_cols=69  Identities=23%  Similarity=0.299  Sum_probs=59.1

Q ss_pred             CEEEECCEEEC--CCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCC
Q ss_conf             26996429999--88885000108997999998317865566678877998879889517271411478999
Q gi|254780301|r    3 SFVLNNTRIID--PSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSP   72 (431)
Q Consensus         3 ~llI~n~~iid--~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~   72 (431)
                      +++++||+|++  +..+++++|+|+|+||||++||+.. ....++++++||++|++|+|||||+|+|+....
T Consensus         1 ~t~f~na~iiT~d~~~~vi~~g~v~V~~g~I~~VG~~~-~~~~~~~~~viD~~g~~v~PGlVnaH~Hl~~~~   71 (422)
T PRK06687          1 KTTYVNATIVTMNEQNEVIENGYIIVEDDQIIDVGSGE-FASDFEVDEVIDMKGKWVLPGLVNTHTHVVMSL   71 (422)
T ss_pred             CEEEECCEEEEECCCCCEECCCEEEEECCEEEEECCCC-CCCCCCCCEEEECCCCEEEECCCCHHHCHHHHH
T ss_conf             96788989998889998883808999899999974853-124678983897899889548507755875562


No 38 
>PRK12393 amidohydrolase; Provisional
Probab=100.00  E-value=4.6e-35  Score=243.98  Aligned_cols=68  Identities=26%  Similarity=0.278  Sum_probs=56.5

Q ss_pred             CCCEEEECCEEEC--CCCCE--EEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             9626996429999--88885--00010899799999831786556667887799887988951727141147899
Q gi|254780301|r    1 MTSFVLNNTRIID--PSRDI--DEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         1 M~~llI~n~~iid--~~~~~--~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      |.++|||||.+|+  ..++.  ++++||+|+||||++||+..   ..+++++|||++|++|+|||||+|+|+.+.
T Consensus         1 m~~iLi~na~~i~~~~~~~~~~~~~~dv~I~~~rI~~Vg~~~---~~~~~~~viD~~g~lv~PG~VnaH~H~~~~   72 (459)
T PRK12393          1 MPSLLIRNAAAIMTGRRGDAARLGGADIRIRDGRIAAIGAAL---TPLPGERVIDATDCVVYPGWVNTHHHLFQS   72 (459)
T ss_pred             CCCEEEECCCEEEECCCCCEEEECCCEEEEECCEEEEECCCC---CCCCCCEEEECCCCEEECCCCCHHHCHHHH
T ss_conf             973557678699934998746617976999899999968999---899999799799988920762241273237


No 39 
>PRK08393 N-ethylammeline chlorohydrolase; Provisional
Probab=100.00  E-value=1.2e-34  Score=241.37  Aligned_cols=63  Identities=16%  Similarity=0.258  Sum_probs=54.9

Q ss_pred             EEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCC
Q ss_conf             6996429999888850001089979999983178655666788779988798895172714114789
Q gi|254780301|r    4 FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG   70 (431)
Q Consensus         4 llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~   70 (431)
                      ||||||+|++++.....++||+|+||||++||++..    .++++|||++|++|+|||||+|+|+..
T Consensus         1 iLikng~Vv~~d~~~~~~~dVlIe~g~I~~Vg~~~~----~~a~~vIDa~g~iv~PGlIn~H~H~~~   63 (419)
T PRK08393          1 ILIKNGMVIYGENLTVVRADVLIESNKIVEVKRNIN----KPADTVIDASGSLVIPGFINAHTHSPM   63 (419)
T ss_pred             CEEECCEEEECCCCCEECCCEEEECCEEEEEECCCC----CCCCEEEECCCCEEECCCCCHHHCHHH
T ss_conf             989686999889985501439999999999708899----998979978999996081007558666


No 40 
>PRK09045 N-ethylammeline chlorohydrolase; Provisional
Probab=100.00  E-value=2.1e-34  Score=239.72  Aligned_cols=69  Identities=20%  Similarity=0.256  Sum_probs=61.2

Q ss_pred             CEEEECCEEE--CCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             2699642999--98888500010899799999831786556667887799887988951727141147899
Q gi|254780301|r    3 SFVLNNTRII--DPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         3 ~llI~n~~ii--d~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      |+||+|+.|+  |+.+.++++++|+|+||||++|||.......+++++|||++|++|+|||||+|+|+...
T Consensus         9 d~li~~~~VvT~d~~~~vi~dg~vlV~dgrI~aVGp~~~~~~~~~~~~vID~~g~iv~PGlVd~H~H~~~~   79 (444)
T PRK09045          9 DLLIEARWIVPVEPAGVVLEDHAVAVRDGRIVAILPRAEARARYAADETVELPDHVLIPGLVNAHTHAAMS   79 (444)
T ss_pred             EEEEECCEEEEECCCCCEEECCEEEEECCEEEEECCHHHHHHCCCCCCEEECCCCEEEECHHHHHHCHHHH
T ss_conf             09998999999779998870858999899999983624430218998599889949964241396697877


No 41 
>PRK06151 N-ethylammeline chlorohydrolase; Provisional
Probab=100.00  E-value=2.5e-34  Score=239.23  Aligned_cols=78  Identities=21%  Similarity=0.150  Sum_probs=60.0

Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCC-CEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEECCEE
Q ss_conf             1698999999988151799809999-724668726789986989788537785202488656772782288999999999
Q gi|254780301|r  347 GQQISLKKLIRALSTRPAQIFNLPG-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ  425 (431)
Q Consensus       347 ~~gls~~eal~~aT~npA~~lgl~~-G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~i  425 (431)
                      ...++++++|+|+|+++||+||+++ ||||+||+||||+||.+.+......+..+...++.   .  .+.|++||||||+
T Consensus       353 ~~~~~~~~~l~mAT~~GArALg~~diGsLe~Gk~ADlvi~d~~~~~~~P~~dp~~~lV~~a---~--~~~V~~V~VdG~~  427 (480)
T PRK06151        353 LDAASSADLFDAATLGGARALGRTDLGRLAPGARADIAVFNLDDLHLGPSWDPIRTLVLGG---S--GDDVRAVFVDGRV  427 (480)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCHHHHHHCCC---C--CCCCEEEEECCEE
T ss_conf             9989999999999999999828988876588773788999599987678769689987748---8--7866299999999


Q ss_pred             EEEE
Q ss_conf             9862
Q gi|254780301|r  426 VYTL  429 (431)
Q Consensus       426 Vy~~  429 (431)
                      ||+.
T Consensus       428 v~~d  431 (480)
T PRK06151        428 VMED  431 (480)
T ss_pred             EEEC
T ss_conf             9999


No 42 
>PRK09356 imidazolonepropionase; Validated
Probab=100.00  E-value=1.5e-34  Score=240.71  Aligned_cols=72  Identities=29%  Similarity=0.393  Sum_probs=60.8

Q ss_pred             CC-CEEEECCEEECCCC------CEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCC
Q ss_conf             96-26996429999888------850001089979999983178655666788779988798895172714114789998
Q gi|254780301|r    1 MT-SFVLNNTRIIDPSR------DIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPD   73 (431)
Q Consensus         1 M~-~llI~n~~iid~~~------~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~   73 (431)
                      |+ +|||+||+|+++++      +++++++|+|+||||++||+..+.  .+++++|||++|++|+|||||+|+|+...+.
T Consensus         1 ~~~~~ll~n~~v~Tm~~~~~~~~~vie~g~V~I~~grI~~VG~~~~~--~~~~~~vID~~g~~v~PGfID~H~Hl~~~g~   78 (401)
T PRK09356          1 MSDDLLWNNARLATMKGEAMGPLGVIEDGAIAVKDGKIVWVGPEAEL--PASATEIIDAGGKWVTPGLIDCHTHLVFGGN   78 (401)
T ss_pred             CCCCEEEECCEEEEECCCCCCCCCEECCCEEEEECCEEEEECCCCCC--CCCCCEEEECCCCEEEECHHHHHHCCCCCCC
T ss_conf             97668987989996266556887867486899989999995589878--9889919987999994564135348046787


Q ss_pred             C
Q ss_conf             3
Q gi|254780301|r   74 E   74 (431)
Q Consensus        74 ~   74 (431)
                      .
T Consensus        79 r   79 (401)
T PRK09356         79 R   79 (401)
T ss_pred             C
T ss_conf             2


No 43 
>PRK12394 putative metallo-dependent hydrolase; Provisional
Probab=100.00  E-value=1.3e-33  Score=234.57  Aligned_cols=90  Identities=23%  Similarity=0.407  Sum_probs=67.8

Q ss_pred             CC-CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCH
Q ss_conf             96-26996429999888850001089979999983178655666788779988798895172714114789998311437
Q gi|254780301|r    1 MT-SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNI   79 (431)
Q Consensus         1 M~-~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~   79 (431)
                      |+ |||||||+|+||.+++....||+|+||||++|++.+.    .++.+||||+|+||+|||||.|+|+...+.....+ 
T Consensus         2 m~~dllIknG~VIDP~~~~d~~~DI~I~~GkI~~v~~~~~----~~a~~VIDa~G~~V~PGlID~H~H~~~~~~~~g~~-   76 (387)
T PRK12394          2 MKNDILITGGHIIDPARNINEINNLRIINDIIVDADKYPV----TSETRIIHADGMIVTPGLIDYHAHVFYDATEGGVR-   76 (387)
T ss_pred             CCCCEEEECCEEECCCCCCCCEEEEEEECCEEEECCCCCC----CCCCEEEECCCCEECCCEEEEEECCCCCCCCCCCC-
T ss_conf             7647898698998988787853479998999997456787----76563995899888468478734014688657638-


Q ss_pred             HHHHHHHHCCCCCCCCCC
Q ss_conf             889999870787321245
Q gi|254780301|r   80 TTLSKEAVAGGITSIILM   97 (431)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~   97 (431)
                        ........|++...+.
T Consensus        77 --pD~~~~~~GVTTvVDa   92 (387)
T PRK12394         77 --PDMYMPPNGVTTVVDA   92 (387)
T ss_pred             --CCCCCCCCCCCEEEEC
T ss_conf             --1110146785658726


No 44 
>PRK06380 metal-dependent hydrolase; Provisional
Probab=100.00  E-value=4e-34  Score=237.95  Aligned_cols=78  Identities=17%  Similarity=0.242  Sum_probs=58.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEEEC--HHHHHCCCCCCCCCCEEEEEEEEEEEECCE
Q ss_conf             169899999998815179980999972466872678998698978853--778520248865677278228899999999
Q gi|254780301|r  347 GQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVK--ADDMSSIHKNTVFDKEFFTGKVVRTYISGK  424 (431)
Q Consensus       347 ~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i~--~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~  424 (431)
                      ...++++++|+|+|+||||+||++.|+||+||+||||+||.+.+....  ..++.+...++   +.  .+.|++|||+||
T Consensus       322 ~~~~~~~~~l~mAT~~gAkaLg~~~Gsie~Gk~ADlvviD~~~p~~~P~~~~d~~~~lV~~---a~--~~~V~~V~V~G~  396 (418)
T PRK06380        322 ASIIKSQDILDMATLNAASALNLNAGSIEVGKIADLVILDARAPNMIPTNEANFVKNIVYS---GN--PSNVDYVIIDGK  396 (418)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHCC---CC--CCCCCEEEECCE
T ss_conf             8767999999999999999849999756877637899991899877788866989997536---99--998599999999


Q ss_pred             EEEEE
Q ss_conf             99862
Q gi|254780301|r  425 QVYTL  429 (431)
Q Consensus       425 iVy~~  429 (431)
                      +|++.
T Consensus       397 ~v~~d  401 (418)
T PRK06380        397 ILKEN  401 (418)
T ss_pred             EEEEC
T ss_conf             99999


No 45 
>PRK11170 nagA N-acetylglucosamine-6-phosphate deacetylase; Provisional
Probab=100.00  E-value=3.1e-32  Score=225.73  Aligned_cols=94  Identities=24%  Similarity=0.359  Sum_probs=69.5

Q ss_pred             EEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCC-------CCC
Q ss_conf             9964299998888500010899799999831786556667887799887988951727141147899983-------114
Q gi|254780301|r    5 VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDE-------YSK   77 (431)
Q Consensus         5 lI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~-------~~~   77 (431)
                      .|+|++|++|. .+++++.|+|+||||++|++..   +.|+++++||++|++|+|||||.|+|-.++...       ..+
T Consensus         3 ~l~n~~i~~~~-~~l~~~~v~i~~g~I~~i~~~~---~~~~~~~~iD~~g~~l~PGfIDihihG~~G~~f~d~~~~~t~e   78 (381)
T PRK11170          3 ALTNGRIYTGH-EVLDDHAVVIANGLIKAVCPVA---ELPPGIEQRDLNGAILSPGFIDLQLNGCGGVQFNDTAEAISVE   78 (381)
T ss_pred             EEECCEEECCC-CEEECCEEEEECCEEEEEECCC---CCCCCCEEEECCCCEEECCEEEEECCCCCCCCCCCCCCCCCHH
T ss_conf             68772998899-5897989999899999986777---6899982897999988358988730788884767886445699


Q ss_pred             CHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             3788999987078732124545566
Q gi|254780301|r   78 NITTLSKEAVAGGITSIILMPLGMS  102 (431)
Q Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~~~~  102 (431)
                      .+....+.....|++.........+
T Consensus        79 ~l~~~~~~~~~~GvTs~lpT~iT~~  103 (381)
T PRK11170         79 TLEIMQKANLKSGCTSFLPTLITSS  103 (381)
T ss_pred             HHHHHHHHHHHCCEEEEECCCCCCC
T ss_conf             9999999877168789935656899


No 46 
>cd01302 Cyclic_amidohydrolases Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids. Allantoinases catalyze the degradation of purines, while dihydropyrimidinases and hydantoinases, a microbial counterpart of dihydropyrimidinase, are involved in pyrimidine degradation. Dihydroorotase participates in the de novo synthesis of pyrimidines.
Probab=100.00  E-value=1.2e-32  Score=228.32  Aligned_cols=330  Identities=28%  Similarity=0.382  Sum_probs=165.3

Q ss_pred             CEEECCEEECCCCCCCCCC-CCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECC
Q ss_conf             8895172714114789998-311437889999870787321245455664333166777767766431012232100013
Q gi|254780301|r   55 LVAVPGIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLT  133 (431)
Q Consensus        55 ~~v~PGlID~H~Hl~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  133 (431)
                      .+|+|||||.|+|++.|+. .++|++.++++++..||++....++...+............... ......+........
T Consensus         1 L~v~PG~iD~HvH~r~pg~~~~ked~~s~t~AAa~GGvTtv~~mPnt~p~~~~~~~~~~~~~~a-~~~~~vd~~~~~~~~   79 (337)
T cd01302           1 LLVLPGFIDIHVHLRDPGGTTYKEDFESGSRAAAAGGVTTVIDMPNTGPPPIDLPAIELKIKLA-EESSYVDFSFHAGIG   79 (337)
T ss_pred             CEEECCEEEECCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHH-HCCCCEEEEEEEEEE
T ss_conf             9894887870332578999886435999999998488007998989999989899999999986-136863576688861


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             44322222221000001122223433---322221101245676542101222233322222221124675310012222
Q gi|254780301|r  134 SNMEGKEISEMRLLQEQGIVSFIQSP---MSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVG  210 (431)
Q Consensus       134 ~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  210 (431)
                      ..........................   .............+...........|.                        
T Consensus        80 ~~~~~~el~~~~~~g~~~~k~f~~~~~~~~~~~~~~~l~~~~~~~~~~~~~v~~Ha------------------------  135 (337)
T cd01302          80 PGDVTDELKKLFDAGINSLKVFMNYYFGELFDVDDGTLMRTFLEIASRGGPVMVHA------------------------  135 (337)
T ss_pred             CCCCHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEHH------------------------
T ss_conf             57557789998876732022898733787654799999999998875799799708------------------------


Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             10000123555566543200011122233311211001111001222322222222222322221110000001112222
Q gi|254780301|r  211 IPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE  290 (431)
Q Consensus       211 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  290 (431)
                                ..............+..+..........................+...................+.....
T Consensus       136 ----------Er~~~la~~~g~~lhi~HvSt~~sle~I~~ak~~G~~Vt~Ev~phhL~l~~~~~~~~~~~~k~~PPLR~~  205 (337)
T cd01302         136 ----------ERAAQLAEEAGANVHIAHVSSGEALELIKFAKNKGVKVTCEVCPHHLFLDESMLRLNGAWGKVNPPLRSK  205 (337)
T ss_pred             ----------HHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHCCCCEECCCCHHHHCCCHHHHHCCCCCEECCCCCCCH
T ss_conf             ----------8899999987998999938998999999998872983664643555429987871358636407998977


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             2222222223344311113444545432222--34333222222210136788867651698999999988151799809
Q gi|254780301|r  291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKL--LPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN  368 (431)
Q Consensus       291 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lg  368 (431)
                      ..................+...++.......  ........+.......+........++++|++++++++|.||||+||
T Consensus       206 ~d~~aL~~~l~~G~ID~i~SDHaP~~~~~K~~~~~f~~a~~G~~glet~lpl~l~~~~~~~lsl~~~v~~~s~nPAki~g  285 (337)
T cd01302         206 EDREALWEGVKNGKIDTIASDHAPHSKEEKESGKDIWKAPPGFPGLETRLPILLTEGVKRGLSLETLVEILSENPARIFG  285 (337)
T ss_pred             HHHHHHHHHHHCCCCCEEEECCCCCCHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHC
T ss_conf             89999999887499558985888989888102467464889875277799999999985499999999999788999959


Q ss_pred             CC-CCEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEE
Q ss_conf             99-9724668726789986989788537785202488656772782288999
Q gi|254780301|r  369 LP-GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT  419 (431)
Q Consensus       369 l~-~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~t  419 (431)
                      +. +|+|++|++||||||||+++|+|+.++++|+++||||+|++++|+|.+|
T Consensus       286 l~~kG~i~~G~dADlvi~Dp~~~~~v~~~~~~s~~~~sp~~G~~l~G~v~~T  337 (337)
T cd01302         286 LYPKGTIAVGYDADLVIVDPKKEWKVTAEEIESKADWTPFEGMEVTGKPVST  337 (337)
T ss_pred             CCCCCCCCCCCCCCEEEEECCCCEEECHHHCCCCCCCCCCCCCEEEEEEEEC
T ss_conf             8988861689957889995999689874558075885774698887899579


No 47 
>PRK09228 guanine deaminase; Provisional
Probab=99.98  E-value=1.7e-31  Score=221.07  Aligned_cols=70  Identities=33%  Similarity=0.469  Sum_probs=55.3

Q ss_pred             CCCEEEECCEEE---CC------CCCEEEEEEEEEECCEEEEECCCCCC-CCCCCCCEEEECCCCEEECCEEECCCCCCC
Q ss_conf             962699642999---98------88850001089979999983178655-666788779988798895172714114789
Q gi|254780301|r    1 MTSFVLNNTRII---DP------SRDIDEVGAIIVENGIILAAGADALN-AKFPTSALIHDCTGLVAVPGIIDARVTLTG   70 (431)
Q Consensus         1 M~~llI~n~~ii---d~------~~~~~~~~~I~I~~gkI~~Ig~~~~~-~~~~~~~~vID~~G~~v~PGlID~H~Hl~~   70 (431)
                      |++.++++-...   ||      ...++++|+|+|+||||++||+..+. ...|++++|||++|++|||||||+|+|+.+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~d~~~~vIedGaVlVe~grI~aVG~~~el~~~~p~~a~viD~~G~~vmPGlVd~H~Hl~q   80 (429)
T PRK09228          1 MTTKAYRGRILHFVDDPAEIDDDALRYIEDGLLLVEDGRIVAAGPYADLAAQLPADVEVVDYRGKLIVPGFIDTHIHYPQ   80 (429)
T ss_pred             CCCEEEEEEEEEECCCCCCCCCCCEEEEECEEEEEECCEEEEECCHHHHHHHCCCCCEEEECCCCEEEECEEECCCCHHH
T ss_conf             96347555586034898778987459991749999899999977878855447999879968999894170670318142


No 48 
>COG1228 HutI Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=99.98  E-value=8.6e-32  Score=222.90  Aligned_cols=70  Identities=29%  Similarity=0.388  Sum_probs=57.1

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCC
Q ss_conf             2699642999988885000108997999998317865566678877998879889517271411478999831
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEY   75 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~   75 (431)
                      .+++++++.++..+ ..+++.|+|+||||++||+..  ...|+++++||++|++|+|||||+|+|+...+...
T Consensus        11 ~~~~~~~~~~~~~~-~i~~~~v~i~~GkI~~vg~~~--~~~~~~~~viD~~G~~V~PGLID~HtHl~~~~~~~   80 (406)
T COG1228          11 MLATLAGRGLPGLG-IIEDGAVLIEDGKIVAVGPEE--IDIPAGAEVIDAKGKTVTPGLIDAHTHLGFGGSRG   80 (406)
T ss_pred             HEEEECCCCCCCCC-EEECCEEEEECCEEEEECCCC--CCCCCCCEEEECCCCEECCCEECCCCCCCCCCCCC
T ss_conf             30231465667765-274437999689389937655--67898876997889877656551100415577862


No 49 
>PRK08418 chlorohydrolase; Provisional
Probab=99.98  E-value=1.6e-32  Score=227.55  Aligned_cols=68  Identities=26%  Similarity=0.228  Sum_probs=58.2

Q ss_pred             CCCEEEECCEEEC--CCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             9626996429999--8888500010899799999831786556667887799887988951727141147899
Q gi|254780301|r    1 MTSFVLNNTRIID--PSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         1 M~~llI~n~~iid--~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      |+  ||+|++|++  +...++++|+|+|+ ++|++||+..+....++++++||++|++|+|||||+|+|+.+.
T Consensus         1 m~--li~~~~vvT~d~~~~vi~dg~v~i~-d~I~~VG~~~~l~~~~~~~~viD~~~~iv~PGlVNaH~Hl~~~   70 (407)
T PRK08418          1 ME--IIGASYIFTCDENFTILEDQAVVFD-DKILEIGDLENLKKKYPNAKIKFFENSVLLPAFINAHVHLEFS   70 (407)
T ss_pred             CE--EEECCEEEEECCCCCEECCCEEEEC-CEEEEEECHHHHHHHCCCCEEEECCCCEEEECCEECCCCCCCC
T ss_conf             96--9768999987799988879589993-8399990889987558998799689989937960504381201


No 50 
>PRK07203 putative chlorohydrolase/aminohydrolase; Validated
Probab=99.97  E-value=9.9e-32  Score=222.53  Aligned_cols=67  Identities=28%  Similarity=0.483  Sum_probs=59.0

Q ss_pred             EEEECCEEE--CCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCC
Q ss_conf             699642999--9888850001089979999983178655666788779988798895172714114789
Q gi|254780301|r    4 FVLNNTRII--DPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG   70 (431)
Q Consensus         4 llI~n~~ii--d~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~   70 (431)
                      ||||||+|+  |+...++++|+|+|+||||++||+..+....++++++||++|++|+|||||+|+|+..
T Consensus         2 lli~~~~v~T~d~~~~v~~~g~V~V~~~~I~~VG~~~~~~~~~~~~~vID~~g~iv~PGfVn~H~H~~~   70 (442)
T PRK07203          2 LLLGNGTAVTLDPAKPVQEGGDIAIENNVIVAIGNTDALKQKYPDAEFIDAKGKIIMPGIINSHNHFYS   70 (442)
T ss_pred             EEEECCEEEEECCCCCEECCEEEEEECCEEEEECCCHHHHHCCCCCEEEECCCCEEEECHHHHHHHHHH
T ss_conf             799888999977999877681899989999997882454230899869968998995665969866876


No 51 
>TIGR03179 gua_deam guanine deaminase. This enzyme converts guanine to xanthine in the catabolism of guanine. Seed members were included by virtue of their proximity to other genes of the guanine/xanthine/urate/allantoate catabolic pathway. The guanine deaminase in E. coli has been characterized. Eukaryotic sequences were not included in the seed and fall below trusted to this model.
Probab=99.97  E-value=6.6e-33  Score=230.08  Aligned_cols=55  Identities=36%  Similarity=0.492  Sum_probs=47.4

Q ss_pred             CCEEEEEEEEEECCEEEEECCCCCC-CCCCCCCEEEECCCCEEECCEEECCCCCCC
Q ss_conf             8850001089979999983178655-666788779988798895172714114789
Q gi|254780301|r   16 RDIDEVGAIIVENGIILAAGADALN-AKFPTSALIHDCTGLVAVPGIIDARVTLTG   70 (431)
Q Consensus        16 ~~~~~~~~I~I~~gkI~~Ig~~~~~-~~~~~~~~vID~~G~~v~PGlID~H~Hl~~   70 (431)
                      ..++++|+|+|+||||++||+..+. ...|++++|||++|++|||||||+|+|+..
T Consensus        24 ~~vIedGaVlVedgrI~aVG~~~ev~~~~p~~aeviD~~G~~VmPGlVdaHtHl~~   79 (427)
T TIGR03179        24 YQYFEDGLLLVEDGRIAAAGPYADLLATLPAGAEVHDHRPHLIVPGFIDTHIHFPQ   79 (427)
T ss_pred             EEEECCEEEEEECCEEEEECCHHHHHHHCCCCCEEEECCCCEEEECCEEHHHCHHH
T ss_conf             27971879999899999986867867547999979979998984321107449554


No 52 
>TIGR03314 Se_ssnA putative selenium metabolism protein SsnA. Members of this protein family are found exclusively in genomes that contain putative set of labile selenium-dependent enzyme accessory proteins as well as homologs of a labile selenium-dependent purine hydroxylase. A mutant in this gene in Escherichia coli had improved stationary phase viability. The function is unknown.
Probab=99.97  E-value=5.7e-31  Score=217.62  Aligned_cols=68  Identities=25%  Similarity=0.435  Sum_probs=59.5

Q ss_pred             EEEECCEEE--CCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             699642999--98888500010899799999831786556667887799887988951727141147899
Q gi|254780301|r    4 FVLNNTRII--DPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         4 llI~n~~ii--d~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      |||+||+|+  |+...++++|+|+|+||||++||+.......++++++||++|++|+|||||+|+|+.+.
T Consensus         1 lLi~~~~vvT~D~~~~vl~~g~v~V~~~~I~aVG~~~~~~~~~~~~~viD~~g~iv~PGlVntH~H~~~~   70 (441)
T TIGR03314         1 LLIGNGTAVQLDPTRPIQEGGDIAIDGDVIKAVGPTEELKQKYPEATFIDAKGKLIMPGFINTHNHFYST   70 (441)
T ss_pred             CEEECCEEEEECCCCCEECCEEEEEECCEEEEECCCHHHHHCCCCCEEEECCCCEEEECCHHHHHCHHHH
T ss_conf             9797879999879998787828999899999976833432308998499689989956607398687657


No 53 
>PRK07213 chlorohydrolase; Provisional
Probab=99.97  E-value=1.1e-30  Score=215.88  Aligned_cols=81  Identities=15%  Similarity=0.212  Sum_probs=58.6

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCC-CEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEE
Q ss_conf             6788867651698999999988151799809999-724668726789986989788537785202488656772782288
Q gi|254780301|r  338 LSAALRLFHGQQISLKKLIRALSTRPAQIFNLPG-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV  416 (431)
Q Consensus       338 ~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~-G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V  416 (431)
                      +...........++++|+|+|||+|+||+||+++ |+||+||+||||+||++...... .+..+...|+.-     .+.|
T Consensus       296 ~~em~~~~~~~~~~~~e~L~mAT~~GA~aLg~~~~GsLe~Gk~ADli~id~~~~~~~~-~dp~~~lV~~a~-----~~~V  369 (378)
T PRK07213        296 FKEMDFIYKIYHIDPKEILKMATINGAEILGLQNTGLIKEGFKADFTFIKNGNILKTS-KNPYASIVTRCE-----NGDI  369 (378)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCC-CCHHHHHHCCCC-----CCCC
T ss_conf             9999999987399999999999999999809988777078887619999898655788-785999982687-----5767


Q ss_pred             EEEEECCE
Q ss_conf             99999999
Q gi|254780301|r  417 VRTYISGK  424 (431)
Q Consensus       417 ~~tiv~G~  424 (431)
                      ++|||+||
T Consensus       370 ~~v~V~gk  377 (378)
T PRK07213        370 DSFFLVCK  377 (378)
T ss_pred             CEEEECCC
T ss_conf             98996798


No 54 
>TIGR03583 EF_0837 probable amidohydrolase EF_0837/AHA_3915. Members of this family of relatively uncommon proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. These proteins resemble aminohydrolases (see pfam01979), including dihydroorotases. The function is unknown.
Probab=99.97  E-value=8.2e-30  Score=210.16  Aligned_cols=84  Identities=20%  Similarity=0.285  Sum_probs=62.0

Q ss_pred             CCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCC-CEEECCEEECCCCCCCCCCCCCCCHH
Q ss_conf             62699642999988885000108997999998317865566678877998879-88951727141147899983114378
Q gi|254780301|r    2 TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTG-LVAVPGIIDARVTLTGSPDEYSKNIT   80 (431)
Q Consensus         2 ~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G-~~v~PGlID~H~Hl~~~~~~~~~~~~   80 (431)
                      .|||||||+|+|+.     ..||+|+||||++||+++..    ++.+||||+| +||+|||||+|+|+..++..+..+. 
T Consensus         1 yDllIknG~vid~~-----~~DI~I~~GkI~~Ig~~i~~----~~~~vIDa~G~~yV~PGlID~H~H~~~~~~~~~~~~-   70 (365)
T TIGR03583         1 YDLLIKNGRTVNGT-----PVDIAIEDGKIAAVGTTITG----SAKQTIDLEGETYVSAGWIDDHTHCFPKSALYYDEP-   70 (365)
T ss_pred             CCEEEECCEEECCC-----CEEEEEECCEEEEECCCCCC----CCCEEEECCCCEEECCCEEEEEECCCCCCCCCCCCC-
T ss_conf             96899798981898-----12799989999981567788----876499899998985784374035778987655474-


Q ss_pred             HHHHHHHCCCCCCCCCC
Q ss_conf             89999870787321245
Q gi|254780301|r   81 TLSKEAVAGGITSIILM   97 (431)
Q Consensus        81 ~~~~~~~~~~~~~~~~~   97 (431)
                        .......|+|+..+.
T Consensus        71 --d~~~~~~GvTTvvda   85 (365)
T TIGR03583        71 --DEIGVKTGVTTVVDA   85 (365)
T ss_pred             --CHHHHCCCCCEEEEC
T ss_conf             --221112574559857


No 55 
>cd01309 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.
Probab=99.97  E-value=8e-31  Score=216.69  Aligned_cols=70  Identities=24%  Similarity=0.454  Sum_probs=58.2

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCC--CEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEE
Q ss_conf             6788867651698999999988151799809999--72466872678998698978853778520248865677278228
Q gi|254780301|r  338 LSAALRLFHGQQISLKKLIRALSTRPAQIFNLPG--GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK  415 (431)
Q Consensus       338 ~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~--G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~  415 (431)
                      ......+..+.|||++|||+++|+||||+||+++  |+|++||+|||||||.|                 |++..   .+
T Consensus       288 ~~~~~~~~~~~Gl~~~eal~~aT~n~A~~lgl~~~~Gsie~Gk~ADlVvvd~d-----------------PL~~~---~~  347 (359)
T cd01309         288 LNLEAAKAVKYGLSYEEALKAITINPAKILGIEDRVGSLEPGKDADLVVWNGD-----------------PLEPT---SK  347 (359)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCEEEECCC-----------------CCCCH---HH
T ss_conf             99999999980999999999999999999499898500078883768998999-----------------66650---12


Q ss_pred             EEEEEECCEEEE
Q ss_conf             899999999998
Q gi|254780301|r  416 VVRTYISGKQVY  427 (431)
Q Consensus       416 V~~tiv~G~iVy  427 (431)
                      |++|||+||+||
T Consensus       348 v~~v~~~Gr~v~  359 (359)
T cd01309         348 PEQVYIDGRLVY  359 (359)
T ss_pred             HHEEEECCEEEC
T ss_conf             261467999949


No 56 
>cd01307 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgroup B is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.
Probab=99.97  E-value=4.3e-29  Score=205.52  Aligned_cols=70  Identities=29%  Similarity=0.414  Sum_probs=55.8

Q ss_pred             EEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCC
Q ss_conf             0899799999831786556667887799887988951727141147899983114378899998707873212454
Q gi|254780301|r   23 AIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMP   98 (431)
Q Consensus        23 ~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   98 (431)
                      ||+|+||||++||++.   ..+.+++||||+|+||+|||||+|+|+..++..+.++.   .+.+..+|+|+.....
T Consensus         1 DVlI~~GkI~aIg~~l---~~~~~~evIDa~G~~V~PGlID~HvH~~~~~~~~~~~~---~~~~~~~GvTTvvd~~   70 (338)
T cd01307           1 DVAIENGKIAAVGAAL---AAPAATQIVDAGGCYVSPGWIDLHVHVYQGGTRYGDRP---DMIGVKSGVTTVVDAG   70 (338)
T ss_pred             CEEEECCEEEEECCCC---CCCCCCEEEECCCCEEECCEEEECCCCCCCCCCCCCCH---HHHHHCCCCEEEEECC
T ss_conf             9889899999957889---99999989959999994172563428999975666798---8875415826999678


No 57 
>cd01316 CAD_DHOase The eukaryotic CAD protein is a trifunctional enzyme of carbamoylphosphate synthetase-aspartate transcarbamoylase-dihydroorotase, which catalyzes the first three steps of de novo pyrimidine nucleotide biosynthesis. Dihydroorotase (DHOase) catalyzes the third step, the reversible interconversion of carbamoyl aspartate to dihydroorotate.
Probab=99.97  E-value=8.4e-29  Score=203.64  Aligned_cols=333  Identities=25%  Similarity=0.357  Sum_probs=159.0

Q ss_pred             CEEECCEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCC
Q ss_conf             88951727141147899983114378899998707873212454556643331667777677664310122321000134
Q gi|254780301|r   55 LVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTS  134 (431)
Q Consensus        55 ~~v~PGlID~H~Hl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  134 (431)
                      .+|+|||||+|+|+++||.+++||++++++++..||++....++...+............... ......+........ 
T Consensus         2 ~lvlPG~iD~HvH~r~pg~~~~ed~~sgs~AAa~GGvTtv~~mPnt~P~~~~~~~~~~~~~~a-~~~~~~d~~~~~~~~-   79 (344)
T cd01316           2 TIRLPGLIDVHVHLREPGATHKEDFASGTKAALAGGFTMVRAMPNTNPSIVDVASLKLVQSLA-QAKARCDYAFSIGAT-   79 (344)
T ss_pred             EEEECCEEECCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHH-HCCCCCCEEEEEEEC-
T ss_conf             698268880057779999877464999999998479779977999989979999999999974-317732112688852-


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             43222222210000011222234333222211012456765421012222333222222211246753100122221000
Q gi|254780301|r  135 NMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSI  214 (431)
Q Consensus       135 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  214 (431)
                      ............. ..........   ...................    .            .....        ....
T Consensus        80 ~~~~~~l~~l~~~-~~g~~~~~~~---~~~~~~~~~~~~~~~~~~~----~------------~~~~p--------i~~~  131 (344)
T cd01316          80 STNAATVGELASE-AVGLKFYLNE---TFSTLILDKITAWASHFNA----W------------PSTKP--------IVTH  131 (344)
T ss_pred             CCCHHHHHHHHHC-CCCEEEEECC---CCCHHHHHHHHHHHHHHHH----C------------CCCCC--------CHHH
T ss_conf             6767899998754-6838999635---5635777799999999863----6------------45697--------3142


Q ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             01235555665432000111222333112110011110012223222222222223222211100000011122222222
Q gi|254780301|r  215 SETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERM  294 (431)
Q Consensus       215 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  294 (431)
                      ....................+..+..........................+..........  .......+.........
T Consensus       132 aE~~~~~~~l~la~~~~~~lHi~HiSt~~~v~lI~~ak~~G~~Vt~Et~ph~L~l~~~~~~--~~~~k~~PPLR~~~d~~  209 (344)
T cd01316         132 AKSQTLAAVLLLASLHNRSIHICHVSSKEEINLIRLAKARGLKVTCEVSPHHLFLSQDDLP--RGQYEVRPFLPTREDQE  209 (344)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECHHHHCCCHHHHH--CCCCCCCCCCCCHHHHH
T ss_conf             2389999999999987998999946887799999999872897478634554208775763--35987288999978999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             22222334431111344454543222234333222222210136788867651698999999988151799809999724
Q gi|254780301|r  295 SMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTL  374 (431)
Q Consensus       295 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~G~I  374 (431)
                      ......  ......+...++........  .....+.......+......+.++++|++++++++|.||||+|||..   
T Consensus       210 aL~~~l--~~ID~IaSDHaP~~~~~K~~--~~~~~G~~GlEt~lp~~~~~v~~g~lsl~~lv~~~s~nPAki~gl~~---  282 (344)
T cd01316         210 ALWENL--DYIDCFATDHAPHTLAEKTG--NKPPPGFPGVETSLPLLLTAVHEGRLTIEDIVDRLHTNPKRIFNLPP---  282 (344)
T ss_pred             HHHHHH--HCCCEEECCCCCCCHHHHCC--CCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCC---
T ss_conf             999754--22778971677657655022--46999856277689999999983997899999999498999728898---


Q ss_pred             CCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEECCEEEEEE
Q ss_conf             6687267899869897885377852024886567727822889999999999862
Q gi|254780301|r  375 QTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTL  429 (431)
Q Consensus       375 ~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~iVy~~  429 (431)
                         +..++|++|+|.+|+++.++++|+++||||+|++++|+|.+||++|++||+.
T Consensus       283 ---~~g~~v~vD~~~~~~i~~~~~~Sk~~~spfeG~~l~G~v~~ti~rG~~v~~~  334 (344)
T cd01316         283 ---QSDTYVEVDLDEEWTIPKNPLQSKKGWTPFEGKKVKGKVQRVVLRGETAFID  334 (344)
T ss_pred             ---CCCCEEEECCCCCEEECHHHCCCCCCCCCCCCCEEEEEEEEEEECCEEEEEC
T ss_conf             ---8898899879997898814272758867745988888999999999999999


No 58 
>PRK10027 cryptic adenine deaminase; Provisional
Probab=99.97  E-value=1.1e-28  Score=202.90  Aligned_cols=90  Identities=26%  Similarity=0.404  Sum_probs=69.0

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHHH
Q ss_conf             26996429999888850001089979999983178655666788779988798895172714114789998311437889
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTL   82 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~~~   82 (431)
                      |++||||+|++...+.+..+||+|.+|+|+.||++.   ...++.++|||+|+|+.|||||+|+|+..+-.+    ....
T Consensus        31 DLvikn~~vvnV~t~ei~~~dIaI~~g~Ia~VG~~~---~~~~~~~viDa~G~ylvPG~ID~H~HIESsmlt----P~ef  103 (588)
T PRK10027         31 DYIIDNVSILDLINGGEISGPIVIKGRYIAGVGAEY---ADAPALQRIDARGATAVPGFIDAHLHIESSMMT----PVTF  103 (588)
T ss_pred             CEEEECCEEEECCCCEEEECCEEEECCEEEEECCCC---CCCCCCEEEECCCCEECCCCCCCCCCCCCCCCC----HHHH
T ss_conf             899989999982547099887999999999987766---778873899788998774502474056042329----9999


Q ss_pred             HHHHHCCCCCCCCCCCC
Q ss_conf             99987078732124545
Q gi|254780301|r   83 SKEAVAGGITSIILMPL   99 (431)
Q Consensus        83 ~~~~~~~~~~~~~~~~~   99 (431)
                      .+.....|++....-+.
T Consensus       104 A~~vlp~GTTtvv~DpH  120 (588)
T PRK10027        104 ETATLPRGLTTVICDPH  120 (588)
T ss_pred             HHHHHCCCCEEEECCCH
T ss_conf             99987358769972878


No 59 
>cd01293 Bact_CD Bacterial cytosine deaminase and related metal-dependent hydrolases. Cytosine deaminases (CDs) catalyze the deamination of cytosine, producing uracil and ammonia. They play an important role in pyrimidine salvage. CDs are present in prokaryotes and fungi, but not mammalian cells. The bacterial enzymes, but not the fungal enzymes, are related to the adenosine deaminases (ADA). The bacterial enzymes are iron dependent and hexameric.
Probab=99.97  E-value=9.7e-31  Score=216.14  Aligned_cols=60  Identities=28%  Similarity=0.470  Sum_probs=51.9

Q ss_pred             EEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCC
Q ss_conf             996429999888850001089979999983178655666788779988798895172714114789
Q gi|254780301|r    5 VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG   70 (431)
Q Consensus         5 lI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~   70 (431)
                      ||||+||+|+..   ...||+|+||||++||+..   ..++++++||++|++|+|||||+|+|+..
T Consensus         1 li~n~~~~dg~~---~~~DVlIedgrI~aVg~~~---~~~~~~~vID~~G~~v~PGlID~H~Hl~~   60 (398)
T cd01293           1 LLRNARLADGGT---ALVDIAIEDGRIAAIGPAL---AVPPDAEEVDAKGRLVLPAFVDPHIHLDK   60 (398)
T ss_pred             CCCCEEECCCCC---CEEEEEEECCEEEEECCCC---CCCCCCCEEECCCCEEEECCEEHHHCHHH
T ss_conf             921338248996---7578999999999956689---88999988989998997170307258333


No 60 
>cd01303 GDEase Guanine deaminase (GDEase). Guanine deaminase is an aminohydrolase responsible for the conversion of guanine to xanthine and ammonia, the first step to utilize guanine as a nitrogen source. This reaction also removes the guanine base from the pool and therefore can play a role in the regulation of cellular GTP and the guanylate nucleotide pool.
Probab=99.96  E-value=1.9e-30  Score=214.31  Aligned_cols=61  Identities=26%  Similarity=0.395  Sum_probs=52.1

Q ss_pred             EEECCCCCEEEEEEEEEECCEEEEECCCCCC-CCCCCCCEEEECCCCEEECCEEECCCCCCC
Q ss_conf             9999888850001089979999983178655-666788779988798895172714114789
Q gi|254780301|r   10 RIIDPSRDIDEVGAIIVENGIILAAGADALN-AKFPTSALIHDCTGLVAVPGIIDARVTLTG   70 (431)
Q Consensus        10 ~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~-~~~~~~~~vID~~G~~v~PGlID~H~Hl~~   70 (431)
                      .++|....++++|+|+|+||||++||+..+. ...+++++|||++|++|+|||||+|+|+.+
T Consensus        15 ~~mdd~~~vi~dgav~V~dg~I~aVG~~~~~~~~~~~~a~vID~~g~~v~PGlVd~HtH~~~   76 (429)
T cd01303          15 ELVEDALRVVEDGLIVVVDGNIIAAGAAETLKRAAKPGARVIDSPNQFILPGFIDTHIHAPQ   76 (429)
T ss_pred             EEECCCEEEEECCEEEEECCEEEEECCHHHHHHHCCCCCEEEECCCCEEEECCHHHHHCHHH
T ss_conf             67547708995879999999999984867732215999879968998897783408768863


No 61 
>PRK05985 cytosine deaminase; Provisional
Probab=99.96  E-value=4.4e-29  Score=205.47  Aligned_cols=63  Identities=30%  Similarity=0.528  Sum_probs=54.6

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             96269964299998888500010899799999831786556667887799887988951727141147899
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      |+++||||+++.|+.     ..||+|+||||++|||..   +.+++.++||++|++|+|||||+|+|+...
T Consensus         2 ~~~~~i~~~~~~~~~-----~~Dv~I~dgrIaaVgp~~---~~~~~~eviD~~G~lv~PGlVd~HtHl~~t   64 (398)
T PRK05985          2 MTDLLFRNVRPAGGA-----AVDILIRDGRIAAIGPDL---AAPPGAAVIDGGGALALPGLVDGHIHLDKT   64 (398)
T ss_pred             CCCEEEECCCCCCCC-----EEEEEEECCEEEEECCCC---CCCCCCCEEECCCCEECCCCCHHHHCCCHH
T ss_conf             753577563469989-----513999899999964688---889999889899988774753163483013


No 62 
>COG1820 NagA N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism]
Probab=99.96  E-value=5.1e-28  Score=198.61  Aligned_cols=95  Identities=29%  Similarity=0.444  Sum_probs=73.5

Q ss_pred             EEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCC----CCH
Q ss_conf             6996429999888850001089979999983178655666788779988798895172714114789998311----437
Q gi|254780301|r    4 FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYS----KNI   79 (431)
Q Consensus         4 llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~----~~~   79 (431)
                      .+|+|++|+++.+ ++.++.+.|+||+|.+|.+    .+.|.+.++||.+|.+|+|||||.|+|-.++...+.    +.+
T Consensus         2 ~~~~~~~i~t~~~-~~~~~~v~i~dg~I~~i~~----~~~p~~~e~id~~G~~l~PGfID~hihG~gG~~~~D~~~~~~l   76 (380)
T COG1820           2 YALKNGRIFTGHG-VLDGGAVVIEDGKIEAVVP----AELPADAEIIDLKGALLVPGFIDLHIHGGGGADFMDAGSVETL   76 (380)
T ss_pred             CEEECCEEECCCC-EEECCEEEECCCEEEEEEC----CCCCCCCEEECCCCCEECCCEEEEEECCCCCCCCCCCCCHHHH
T ss_conf             2465547973764-5977579980898999705----7677765156389998646478975337674133676478999


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             889999870787321245455664
Q gi|254780301|r   80 TTLSKEAVAGGITSIILMPLGMSS  103 (431)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~  103 (431)
                      .+..+.....|++.........+.
T Consensus        77 ~~i~~~~~~~GtTsfLpT~iT~~~  100 (380)
T COG1820          77 ETMAEAHLRHGTTSFLPTLITASL  100 (380)
T ss_pred             HHHHHHHHHCCEEEEEEECCCCCH
T ss_conf             999998662174224201035999


No 63 
>COG1001 AdeC Adenine deaminase [Nucleotide transport and metabolism]
Probab=99.96  E-value=1.8e-27  Score=195.05  Aligned_cols=88  Identities=26%  Similarity=0.406  Sum_probs=67.4

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEE-CCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCCCCCHHH
Q ss_conf             26996429999888850001089979999983-17865566678877998879889517271411478999831143788
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAA-GADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITT   81 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~I-g~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~~~~~~~   81 (431)
                      |++++||+++|.-.+.+..+||.|.+|||+.| ++.    . +++.++||+.|+||.|||||+|.|+..+..+.    .+
T Consensus        25 dlv~kng~ivdv~~gei~~~dIaI~~grI~~v~~~~----~-~e~~~~iDa~g~yivPGfID~H~HIESSm~tP----~~   95 (584)
T COG1001          25 DLVLKNGRIVDVVTGEIYKGDIAIAGGRIVGVIGEY----R-AEATEVIDAAGRYIVPGFIDAHLHIESSMLTP----SE   95 (584)
T ss_pred             CEEEECCEEEEEEECCEEEEEEEEECCEEEEEECCC----C-CCCCEEECCCCCEECCCEECCCEECCCCCCCH----HH
T ss_conf             789989899875405088610899899999852677----7-66653761789886566110321010036689----99


Q ss_pred             HHHHHHCCCCCCCCCCCC
Q ss_conf             999987078732124545
Q gi|254780301|r   82 LSKEAVAGGITSIILMPL   99 (431)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~   99 (431)
                      ..++....|++....-+.
T Consensus        96 FA~~Vlp~GtTtvV~DPH  113 (584)
T COG1001          96 FARAVLPHGTTTVVSDPH  113 (584)
T ss_pred             HHHHHHCCCCEEEEECCH
T ss_conf             998865178558961728


No 64 
>cd01296 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate. In bacteria, the enzyme is part of histidine utilization (hut) operon.
Probab=99.95  E-value=5.6e-29  Score=204.77  Aligned_cols=66  Identities=17%  Similarity=0.240  Sum_probs=52.2

Q ss_pred             HHHCCCCCHHHHHHHHHHHHHHHCCCC-C-CEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEE
Q ss_conf             765169899999998815179980999-9-72466872678998698978853778520248865677278228899999
Q gi|254780301|r  344 LFHGQQISLKKLIRALSTRPAQIFNLP-G-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI  421 (431)
Q Consensus       344 ~~~~~gls~~eal~~aT~npA~~lgl~-~-G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv  421 (431)
                      .....+||++|+|+++|+||||+||++ + ||||+||+|||||||.|+.     +++.+...         ..+|++||+
T Consensus       304 a~~~~~l~~~eaL~~aT~n~A~~lg~~~~~GsLe~Gk~ADlvvlD~dp~-----~~i~~~~~---------~~~v~~V~~  369 (371)
T cd01296         304 ACRLMRMTPEEALTAATINAAAALGLGETVGSLEVGKQADLVILDAPSY-----EHLAYRFG---------VNLVEYVIK  369 (371)
T ss_pred             HHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCEECCCCCCCEEEEECCCH-----HHHHHHCC---------CCCCCEEEE
T ss_conf             9998599999999999999999958989975258898343799958987-----99876419---------999578881


Q ss_pred             CC
Q ss_conf             99
Q gi|254780301|r  422 SG  423 (431)
Q Consensus       422 ~G  423 (431)
                      ||
T Consensus       370 ~G  371 (371)
T cd01296         370 NG  371 (371)
T ss_pred             CC
T ss_conf             94


No 65 
>COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only]
Probab=99.95  E-value=3e-27  Score=193.63  Aligned_cols=74  Identities=24%  Similarity=0.383  Sum_probs=59.2

Q ss_pred             CCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCC-CCCCEEEECCCCEEECCEEECCCCCCCCCCCC
Q ss_conf             626996429999888850001089979999983178655666-78877998879889517271411478999831
Q gi|254780301|r    2 TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKF-PTSALIHDCTGLVAVPGIIDARVTLTGSPDEY   75 (431)
Q Consensus         2 ~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~-~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~   75 (431)
                      .++++.||+|++.+.....--.|+|+||||++||++...... .++++|||++|++|+|||||+|.|+...|...
T Consensus         5 adlil~nG~i~T~~~~~p~aeAvaI~dGrI~avG~~~~~~~~~~~~t~viDL~Gk~v~PGfvDaH~Hl~~~G~~~   79 (535)
T COG1574           5 ADLILHNGRIYTMDEARPTAEAVAIKDGRIVAVGSDAELKALAGPATEVIDLKGKFVLPGFVDAHLHLISGGLSL   79 (535)
T ss_pred             CCEEEECCEEEECCCCCCCEEEEEECCCEEEEECCHHHHHHHCCCCCEEEECCCCEECCCCCHHHHHHHHHHHHH
T ss_conf             141178887995268886435899739989997586999862278863996899875466100467798755553


No 66 
>PRK09229 N-formimino-L-glutamate deiminase; Validated
Probab=99.94  E-value=5e-26  Score=185.76  Aligned_cols=78  Identities=22%  Similarity=0.244  Sum_probs=59.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEE--ECHHHHHCCCCCCCCCCEEEEEEEEEEEECCE
Q ss_conf             1698999999988151799809999724668726789986989788--53778520248865677278228899999999
Q gi|254780301|r  347 GQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWT--VKADDMSSIHKNTVFDKEFFTGKVVRTYISGK  424 (431)
Q Consensus       347 ~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~--i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~  424 (431)
                      ...++..++|+|+|.++||+||++.|+|++||+||||+||++.++.  ....++.+...++   +.  ...|.+|||+||
T Consensus       355 ~~~~~a~~~l~mAT~~GAraLG~~~GsLe~Gk~ADlv~id~~~p~l~~~~~~~~~~~lV~~---a~--~~dV~~V~V~G~  429 (457)
T PRK09229        355 AQGSVGRRLFDAALAGGAQALGRPIGGLAVGARADLVVLDLDHPALAGRDGDALLDGWVFA---AG--AAAVRDVWVAGR  429 (457)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCHHHHHEEE---CC--CCCCCEEEECCE
T ss_conf             6557499999999999999829877773788827989990899766898974156462575---89--987679999999


Q ss_pred             EEEEE
Q ss_conf             99862
Q gi|254780301|r  425 QVYTL  429 (431)
Q Consensus       425 iVy~~  429 (431)
                      +|++.
T Consensus       430 ~v~~d  434 (457)
T PRK09229        430 KVVRD  434 (457)
T ss_pred             EEEEC
T ss_conf             99999


No 67 
>cd01312 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.
Probab=99.94  E-value=3e-27  Score=193.64  Aligned_cols=69  Identities=20%  Similarity=0.250  Sum_probs=53.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEEEEEECCE
Q ss_conf             169899999998815179980999972466872678998698978853778520248865677278228899999999
Q gi|254780301|r  347 GQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK  424 (431)
Q Consensus       347 ~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~  424 (431)
                      ....++.++|+|+|+|+||+||++-|+||+||+||||+||++.|..-....+.    +...     .+.|++|||+||
T Consensus       313 ~~~~~~~~~l~~aT~~gA~aLgl~iGsLe~Gk~ADliv~D~~~P~~~~~~~~~----~~~~-----~~~V~~v~V~G~  381 (381)
T cd01312         313 DLLELASELLLMATLGGARALGLNNGEIEAGKRADFAVFELPGPGIKEQAPLQ----FILH-----AKEVRHLFISGK  381 (381)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCCCCHHH----EEEC-----CCCCCEEEECCC
T ss_conf             99889999999999999999588785368778678999948999989843010----0003-----686897985899


No 68 
>TIGR03121 one_C_dehyd_A formylmethanofuran dehydrogenase subunit A. Members of this largely archaeal protein family are subunit A of the formylmethanofuran dehydrogenase. Nomenclature in some bacteria may reflect inclusion of the formyltransferase described by TIGR03119 as part of the complex, and therefore call this protein formyltransferase/hydrolase complex Fhc subunit A. Note that this model does not distinguish tungsten (FwdA) from molybdenum-containing (FmdA) forms of this enzyme; a single gene from this family is expressed constitutively in Methanobacterium thermoautotrophicum, which has both tungsten and molybdenum forms and may work interchangeably.
Probab=99.93  E-value=1.9e-24  Score=175.61  Aligned_cols=91  Identities=22%  Similarity=0.291  Sum_probs=67.5

Q ss_pred             CEEEECCEEECCCCCEE-EEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCC--------
Q ss_conf             26996429999888850-001089979999983178655666788779988798895172714114789998--------
Q gi|254780301|r    3 SFVLNNTRIIDPSRDID-EVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPD--------   73 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~-~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~--------   73 (431)
                      .++||||+|+||.+++. +.+||.|+||||++--.     .....+++|||+|++||||.||+|+|+.++..        
T Consensus         1 ei~iknG~V~DPangidGev~DI~IkDGkIV~~~~-----~~~~~~~vIDa~G~vVMpGgID~HsHIaG~KVN~gR~m~P   75 (556)
T TIGR03121         1 EILIKNGTVYDPANGIDGEVMDIFIRDGKIVEPVS-----GGTKPAKVIDASGKLVMAGGVDSHTHIAGPKVNVGRLLRP   75 (556)
T ss_pred             CEEEECCEEECCCCCCCCCEEEEEEECCEEECCCC-----CCCCCCEEEECCCCEEECCCCCCCCCCCCCCCCHHHEECH
T ss_conf             97987969979988888726257788998965777-----7777773897899888177112013556776324201075


Q ss_pred             --------------------CCCCCHHHHHHHHHCCCCCCCCCCC
Q ss_conf             --------------------3114378899998707873212454
Q gi|254780301|r   74 --------------------EYSKNITTLSKEAVAGGITSIILMP   98 (431)
Q Consensus        74 --------------------~~~~~~~~~~~~~~~~~~~~~~~~~   98 (431)
                                          ....++.++.+.+..|.++......
T Consensus        76 Ed~~~~~~~~~~~~~~~~G~~~Pst~~tGy~YA~MGYTtv~EaA~  120 (556)
T TIGR03121        76 EDHRRDPEPRTGLTRAGSGFSVPSTYATGYRYARMGYTTVFEAAV  120 (556)
T ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEECCCC
T ss_conf             441144455665433567876676567666888648525403466


No 69 
>TIGR02318 phosphono_phnM phosphonate metabolism protein PhnM; InterPro: IPR012696    This family consists of proteins from in the PhnM family. PhnM is a protein associated with phosphonate utilization in a number of bacterial species. Pseudomonas stutzeri WM88, has a related protein that is part of a system for the oxidation of phosphites (another form of reduced phosphorous compound), which is not contained in this entry..
Probab=99.93  E-value=5.4e-26  Score=185.54  Aligned_cols=82  Identities=18%  Similarity=0.336  Sum_probs=61.4

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHC-CC-CCHHHHHHHHHHHHHHHCCCC-C-CEECCCCCCCEEEECC-CCCEEECHHHH
Q ss_conf             333222222210136788867651-69-899999998815179980999-9-7246687267899869-89788537785
Q gi|254780301|r  324 FAEASFGSIGLETMLSAALRLFHG-QQ-ISLKKLIRALSTRPAQIFNLP-G-GTLQTGTAADIALIDL-NYQWTVKADDM  398 (431)
Q Consensus       324 ~~~~~~~~~~~~~~~~~~~~~~~~-~g-ls~~eal~~aT~npA~~lgl~-~-G~I~~Gk~ADlvi~D~-~~~~~i~~~~~  398 (431)
                      ..+.-...+.+...+...+.+..+ .+ |++.+|++|+|.|||+++||. + |+|++||+||||+++. +.-        
T Consensus       305 llDvL~SDY~P~SLL~AaF~La~~~~~~~~L~~A~~lvT~nPA~a~GL~DdRG~I~~G~RADl~~v~~~~~~--------  376 (391)
T TIGR02318       305 LLDVLASDYVPASLLLAAFQLADDVEGIIDLPEAVKLVTKNPARAVGLSDDRGSIAPGKRADLVRVHRREDG--------  376 (391)
T ss_pred             CCCEEECCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCCC--------
T ss_conf             730640122013455788750221267757899999986547986288888630147850448988605588--------


Q ss_pred             HCCCCCCCCCCEEEEEEEEEEEECCEEEE
Q ss_conf             20248865677278228899999999998
Q gi|254780301|r  399 SSIHKNTVFDKEFFTGKVVRTYISGKQVY  427 (431)
Q Consensus       399 ~s~~~~tp~~g~~~~g~V~~tiv~G~iVy  427 (431)
                            -|        +|+.||++||.||
T Consensus       377 ------~P--------~~r~v~r~G~~V~  391 (391)
T TIGR02318       377 ------VP--------RIRAVWRAGRRVA  391 (391)
T ss_pred             ------CC--------CEEEEEECCCCCC
T ss_conf             ------64--------0210232761339


No 70 
>cd01304 FMDH_A Formylmethanofuran dehydrogenase (FMDH) subunit A;  Methanogenic bacteria and archea derive the energy for autotrophic growth from methanogenesis, the reduction of CO2 with molecular hydrogen as the electron donor. FMDH catalyzes the first step in methanogenesis, the formyl-methanofuran synthesis. In this step, CO2 is bound to methanofuran and subsequently reduced to the formyl state with electrons derived from hydrogen.
Probab=99.92  E-value=1.6e-24  Score=176.10  Aligned_cols=87  Identities=22%  Similarity=0.303  Sum_probs=66.7

Q ss_pred             EECCEEECCCCCEE-EEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCC------------
Q ss_conf             96429999888850-00108997999998317865566678877998879889517271411478999------------
Q gi|254780301|r    6 LNNTRIIDPSRDID-EVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSP------------   72 (431)
Q Consensus         6 I~n~~iid~~~~~~-~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~------------   72 (431)
                      ||||+|+||.+++. +..||.|+||||++..+.      ...+++|||+|++||||-||+|+|+.++.            
T Consensus         1 IknG~V~DP~ngi~Ge~~DI~I~DGkIV~~~s~------~~~a~vIDa~G~vVMpGGID~HsHIaG~KVN~gR~~~PEd~   74 (541)
T cd01304           1 IKNGTVYDPLNGINGEKMDIFIRDGKIVESSSG------AKPAKVIDASGKVVMAGGVDMHSHIAGGKVNVGRILRPEDH   74 (541)
T ss_pred             CCCCEEECCCCCCCCCEEEEEEECCEEECCCCC------CCCCEEEECCCCEEECCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             998789599888888465688878989756778------88885896899888368123244656786360111177675


Q ss_pred             ----------------CCCCCCHHHHHHHHHCCCCCCCCCCC
Q ss_conf             ----------------83114378899998707873212454
Q gi|254780301|r   73 ----------------DEYSKNITTLSKEAVAGGITSIILMP   98 (431)
Q Consensus        73 ----------------~~~~~~~~~~~~~~~~~~~~~~~~~~   98 (431)
                                      .....++.++.+.+..|.++......
T Consensus        75 ~~~~~~~~~~~~~~~G~~vPst~~tGyrYA~MGYTtv~EaA~  116 (541)
T cd01304          75 RRDPVPKGALRRAGVGFSVPSTLATGYRYAEMGYTTAFEAAM  116 (541)
T ss_pred             HCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEECCCCC
T ss_conf             315444566655888875786568778998738720115556


No 71 
>cd01313 Met_dep_hydrolase_E Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.
Probab=99.92  E-value=2.3e-25  Score=181.45  Aligned_cols=73  Identities=22%  Similarity=0.262  Sum_probs=54.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCEEE--CHHHHHCCCCCCCCCCEEEEEEEEEEEECCE
Q ss_conf             16989999999881517998099997246687267899869897885--3778520248865677278228899999999
Q gi|254780301|r  347 GQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTV--KADDMSSIHKNTVFDKEFFTGKVVRTYISGK  424 (431)
Q Consensus       347 ~~gls~~eal~~aT~npA~~lgl~~G~I~~Gk~ADlvi~D~~~~~~i--~~~~~~s~~~~tp~~g~~~~g~V~~tiv~G~  424 (431)
                      ...++++++|+|+|.++||+||++-|+||+||+||||++|.+.+...  ..+++.+...++   +.  .+.|++|||+||
T Consensus       344 ~~~~~~~~vl~mAT~~GA~aLgl~iGsLe~Gk~ADlvvvD~~~p~~~~~~~~~~~~~lV~~---a~--~~~V~~V~V~Gr  418 (418)
T cd01313         344 AGGSSARALLDAALAGGAQALGLATGALEAGARADLLSLDLDHPSLAGALPDTLLDAWVFA---AG--DREVRDVVVGGR  418 (418)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHCC---CC--CCCCCEEEECCC
T ss_conf             7788899999999999999968988877876830789988999765799975699997277---99--987467984898


No 72 
>COG0402 SsnA Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only]
Probab=99.92  E-value=5.1e-24  Score=172.85  Aligned_cols=68  Identities=25%  Similarity=0.463  Sum_probs=55.0

Q ss_pred             CCCEEEECCEEECCCCCE-EEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             962699642999988885-00010899799999831786556667887799887988951727141147899
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDI-DEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~-~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      |+.++|+|..++..+... .+.+++.|+||||+.||+.....   ++.++||++|++|+|||||+|+|+...
T Consensus         1 ~~~~~i~~~~~~~~d~~~~~~~~~~~i~~g~I~~ig~~~~~~---~~~~~iD~~~~lv~Pgfvn~H~H~~~t   69 (421)
T COG0402           1 MTMLLIRGDLLLTNDPEGRIEDGDLVIEDGKIVAIGANAEGP---PDEEVIDAKGKLVLPGFVNAHTHLDQT   69 (421)
T ss_pred             CCEEEEECCEEEECCCCCCCCCCCEEEECCEEEEECCCCCCC---CCCEEECCCCCEECCCCCCCCCCHHHH
T ss_conf             960798644785036322420140798189999954677778---874365489988806962245285776


No 73 
>TIGR01975 isoAsp_dipep beta-aspartyl peptidase; InterPro: IPR010229   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This group of proteins include metallopeptidases belonging to the MEROPS peptidase family M38 (clan MJ, beta-aspartyl dipeptidase family). This entry includes the beta-aspartyl dipeptidase from Escherichia coli, (3.4.19.5 from EC, IadA), which degrades isoaspartyl dipeptides and may unblock degradation of proteins that cannot be repaired. This entry also describes closely related proteins from other species (e.g. Clostridium perfringens, Thermoanaerobacter tengcongensis) that may have an equivalent in function. This family shows homology to dihydroorotases. The L-isoaspartyl derivative of Asp arises non-enzymatically over time as a form of protein damage. In this isomerisation, the connectivity of the polypeptide changes to pass through the beta-carboxyl of the side chain. Much but not all of this damage can be repaired by protein-L-isoaspartate (D-aspartate) O-methyltransferase..
Probab=99.90  E-value=2.3e-23  Score=168.61  Aligned_cols=138  Identities=17%  Similarity=0.128  Sum_probs=96.3

Q ss_pred             EEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEEC-CCCEEECCEEECCCCCCCCCCCC---CCCH
Q ss_conf             6996429999888850001089979999983178655666788779988-79889517271411478999831---1437
Q gi|254780301|r    4 FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDC-TGLVAVPGIIDARVTLTGSPDEY---SKNI   79 (431)
Q Consensus         4 llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~-~G~~v~PGlID~H~Hl~~~~~~~---~~~~   79 (431)
                      .||||..||+|+.  +...||+|-++||.+|.+++......-+.+||+. +|+++.|||||.|+|+-++|.+.   ..+.
T Consensus         2 ~llkg~~vY~Pe~--~GkkD~li~~~ki~~i~d~i~~~k~~~~~~vv~~~eG~i~vPGfID~HVHiiGGGGEgG~~TRTP   79 (391)
T TIGR01975         2 TLLKGLEVYAPEY--IGKKDILIVSDKIIAIADEIELTKDFVEVEVVEGLEGMIAVPGFIDQHVHIIGGGGEGGPKTRTP   79 (391)
T ss_pred             CCCCCCCCCCCCC--CCCCCEEEECCEEEEEECCCCCCCCCCCCEEEECCCCCEECCCCCCCCEEEEECCCCCCCCCCCH
T ss_conf             2011551358888--88421799788489860376566651253388157770873874147457840576886888843


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCC
Q ss_conf             8899998707873212454556643331667777677664310122321000134432222222
Q gi|254780301|r   80 TTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISE  143 (431)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  143 (431)
                      +-.......+|.|+.--...+....+..............+........+.+............
T Consensus        80 E~~Ls~~t~~GvTtvVG~lGTDgi~R~m~~L~AKArAL~eEGvs~y~ltGaY~vP~~TlTgsv~  143 (391)
T TIGR01975        80 ELTLSDITKGGVTTVVGLLGTDGITRDMESLLAKARALEEEGVSCYVLTGAYEVPVRTLTGSVK  143 (391)
T ss_pred             HHECCCEEECCCEEEEEEEECCCCCCCCHHHHHHHHHHHHCCEEEEEEECCEECCCCCCCCCEE
T ss_conf             2230120112624898886278622584678999986520782699963331355200151124


No 74 
>PRK13308 ureC urease subunit alpha; Reviewed
Probab=99.89  E-value=2.7e-22  Score=161.77  Aligned_cols=70  Identities=31%  Similarity=0.503  Sum_probs=56.2

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCC----C-----CCCCCCCEEEECCCCEEECCEEECCCCCCCCCC
Q ss_conf             2699642999988885000108997999998317865----5-----666788779988798895172714114789998
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADAL----N-----AKFPTSALIHDCTGLVAVPGIIDARVTLTGSPD   73 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~----~-----~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~   73 (431)
                      |++|+|+.|+|...++ .++||.|+||||+.||+...    +     .-..++.++|.++|+++++|-||+|+|+-.|.+
T Consensus        69 D~VITNa~IiD~~~GI-~KADIGIkdGrI~~IGKAGNPd~mdgV~p~~viG~~TevIagEg~I~TAGgiDtHvHfi~Pqq  147 (569)
T PRK13308         69 DFVLCNATVIDPVLGI-VKGDIGIRDGRIVGIGKAGNPDIMDGVDPRLVVGAGTTVRDAEGLIATPGAIDVHVHFDSAGL  147 (569)
T ss_pred             CEEEECCEEEECCCCE-EEEEECCCCCEEEEEECCCCCCCCCCCCCCEEECCCCCEECCCCCEEECCCEEEEEEECCHHH
T ss_conf             4798471998067777-971212227779774247896656799988177778525737851660363045666338778


No 75 
>cd01300 YtcJ_like YtcJ_like metal dependent amidohydrolases. YtcJ is a Bacillus subtilis ORF of unknown function. The Arabidopsis homolog LAF3 has been identified as a factor required for photochrome A signalling.
Probab=99.89  E-value=2.3e-23  Score=168.64  Aligned_cols=49  Identities=31%  Similarity=0.410  Sum_probs=41.4

Q ss_pred             EEEEECCEEEEECCCCCCC-CCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             0899799999831786556-667887799887988951727141147899
Q gi|254780301|r   23 AIIVENGIILAAGADALNA-KFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus        23 ~I~I~~gkI~~Ig~~~~~~-~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      .|+|+||||++||+..+.. ..+++++|||++|++|+|||||+|+|+...
T Consensus         1 AV~V~dgrI~aVG~~~~~~~~~~~~~~vID~~G~~V~PGfID~H~H~~~~   50 (479)
T cd01300           1 AVAVRDGRIVAVGSDAEAKALKGPATEVIDLKGKTVLPGFIDSHSHLLLG   50 (479)
T ss_pred             CEEEECCEEEEECCHHHHHHCCCCCCEEEECCCCEECCCCCHHHHCHHHH
T ss_conf             98998999999898689863079999899899999851650255475678


No 76 
>TIGR01792 urease_alph urease, alpha subunit; InterPro: IPR005848    Urease (urea amidohydrolase, 3.5.1.5 from EC) catalyses the hydrolysis of urea to form ammonia and carbamate. The subunit composition of urease from different sources varies , but each holoenzyme consists of four structural domains : three structural domains and a nickel-binding catalytic domain common to amidohydrolases . Urease is unique among nickel metalloenzymes in that it catalyses a hydrolysis rather than a redox reaction. In Helicobacter pylori, the gamma and beta domains are fused and called the alpha subunit (IPR008223 from INTERPRO). The catalytic subunit (called beta or B) has the same organization as the Klebsiella alpha subunit. Jack bean (Canavalia ensiformis) urease has a fused gamma-beta-alpha organization (IPR008221 from INTERPRO). This entry describes the urease alpha subunit UreC (designated beta or B chain, UreB in Helicobacter species).    Urease (3.5.1.5 from EC) belongs to MEROPS peptidase family M38 (clan MJ). ; GO: 0009039 urease activity, 0016151 nickel ion binding, 0006807 nitrogen compound metabolic process.
Probab=99.89  E-value=1.1e-23  Score=170.68  Aligned_cols=174  Identities=18%  Similarity=0.124  Sum_probs=94.9

Q ss_pred             CEEEECCEEECC-CCCEEEEEEEEEECCEEEEECCCCCCCC----------CCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             269964299998-8885000108997999998317865566----------67887799887988951727141147899
Q gi|254780301|r    3 SFVLNNTRIIDP-SRDIDEVGAIIVENGIILAAGADALNAK----------FPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         3 ~llI~n~~iid~-~~~~~~~~~I~I~~gkI~~Ig~~~~~~~----------~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      ||+|+||.|+|- ++  +.++||.|+||||+.||+.- +++          ....+++|-++|++++-|=||+|+|+-.|
T Consensus        73 DLVITNAlIlD~i~G--IyKADIGiknG~I~~IGKaG-NPd~mDgVd~G~ivGasTe~IsGEg~I~TAGGiDtHVHyi~P  149 (605)
T TIGR01792        73 DLVITNALILDYITG--IYKADIGIKNGKIVGIGKAG-NPDTMDGVDDGIIVGASTEVISGEGKIVTAGGIDTHVHYISP  149 (605)
T ss_pred             CCCCCCEEEEEEECC--EEEEEEECCCCEEEEECCCC-CCCCCCCCCCCEEECCCHHHHHCCCCEEECCCCEEEEEEECC
T ss_conf             100024135532165--68844410077477732688-668888887455878862300026610104864046786064


Q ss_pred             CCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCH-----HHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCC
Q ss_conf             9831143788999987078732124545566433316-----67777677664310122321000134432222222100
Q gi|254780301|r   72 PDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEY-----TFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRL  146 (431)
Q Consensus        72 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  146 (431)
                      .+         ...|...|.|...-............     ..............-.+.....-.....    ......
T Consensus       150 ~~---------~~~AL~~GITT~~GGGTGpadGt~atT~tpG~w~~~~ml~a~dglPiN~G~~gKG~~s~----~~al~E  216 (605)
T TIGR01792       150 QQ---------VQAALDSGITTLIGGGTGPADGTKATTCTPGPWYLHRMLQAADGLPINIGFTGKGSASG----PEALVE  216 (605)
T ss_pred             CH---------HHHHHCCCCEEEECCCCCCCCCCCCEEECCCHHHHHHHHHHHCCCCCCCCEEEECCCCC----HHHHHH
T ss_conf             37---------88985289879972743546787545427737999999997546751012352045453----237999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             0001122223433322221101245676542101222233322222
Q gi|254780301|r  147 LQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLG  192 (431)
Q Consensus       147 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  192 (431)
                      ...+..........+.........+.............|.......
T Consensus       217 ~i~AGA~GlKvHEDWGATp~aId~aL~vAd~yDVqvA~HtDTLNE~  262 (605)
T TIGR01792       217 QIEAGACGLKVHEDWGATPAAIDNALSVADEYDVQVAVHTDTLNES  262 (605)
T ss_pred             HHHHHHCEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             9986100002123657768899999987530680288823422553


No 77 
>COG3653 N-acyl-D-aspartate/D-glutamate deacylase [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=99.89  E-value=1.9e-21  Score=156.33  Aligned_cols=66  Identities=21%  Similarity=0.328  Sum_probs=56.6

Q ss_pred             CCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCC
Q ss_conf             62699642999988885000108997999998317865566678877998879889517271411478
Q gi|254780301|r    2 TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLT   69 (431)
Q Consensus         2 ~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~   69 (431)
                      .|++||++.|||++++.....||.|+||+|++|++.....  .-+.++||+.|++|.|||||+|+|-.
T Consensus         6 YD~ViR~g~ifDGtGnp~f~tdvgIrDGvIaav~kg~~dg--~~~~eevDaagriVaPGFIDvHtHyD   71 (579)
T COG3653           6 YDVVIRDGLIFDGTGNPPFTTDVGIRDGVIAAVAKGALDG--TGCPEEVDAAGRIVAPGFIDVHTHYD   71 (579)
T ss_pred             EEEEEEECEEEECCCCCCCCCCCCCCCCEEEEEECCCCCC--CCCCEEECCCCCEECCCEEEEEECCC
T ss_conf             2478850359857999864122122355589986133335--68873552668675266777554156


No 78 
>PRK07572 cytosine deaminase; Validated
Probab=99.89  E-value=1.4e-23  Score=169.94  Aligned_cols=60  Identities=17%  Similarity=0.233  Sum_probs=49.9

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCC
Q ss_conf             26996429999888850001089979999983178655666788779988798895172714114789
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG   70 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~   70 (431)
                      |+||+|+++-++.    ...||+|+||||++|+|...    .++.++||++|++|+|||||+|+|+..
T Consensus         2 dlli~n~rl~~g~----~~~DI~I~dGrIaai~p~~~----~~~~~~iDa~G~LvlPgfVd~H~HLDk   61 (425)
T PRK07572          2 DLIVRNANLPDGR----RGIDIGIAGGRIAAVEPGLA----APAGEEIDAAGRLVSPPFVDPHFHMDA   61 (425)
T ss_pred             CEEEECCCCCCCC----CEEEEEEECCEEEEECCCCC----CCCCCEEECCCCEECCCCCCCEECHHH
T ss_conf             6568535738998----35539998999999627999----998775879998768787760058545


No 79 
>TIGR02967 guan_deamin guanine deaminase; InterPro: IPR014311   This entry describes guanine deaminase, which hydrolyzes guanine to xanthine and ammonia. Xanthine can then be converted to urate by xanthine dehydrogenase. In some bacteria, the guanine deaminase gene is found near the xdhABC genes for xanthine dehydrogenase. Non-homologous forms of guanine deaminase also exist, as well as more distantly related homologs which are not included in this entry. .
Probab=99.89  E-value=6.4e-23  Score=165.74  Aligned_cols=53  Identities=34%  Similarity=0.515  Sum_probs=45.3

Q ss_pred             EEEEEEEEEECCEEEEE----CCCCC-CC---CCCCCCEEEECCCC-EEECCEEECCCCCCC
Q ss_conf             50001089979999983----17865-56---66788779988798-895172714114789
Q gi|254780301|r   18 IDEVGAIIVENGIILAA----GADAL-NA---KFPTSALIHDCTGL-VAVPGIIDARVTLTG   70 (431)
Q Consensus        18 ~~~~~~I~I~~gkI~~I----g~~~~-~~---~~~~~~~vID~~G~-~v~PGlID~H~Hl~~   70 (431)
                      +.++|=|+|++|||+++    |+-.. ..   ..+++.+|.|.+++ +|+|||||+|+|..+
T Consensus         3 ~~~DGLl~v~~G~i~~~~PD~g~~~~l~~LK~~~~~~~~~~~~~~~~Li~PGFIDTHiHyPQ   64 (426)
T TIGR02967         3 YFEDGLLVVENGRIVAVLPDKGDYAELLKLKDTLPAGVEIEDYRGKQLIIPGFIDTHIHYPQ   64 (426)
T ss_pred             EECCCEEEEECCEEEEECCCCCCHHHHHHHHHHCCCCCEEEECCCCEEECCCCHHCCCCCCC
T ss_conf             65273588738889983278888889999997348995588838853665670210566022


No 80 
>COG3964 Predicted amidohydrolase [General function prediction only]
Probab=99.89  E-value=8.7e-23  Score=164.90  Aligned_cols=71  Identities=35%  Similarity=0.498  Sum_probs=60.7

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCCCCCC
Q ss_conf             962699642999988885000108997999998317865566678877998879889517271411478999831
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEY   75 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~~   75 (431)
                      |.++||+|++++||..+..+..+|+|.||||+++++    ...|.+.++||++|++|.||+||.|+|....+...
T Consensus         3 qfdiLLt~~rlidpa~g~d~~tniai~ngkIaa~~d----~~apa~tq~Ida~Gc~VspG~iDlHvHvy~ggt~~   73 (386)
T COG3964           3 QFDILLTGGRLIDPARGIDEITNIAIINGKIAAADD----YPAPAETQIIDADGCIVSPGLIDLHVHVYYGGTEG   73 (386)
T ss_pred             CCCEEEECCEECCCCCCCCCCCEEEEECCEEEECCC----CCCCHHHEEECCCCCEECCCEEEEEEEEECCCCCC
T ss_conf             654331097664653566753304642573875367----68971331873676275367654456784389756


No 81 
>PRK07583 cytosine deaminase; Validated
Probab=99.88  E-value=6.1e-22  Score=159.47  Aligned_cols=66  Identities=18%  Similarity=0.205  Sum_probs=50.8

Q ss_pred             CEEEECCEEECC----------CCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             269964299998----------888500010899799999831786556667887799887988951727141147899
Q gi|254780301|r    3 SFVLNNTRIIDP----------SRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         3 ~llI~n~~iid~----------~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      .+.|||++|=..          +..-+...||+|+||||++|+|...   .+++.++||++|++|+|||||+|+||...
T Consensus        12 ~~~l~n~rl~~~~~~~~~~~~~~~~~l~~vDi~I~dGrIa~I~P~~~---~~~~~~~iD~~G~LvlPgfvd~H~HLDK~   87 (437)
T PRK07583         12 RYWLKNAHVPAALLEGGVPGPPDREGLVLVDLEIADGKIAAILPAGS---APPGLPAVDLKGRMVWPCFVDMHTHLDKG   87 (437)
T ss_pred             CEEEECCEECCEEEECCCCCCCCCCCEEEEEEEEECCEEEEECCCCC---CCCCCCCEECCCCEECCCCCCCCCCCCCC
T ss_conf             67995624434476368645677774179889997999988616988---99998608299998797766732687789


No 82 
>PRK13207 ureC urease subunit alpha; Reviewed
Probab=99.88  E-value=1.2e-21  Score=157.54  Aligned_cols=82  Identities=27%  Similarity=0.371  Sum_probs=61.0

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCC--------CCCCCEEEECCCCEEECCEEECCCCCCCCCCC
Q ss_conf             2699642999988885000108997999998317865566--------67887799887988951727141147899983
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAK--------FPTSALIHDCTGLVAVPGIIDARVTLTGSPDE   74 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~--------~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~~   74 (431)
                      |++|+|+.|+|..+ + .++||.|+||||++||+.. ++.        ..++.++|.++|++++||-||+|+|+-.|.+ 
T Consensus        68 D~vitna~iiD~~G-I-~KaDiGikdG~I~~iGkaG-NPd~mdgV~~viG~~Teviageg~I~TaGgiDtHvHfi~Pqq-  143 (568)
T PRK13207         68 DTVITNALILDHWG-I-VKADIGIKDGRIAAIGKAG-NPDIQDGVDIIIGPGTEVIAGEGLIVTAGGIDTHIHFICPQQ-  143 (568)
T ss_pred             CEEEEEEEEECCCC-C-EECCCCCCCCEEEEEECCC-CCCCCCCCEEEECCCCCEECCCCCEEECCCEEEEEEECCHHH-
T ss_conf             28996249962666-1-7633441167687620478-966467842885278525717740771261166553058878-


Q ss_pred             CCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             1143788999987078732124
Q gi|254780301|r   75 YSKNITTLSKEAVAGGITSIIL   96 (431)
Q Consensus        75 ~~~~~~~~~~~~~~~~~~~~~~   96 (431)
                              ...+...|.+...-
T Consensus       144 --------~~~Al~sGiTT~iG  157 (568)
T PRK13207        144 --------IEEALASGVTTMIG  157 (568)
T ss_pred             --------HHHHHHCCCEEEEC
T ss_conf             --------99998558668745


No 83 
>PRK13985 UreB urease subunit beta; Provisional
Probab=99.88  E-value=1.7e-21  Score=156.59  Aligned_cols=68  Identities=21%  Similarity=0.315  Sum_probs=54.6

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCC---------CCCCCCCCEEEECCCCEEECCEEECCCCCCCCC
Q ss_conf             2699642999988885000108997999998317865---------566678877998879889517271411478999
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADAL---------NAKFPTSALIHDCTGLVAVPGIIDARVTLTGSP   72 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~---------~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~   72 (431)
                      |++|+|+.|+|-. ++ .++||.|+||||+.||+...         ..-..++.++|.++|+++++|-||+|+|+-.|.
T Consensus        66 D~VITNalIiD~~-GI-~KADIGIkdG~I~gIGKAGNPd~mdgV~p~lviG~~TeviagEg~I~TaGgiDtHvHfi~Pq  142 (568)
T PRK13985         66 DLIITNALIVDYT-GI-YKADIGIKDGKIAGIGKGGNKDMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHFISPQ  142 (568)
T ss_pred             CEEEEEEEEEECC-CE-EECCCCCCCCEEEEEECCCCCCCCCCCCCCEEECCCCCEECCCCCEEEECCEEEEEEECCHH
T ss_conf             5788504997337-65-87400232776977434789765678888807777853573783189734426576643888


No 84 
>cd00375 Urease_alpha Urease alpha-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide. Nickel-dependent ureases are found in bacteria, fungi and plants. Their primary role is to allow the use of external and internally generated urea as a nitrogen source. The enzyme consists of 3 subunits, alpha, beta and gamma, which can be fused and present on a single protein chain and which in turn forms multimers, mainly trimers. The large alpha subunit is the catalytic domain containing an active site with a bi-nickel center complexed by a carbamylated lysine. The beta and gamma subunits play a role in subunit association to form the higher order trimers.
Probab=99.88  E-value=1.6e-21  Score=156.82  Aligned_cols=68  Identities=25%  Similarity=0.303  Sum_probs=55.2

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCC----C-----CCCCCCCEEEECCCCEEECCEEECCCCCCCCC
Q ss_conf             2699642999988885000108997999998317865----5-----66678877998879889517271411478999
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADAL----N-----AKFPTSALIHDCTGLVAVPGIIDARVTLTGSP   72 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~----~-----~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~   72 (431)
                      |++|+|+.|+|..+ + .++||.|+||||+.||+...    +     .-..++.++|.++|+++++|-||+|+|+-.|.
T Consensus        66 D~VITNalIiD~~G-I-~KADIGIkdGrI~~IGKAGNPd~mdgV~p~~viG~~TevIagEg~I~TAGgiDtHvHfi~Pq  142 (567)
T cd00375          66 DLVITNALIIDYTG-I-YKADIGIKDGRIVAIGKAGNPDIMDGVTPNMIVGPSTEVIAGEGKIVTAGGIDTHVHFICPQ  142 (567)
T ss_pred             CEEEECEEEECCCC-E-EECEECCCCCEEEEEECCCCCCCCCCCCCCEEECCCCCEECCCCEEEECCCEEEEEEECCHH
T ss_conf             58996639964776-1-76300333777977424789765678998807777852573784067326216788843888


No 85 
>PRK13309 ureC urease subunit alpha; Reviewed
Probab=99.88  E-value=1.3e-21  Score=157.39  Aligned_cols=84  Identities=17%  Similarity=0.251  Sum_probs=61.2

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCC----C-----CCCCCCCEEEECCCCEEECCEEECCCCCCCCCC
Q ss_conf             2699642999988885000108997999998317865----5-----666788779988798895172714114789998
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADAL----N-----AKFPTSALIHDCTGLVAVPGIIDARVTLTGSPD   73 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~----~-----~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~   73 (431)
                      |++|+|+.|+|+..++ .++||.|+||||+.||+...    +     .-..++.++|.++|+++++|-||+|+|+-.|.+
T Consensus        69 D~VITNalIiD~~~GI-~KADIGIkdG~I~gIGKAGNPd~mdgV~p~~viG~~TeviaGEg~I~TAGgiDtHvHfi~Pqq  147 (572)
T PRK13309         69 DLVITNVTIVDARLGV-IKADVGIRDGKIAGIGKSGNPGVMDGVTQGMVVGVSTDAISGEHLILTAAGIDSHIHLISPQQ  147 (572)
T ss_pred             CEEEECEEEEECCCCE-EECCCCCCCCEEEEEECCCCCCCCCCCCCCEEECCCCCEECCCCEEEECCCCCCEEECCCHHH
T ss_conf             5899670998467776-974214437779763247897656799888077678525737741650365321000047788


Q ss_pred             CCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             31143788999987078732124
Q gi|254780301|r   74 EYSKNITTLSKEAVAGGITSIIL   96 (431)
Q Consensus        74 ~~~~~~~~~~~~~~~~~~~~~~~   96 (431)
                               ...+...|.+...-
T Consensus       148 ---------~~~AL~sGiTT~iG  161 (572)
T PRK13309        148 ---------AYHALSNGVATFFG  161 (572)
T ss_pred             ---------HHHHHHCCCEEEEC
T ss_conf             ---------99998568768756


No 86 
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.
Probab=99.88  E-value=8.6e-23  Score=164.91  Aligned_cols=52  Identities=21%  Similarity=0.356  Sum_probs=44.2

Q ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCC--CEECCCCCCCEEEECCC
Q ss_conf             36788867651698999999988151799809999--72466872678998698
Q gi|254780301|r  337 MLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPG--GTLQTGTAADIALIDLN  388 (431)
Q Consensus       337 ~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~--G~I~~Gk~ADlvi~D~~  388 (431)
                      ..........+.++|+.|||+|+|+||||+||+++  |||+|||+|||||||-|
T Consensus       281 ~~~~~~~~~~~~gl~~~eal~~aT~n~A~~lgl~~~~GsL~~Gk~ADlVv~D~d  334 (342)
T cd01299         281 WNARELELLVKAGGTPAEALRAATANAAELLGLSDELGVIEAGKLADLLVVDGD  334 (342)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCEECCCCCCCEEEECCC
T ss_conf             999999999983999999999999999999689999770698985448998898


No 87 
>PRK13206 ureC urease subunit alpha; Reviewed
Probab=99.88  E-value=2.1e-21  Score=155.94  Aligned_cols=83  Identities=28%  Similarity=0.306  Sum_probs=61.0

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCC---------CCCCCCCCEEEECCCCEEECCEEECCCCCCCCCC
Q ss_conf             2699642999988885000108997999998317865---------5666788779988798895172714114789998
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADAL---------NAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPD   73 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~---------~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~   73 (431)
                      |++|+|+.|+|..+ + .++||.|+||||+.||+...         ..-..++.++|.++|+++++|-||+|+|+-.|.+
T Consensus        72 D~VITnalIiD~~G-I-~KADIGIkdG~I~gIGKAGNPd~mdgV~~~~viG~~TevIagEg~I~TAGgiDtHvHfi~Pqq  149 (573)
T PRK13206         72 DTVITGAVILDHWG-I-IKADIGIRDGRIVGIGKAGNPDIMDGVHPDLVVGPSTEIIAGNGRILTAGAIDCHVHLICPQI  149 (573)
T ss_pred             CEEEECEEEECCCC-C-EEEEECCCCCEEEEEECCCCCCCCCCCCCCEEECCCCCEECCCCEEEECCCEEEEEEECCHHH
T ss_conf             57995539971677-3-781321117779774247896556789888387788635737830772373368898448888


Q ss_pred             CCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             31143788999987078732124
Q gi|254780301|r   74 EYSKNITTLSKEAVAGGITSIIL   96 (431)
Q Consensus        74 ~~~~~~~~~~~~~~~~~~~~~~~   96 (431)
                               ...+...|.+...-
T Consensus       150 ---------~~~AL~sGiTT~iG  163 (573)
T PRK13206        150 ---------VDEALGAGITTIIG  163 (573)
T ss_pred             ---------HHHHHHCCCEEEEC
T ss_conf             ---------99998669706745


No 88 
>cd01295 AdeC Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine. This reaction is part of one of the adenine salvage pathways, as well as the degradation pathway. It is important for adenine utilization as a purine, as well as a nitrogen source in bacteria and archea.
Probab=99.87  E-value=3.9e-21  Score=154.28  Aligned_cols=69  Identities=20%  Similarity=0.268  Sum_probs=55.7

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCC-CEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCCCEEEEEEEE
Q ss_conf             788867651698999999988151799809999-7246687267899869897885377852024886567727822889
Q gi|254780301|r  339 SAALRLFHGQQISLKKLIRALSTRPAQIFNLPG-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV  417 (431)
Q Consensus       339 ~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~-G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~g~~~~g~V~  417 (431)
                      ........+.|++|.+|++|+|+|||+.||+++ |+|+|||+|||||||--.       +            .    +|+
T Consensus       224 d~~vr~Av~~Gl~p~~Ai~maT~NpA~~~gl~d~GsIapGk~ADiVilddl~-------~------------~----~~~  280 (422)
T cd01295         224 DYIVRRAIEAGIPPEDAIQMATINPAECYGLHDLGAIAPGRIADIVILDDLE-------N------------F----NIT  280 (422)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCCC-------C------------C----CCE
T ss_conf             9999999985999999999987519998599776674787687989988766-------6------------8----720


Q ss_pred             EEEECCEEEEEEC
Q ss_conf             9999999998624
Q gi|254780301|r  418 RTYISGKQVYTLE  430 (431)
Q Consensus       418 ~tiv~G~iVy~~e  430 (431)
                      .||++|..|.+|-
T Consensus       281 ~v~~~G~~v~eR~  293 (422)
T cd01295         281 TVLAKGIAVVERH  293 (422)
T ss_pred             EEEECCEEEEEEC
T ss_conf             5888879998741


No 89 
>PRK09230 cytosine deaminase; Provisional
Probab=99.87  E-value=5.1e-22  Score=159.96  Aligned_cols=65  Identities=22%  Similarity=0.320  Sum_probs=52.2

Q ss_pred             CC--CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             96--269964299998888500010899799999831786556667887799887988951727141147899
Q gi|254780301|r    1 MT--SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         1 M~--~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      |.  .|||+|+++-+..+    -.||.|+||||++|+|....  .+.+.++||++|++++|||+|+|+|+...
T Consensus         1 ~~~~~lli~n~rl~~~~~----l~DI~I~dGrI~aI~p~~~~--~~~~~~~iD~~G~LvlP~fvd~H~HLDKt   67 (426)
T PRK09230          1 MNNALMTIKNVRLPGKEG----LWQITIEDGKISAIEPQEEA--SLDTGEVLDAEGGLAIPPFIEPHIHLDTT   67 (426)
T ss_pred             CCCCEEEEEEEECCCCCC----EEEEEEECCEEEEEECCCCC--CCCCCCEEECCCCEECCCCCCCEECCCCC
T ss_conf             976548998444189984----36599979999997368888--88887668389987477866610332324


No 90 
>COG3454 Metal-dependent hydrolase involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=99.86  E-value=1.6e-21  Score=156.67  Aligned_cols=76  Identities=24%  Similarity=0.327  Sum_probs=56.7

Q ss_pred             CCCCCCHHHHHHHHHHHCCC-CCHHHHHHHHHHHHHHHCCCC-CCEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCC
Q ss_conf             22221013678886765169-899999998815179980999-9724668726789986989788537785202488656
Q gi|254780301|r  330 GSIGLETMLSAALRLFHGQQ-ISLKKLIRALSTRPAQIFNLP-GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVF  407 (431)
Q Consensus       330 ~~~~~~~~~~~~~~~~~~~g-ls~~eal~~aT~npA~~lgl~-~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~  407 (431)
                      ....+...+...+.+..... +|+.+|++|+|.|||+++|+. +|+|++|++||||.+-++..              .| 
T Consensus       300 SDY~P~SLl~A~F~La~~~~~~~lpqAvalvt~nPA~algl~DRG~Ia~GlrADlv~v~~~~~--------------vp-  364 (377)
T COG3454         300 SDYVPASLLHAAFRLADLGSNISLPQAVALVTKNPARALGLTDRGRIAPGLRADLVRVRRDGG--------------VP-  364 (377)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHCCCCCCCCCCCCCCCCEEEEECCCC--------------CC-
T ss_conf             467738888888998664025678999999606978861977466505664344589732799--------------75-


Q ss_pred             CCEEEEEEEEEEEECCEEEE
Q ss_conf             77278228899999999998
Q gi|254780301|r  408 DKEFFTGKVVRTYISGKQVY  427 (431)
Q Consensus       408 ~g~~~~g~V~~tiv~G~iVy  427 (431)
                             .|+.||+.||.||
T Consensus       365 -------~ir~vwr~G~rv~  377 (377)
T COG3454         365 -------VIRTVWRAGKRVA  377 (377)
T ss_pred             -------EEEEEEECCEECC
T ss_conf             -------4445445454439


No 91 
>KOG3968 consensus
Probab=99.86  E-value=5.5e-21  Score=153.29  Aligned_cols=77  Identities=19%  Similarity=0.265  Sum_probs=58.1

Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCC--CEECCCCCCCEEEECCCCCE----EEC-HHHHHCCCCCCCCCCEEEEEEEEEE
Q ss_conf             1698999999988151799809999--72466872678998698978----853-7785202488656772782288999
Q gi|254780301|r  347 GQQISLKKLIRALSTRPAQIFNLPG--GTLQTGTAADIALIDLNYQW----TVK-ADDMSSIHKNTVFDKEFFTGKVVRT  419 (431)
Q Consensus       347 ~~gls~~eal~~aT~npA~~lgl~~--G~I~~Gk~ADlvi~D~~~~~----~i~-~~~~~s~~~~tp~~g~~~~g~V~~t  419 (431)
                      ...||++|+|.+||+|+|++||+++  |++|+||++|++++|++.+.    .+. .+++.++.-++- .++    .+..|
T Consensus       355 ~~~Ls~~e~L~lATi~GA~aLg~d~~~Gs~eVGK~fDai~id~s~~~~~l~~~~~~~~lI~~~v~~g-~dr----ni~~V  429 (439)
T KOG3968         355 VMKLSMEEALYLATIGGAKALGRDDTHGSLEVGKYFDAIIIDLSAPESPLYRFSGHHDLISKVVYNG-DDR----NIAEV  429 (439)
T ss_pred             CCCCCHHHHHHHHHCCCHHHCCCCCCCCCEECCCCCCEEEEECCCCCCHHHHCCCHHHHHHHHHHCC-CCC----CEEEE
T ss_conf             3248999999998505165406777656542145355699847987652554014689999997407-887----55899


Q ss_pred             EECCEEEEE
Q ss_conf             999999986
Q gi|254780301|r  420 YISGKQVYT  428 (431)
Q Consensus       420 iv~G~iVy~  428 (431)
                      ||+||.|++
T Consensus       430 ~V~Gk~v~~  438 (439)
T KOG3968         430 FVAGKLVKQ  438 (439)
T ss_pred             EECCEEECC
T ss_conf             985589316


No 92 
>COG1229 FwdA Formylmethanofuran dehydrogenase subunit A [Energy production and conversion]
Probab=99.82  E-value=5.4e-19  Score=140.44  Aligned_cols=66  Identities=24%  Similarity=0.418  Sum_probs=54.0

Q ss_pred             CCCEEEECCEEECCCCCEE-EEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCCC
Q ss_conf             9626996429999888850-0010899799999831786556667887799887988951727141147899
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDID-EVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGS   71 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~-~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~   71 (431)
                      |..++||||.|+||.+++. +..||.|+||||++-..-     ....++||||+|+++|||-+|+|+|+.++
T Consensus         2 ~~e~~IKNg~V~dPlngingEkMDI~vkdGKIVe~sev-----~~~~aKVIDA~gklvm~GGvD~HsHvAGa   68 (575)
T COG1229           2 AMEILIKNGIVYDPLNGINGEKMDICVKDGKIVEESEV-----SESKAKVIDASGKLVMPGGVDSHSHVAGA   68 (575)
T ss_pred             CCEEEEECCEEECCCCCCCCCEEEEEEECCEEEECCCC-----CCCCCEEEECCCCEEECCCCCCCCCCCCC
T ss_conf             70489716788767667777466678646807400123-----76653488246868734753543323456


No 93 
>pfam01979 Amidohydro_1 Amidohydrolase family. This family of enzymes are a a large metal dependent hydrolase superfamily. The family includes Adenine deaminase EC:3.5.4.2 that hydrolyses adenine to form hypoxanthine and ammonia. Adenine deaminases reaction is important for adenine utilisation as a purine and also as a nitrogen source. This family also includes dihydroorotase and N-acetylglucosamine-6-phosphate deacetylases, EC:3.5.1.25 These enzymes catalyse the reaction N-acetyl-D-glucosamine 6-phosphate + H2O <= D-glucosamine 6-phosphate + acetate. This family includes the catalytic domain of urease alpha subunit. Dihydroorotases (EC:3.5.2.3) are also included.
Probab=99.81  E-value=1.2e-19  Score=144.66  Aligned_cols=52  Identities=21%  Similarity=0.362  Sum_probs=44.1

Q ss_pred             CHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC-C-CEECCCCCCCEEEEC
Q ss_conf             013678886765169899999998815179980999-9-724668726789986
Q gi|254780301|r  335 ETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP-G-GTLQTGTAADIALID  386 (431)
Q Consensus       335 ~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~-~-G~I~~Gk~ADlvi~D  386 (431)
                      ..............++|++|+|+++|.||||+||++ + |+|+|||+|||||||
T Consensus       254 ~~~~~~~~~~~~~~g~~~~~al~~aT~n~A~~lgl~~~~G~I~~Gk~ADlvi~D  307 (307)
T pfam01979       254 GAGLNGKDFYLDPDGLSPIEALRMATINPAKALGLDDRVGSIEVGKDADLVVVD  307 (307)
T ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEECCCCCCCEEEEC
T ss_conf             266789987442579999999999999999996899992554878837879869


No 94 
>COG0804 UreC Urea amidohydrolase (urease) alpha subunit [Amino acid transport and metabolism]
Probab=99.77  E-value=2.3e-18  Score=136.37  Aligned_cols=68  Identities=24%  Similarity=0.251  Sum_probs=54.3

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCC-------CCCCCCCEEEECCCCEEECCEEECCCCCCCCC
Q ss_conf             26996429999888850001089979999983178655-------66678877998879889517271411478999
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALN-------AKFPTSALIHDCTGLVAVPGIIDARVTLTGSP   72 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~-------~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~   72 (431)
                      |++|+|+.|+|-.+ + .++||.|+||||++||+....       .-..+..++|-++|++++.|-||+|+|+-.|.
T Consensus        68 D~VITNa~IiD~~G-i-~KADiGikdGrI~~IGKaGNPd~~dgV~iiiG~sTe~iagEg~I~TAGGiDtHiHfI~Pq  142 (568)
T COG0804          68 DLVITNALIIDYWG-I-VKADIGIKDGRIAGIGKAGNPDIMDGVTIIIGPSTEIIAGEGKIVTAGGIDTHIHFICPQ  142 (568)
T ss_pred             CEEEEEEEEEECCC-E-EEEECCCCCCEEEEEECCCCCCCCCCCEEEECCCCCEECCCCEEEEECCCCCEEEEECHH
T ss_conf             27885138983245-2-773013336669985258998756881398526521002773389605532126886678


No 95 
>PRK06846 deaminase; Validated
Probab=99.76  E-value=3.5e-17  Score=128.76  Aligned_cols=68  Identities=16%  Similarity=0.251  Sum_probs=52.3

Q ss_pred             CCCEEEECCEEECC---C-----CCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEECCCCEEECCEEECCCCCCC
Q ss_conf             96269964299998---8-----8850001089979999983178655666788779988798895172714114789
Q gi|254780301|r    1 MTSFVLNNTRIIDP---S-----RDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG   70 (431)
Q Consensus         1 M~~llI~n~~iid~---~-----~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~   70 (431)
                      |+.+.|||++|=++   .     +......||.|+||||++|.+...  ..+++.++||++|++++|||||+|+||..
T Consensus         3 ~~~ywl~n~~le~~~~~~~~~~~~t~t~l~di~I~dGkI~~I~~~~~--~~~~~~~~iDa~G~LvlP~fvd~H~HLDK   78 (410)
T PRK06846          3 DPHYWLTNVRLETGFDYENGVIVQTETARYTLEIQDGKIVAIRENKV--HPEATLPHYDANGLLMLPAFREMHIHLDK   78 (410)
T ss_pred             CCCEEEEEEEECCEEEECCCEECCCEEEEEEEEEECCEEEEEECCCC--CCCCCCCCEECCCCEECCCCCCCCCCCCC
T ss_conf             76236751562220664276102532689999985898988705888--88899860839998878786774067563


No 96 
>KOG3892 consensus
Probab=99.71  E-value=8.6e-16  Score=119.82  Aligned_cols=79  Identities=29%  Similarity=0.406  Sum_probs=65.6

Q ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCC--CEECCCCCCCEEEECCCCCEEECHHHHHCCCCC
Q ss_conf             222222210136788867651698999999988151799809999--724668726789986989788537785202488
Q gi|254780301|r  327 ASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPG--GTLQTGTAADIALIDLNYQWTVKADDMSSIHKN  404 (431)
Q Consensus       327 ~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~--G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~  404 (431)
                      ..........+..+...++...|.|.+-||+++|..||+.||+++  |+|..|.+||||++|-+.               
T Consensus       326 T~Tl~GSiApMd~CvRhf~kATgCs~e~AleaAtlhPAqlLg~ek~KGTLDfG~dADFVllDd~l---------------  390 (407)
T KOG3892         326 TKTLSGSIAPMDVCVRHFLKATGCSMESALEAATLHPAQLLGLEKSKGTLDFGADADFVLLDDSL---------------  390 (407)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHCCCCCCCCCCCCCCCCEEEECCCE---------------
T ss_conf             43244554574899999986319827888766215818860310246620136667569972651---------------


Q ss_pred             CCCCCEEEEEEEEEEEECCEEEEEEC
Q ss_conf             65677278228899999999998624
Q gi|254780301|r  405 TVFDKEFFTGKVVRTYISGKQVYTLE  430 (431)
Q Consensus       405 tp~~g~~~~g~V~~tiv~G~iVy~~e  430 (431)
                                .|..||+.|+.||+.+
T Consensus       391 ----------~V~aT~isG~~V~~a~  406 (407)
T KOG3892         391 ----------HVQATYISGELVWQAD  406 (407)
T ss_pred             ----------EEEEEEECCEEEEECC
T ss_conf             ----------7999887127998425


No 97 
>cd01306 PhnM PhnM is believed to be a subunit of the membrane associated C-P lyase complex. C-P lyase is thought to catalyze the direct cleavage of inactivated C-P bonds to yield inorganic phosphate and the corresponding hydrocarbons. It is responsible for cleavage of alkylphosphonates, which are utilized as sole phosphorus sources by many bacteria.
Probab=99.54  E-value=2e-14  Score=111.00  Aligned_cols=77  Identities=25%  Similarity=0.280  Sum_probs=61.2

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC-CCEECCCCCCCEEEECCCCCEEECHHHHHCCCC
Q ss_conf             3322222221013678886765169899999998815179980999-972466872678998698978853778520248
Q gi|254780301|r  325 AEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP-GGTLQTGTAADIALIDLNYQWTVKADDMSSIHK  403 (431)
Q Consensus       325 ~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~-~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~  403 (431)
                      .+.......+..+......+....++++.++++++|.|||+++||+ +|+|++||+||||+|++...             
T Consensus       248 ~diL~SDY~p~SLL~Aaf~L~~~~~~~L~~A~~lVS~nPA~a~gL~DRG~I~~G~RADLv~v~~~~~-------------  314 (325)
T cd01306         248 LDILSSDYVPASLLHAAFRLADLGGWSLPEAVALVSANPARAVGLTDRGSIAPGKRADLILVDDMDG-------------  314 (325)
T ss_pred             CCEECCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEECCCC-------------
T ss_conf             7687107886789999999987379999999999856599886996566647886268899963899-------------


Q ss_pred             CCCCCCEEEEEEEEEEEECC
Q ss_conf             86567727822889999999
Q gi|254780301|r  404 NTVFDKEFFTGKVVRTYISG  423 (431)
Q Consensus       404 ~tp~~g~~~~g~V~~tiv~G  423 (431)
                       .|        .|..||++|
T Consensus       315 -~P--------~v~~vw~~G  325 (325)
T cd01306         315 -VP--------VVRTVWRGG  325 (325)
T ss_pred             -CC--------EEEEEECCC
T ss_conf             -75--------588876385


No 98 
>pfam07969 Amidohydro_3 Amidohydrolase family.
Probab=99.43  E-value=1.6e-13  Score=105.25  Aligned_cols=40  Identities=28%  Similarity=0.468  Sum_probs=36.0

Q ss_pred             HHCCCCCHHHHHHHHHHHHHHHCCCCC--CEECCCCCCCEEE
Q ss_conf             651698999999988151799809999--7246687267899
Q gi|254780301|r  345 FHGQQISLKKLIRALSTRPAQIFNLPG--GTLQTGTAADIAL  384 (431)
Q Consensus       345 ~~~~gls~~eal~~aT~npA~~lgl~~--G~I~~Gk~ADlvi  384 (431)
                      ..+..+|++|||+++|+|||+++|+++  ||||+||+|||||
T Consensus       351 ~~~~~ls~~eAl~~~T~~~A~~~g~e~~~Gsie~Gk~ADlvV  392 (392)
T pfam07969       351 KPDERLSLEEALALYTRGPAYALGLEDRKGTLAVGKDADLVI  392 (392)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEC
T ss_conf             825687999999999999999948767871658999777579


No 99 
>TIGR02022 hutF formiminoglutamate deiminase; InterPro: IPR010252   In some species, histidine utilisation goes via urocanate to glutamate in four step, the last being removal of formamide. This entry describes an alternate fourth step, formiminoglutamate hydrolase, which leads to N-formyl-L-glutamate. This product may be acted on by formylglutamate amidohydrolase (IPR010247 from INTERPRO) and bypass glutamate as a product during its degradation. Alternatively, removal of formate (by ) would yield glutamate..
Probab=99.38  E-value=3.3e-13  Score=103.15  Aligned_cols=74  Identities=23%  Similarity=0.257  Sum_probs=55.9

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCC----CEECCCCCCCEEEECCCCCEEECH--HHHHCCCCCCCCCCEEEEEEEEEEEECC
Q ss_conf             8999999988151799809999----724668726789986989788537--7852024886567727822889999999
Q gi|254780301|r  350 ISLKKLIRALSTRPAQIFNLPG----GTLQTGTAADIALIDLNYQWTVKA--DDMSSIHKNTVFDKEFFTGKVVRTYISG  423 (431)
Q Consensus       350 ls~~eal~~aT~npA~~lgl~~----G~I~~Gk~ADlvi~D~~~~~~i~~--~~~~s~~~~tp~~g~~~~g~V~~tiv~G  423 (431)
                      .+-...+.+||..+|++||++.    |.|++|+.|||+.+|.+.|+.+-.  +.+...   -.|.+..  ..|+.|||+|
T Consensus       364 ~~g~~L~d~A~~GGa~AlG~~~G~et~~l~~Ga~AD~~~LD~~~P~l~~a~~~~lLd~---~~FAg~~--~~VRdV~v~G  438 (466)
T TIGR02022       364 SVGRALYDAALAGGAQALGLAIGMETGGLRAGARADLLTLDGDHPYLAGALGDSLLDR---WLFAGGA--AAVRDVWVGG  438 (466)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCCCCCEEEECCCCCCCCCCCCHHHHHH---HHHCCCC--CCEEEEEECC
T ss_conf             8899999999999998537524677653431666454787257874336886156678---9851488--9310148838


Q ss_pred             EEEEE
Q ss_conf             99986
Q gi|254780301|r  424 KQVYT  428 (431)
Q Consensus       424 ~iVy~  428 (431)
                      |.|=+
T Consensus       439 ~~vVr  443 (466)
T TIGR02022       439 RWVVR  443 (466)
T ss_pred             EEEEE
T ss_conf             78860


No 100
>cd01294 DHOase Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis. In contrast to the large polyfunctional CAD proteins of higher organisms, this group of DHOases is monofunctional and mainly dimeric.
Probab=99.37  E-value=1.3e-11  Score=92.89  Aligned_cols=105  Identities=20%  Similarity=0.217  Sum_probs=66.3

Q ss_pred             CCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEEC
Q ss_conf             22233443111-13444545432222343332222222101367888676516989999999881517998099997246
Q gi|254780301|r  297 VEALEKGDIDI-IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQ  375 (431)
Q Consensus       297 ~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~~G~I~  375 (431)
                      ........... .+...++............  .+.............++.+. .++++..+.++.|||+++||..    
T Consensus       227 ~~al~~G~id~~iaTDHAPH~~~eKe~~~~~--AGi~~~~~al~~l~~~f~~~-~~l~~l~~f~s~n~a~~~gl~~----  299 (335)
T cd01294         227 RKAATSGHPKFFLGSDSAPHPKSNKESSCGC--AGIFSAPIALPYLAEVFEEH-NALDKLEAFASDNGPNFYGLPP----  299 (335)
T ss_pred             HHHHHCCCCCEEEECCCCCCCHHHCCCCCCC--CCCCCHHHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHHHCCCC----
T ss_conf             9999749984898479999864552488999--98157888999999999804-8499999998465798809998----


Q ss_pred             CCCCCCEEEECCCCCEEECHHHHHCCCCCCCCC-CEEE
Q ss_conf             687267899869897885377852024886567-7278
Q gi|254780301|r  376 TGTAADIALIDLNYQWTVKADDMSSIHKNTVFD-KEFF  412 (431)
Q Consensus       376 ~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~-g~~~  412 (431)
                        ...+++++.  ++|+|......++++|+||. |.++
T Consensus       300 --~~~~i~~~~--~~~~vp~~~~~~~~~~~P~~ag~~~  333 (335)
T cd01294         300 --NKKTITLVK--EPWKVPEKIPFGNNGVVPFRAGETL  333 (335)
T ss_pred             --CCCEEEEEE--CCCCCCCEEECCCCCEEECCCCCCC
T ss_conf             --998699997--8805687221499857863899877


No 101
>TIGR01178 ade adenine deaminase; InterPro: IPR006679 Adenine deaminase (3.5.4.2 from EC) hydrolyses adenine to form hypoxanthine and ammonia. The enzyme is part of a large metal dependent hydrolase superfamily . The adenine deaminase reaction is important for adenine utilization as a purine and also as a nitrogen source .; GO: 0000034 adenine deaminase activity, 0006146 adenine catabolic process.
Probab=99.10  E-value=6.1e-10  Score=82.12  Aligned_cols=71  Identities=27%  Similarity=0.333  Sum_probs=57.4

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCC----CCCCCCCCEEEECCCCEEECCEEECCCCCCCCCC
Q ss_conf             2699642999988885000108997999998317865----5666788779988798895172714114789998
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADAL----NAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPD   73 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~----~~~~~~~~~vID~~G~~v~PGlID~H~Hl~~~~~   73 (431)
                      +++++|+.++|-.+.....+++.+.+|.|..++....    .....++.+++|+.|.++.|||||.|.|+.....
T Consensus         1 ~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~d~~~~~~~~~~   75 (575)
T TIGR01178         1 DLVIKNAKILDLYNGEIIPGDIAVAGGYIAGVGLYDEDDKIIEKIKPGVEVIDAKGEYLVPGFIDGHLHIESSLL   75 (575)
T ss_pred             CEEEECCEEEEEECCCEECCCEEECCCEEEECCCHHHHHHHHHHHHHHHHHHHHCCCEECCCCCCCCEEECCCCC
T ss_conf             903302104431034300133011055133123201467888763123465531464103420011000000000


No 102
>TIGR00221 nagA N-acetylglucosamine-6-phosphate deacetylase; InterPro: IPR003764 Three enzymes are required for N-acetylglucosamine (NAG) utilization in Escherichia coli: enzyme IInag (gene nagE), N-acetylglucosamine-6-phosphate deacetylase (gene nagA), and glucosamine-6-phosphate isomerase (gene nagB) . This is family of N-acetylglucosamine-6-phosphate deacetylases, 3.5.1.25 from EC .; GO: 0008448 N-acetylglucosamine-6-phosphate deacetylase activity, 0006044 N-acetylglucosamine metabolic process.
Probab=99.09  E-value=2e-09  Score=78.83  Aligned_cols=71  Identities=24%  Similarity=0.308  Sum_probs=54.5

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCCCCCC-CCCCCCEEEECCC-CEEECCEEECCCCCCCCCCC
Q ss_conf             269964299998888500010899799999831786556-6678877998879-88951727141147899983
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNA-KFPTSALIHDCTG-LVAVPGIIDARVTLTGSPDE   74 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~~~~~-~~~~~~~vID~~G-~~v~PGlID~H~Hl~~~~~~   74 (431)
                      .+++++..++++. ..+.+..++|.+++|..+.+..... ...+..+.+|..| .++.|||+|.|.|-.+....
T Consensus         4 ~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~pg~~d~~~~g~~g~~~   76 (408)
T TIGR00221         4 FYLLNDGAILTGN-DVLDDGAVLINDGKISDVVPEAELEKLDLPEIKEIDLPGDNVLTPGLIDLHLHGCGGVGT   76 (408)
T ss_pred             CHHHHCCEEEECC-CCCCCCEEEECCCCEEHHCCCCHHHHCCCCCHHHHCCCCCCCCCCCEEEEEECCCCCCCC
T ss_conf             0201101122032-000242145315400000020000002653011100465421135400001024545543


No 103
>TIGR01224 hutI imidazolonepropionase; InterPro: IPR005920    Imidazolonepropionase (3.5.2.7 from EC) catalyzes the third step in histidine degradation.  4-imidazolone-5-propanoate + H2O = N-formimino-L-glutamate ; GO: 0016812 hydrolase activity acting on carbon-nitrogen (but not peptide) bonds in cyclic amides, 0019556 histidine catabolic process to glutamate and formamide, 0005737 cytoplasm.
Probab=99.03  E-value=5.1e-10  Score=82.66  Aligned_cols=58  Identities=17%  Similarity=0.125  Sum_probs=45.1

Q ss_pred             CCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC-C--CEECCCCCCCEEEECCCC
Q ss_conf             221013678886765169899999998815179980999-9--724668726789986989
Q gi|254780301|r  332 IGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP-G--GTLQTGTAADIALIDLNY  389 (431)
Q Consensus       332 ~~~~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~-~--G~I~~Gk~ADlvi~D~~~  389 (431)
                      ..................+++++++..+|.++|..+|.. +  |+++.|+.||+++|+...
T Consensus       325 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~g~~~~g~~~~~~~~~~~~  385 (409)
T TIGR01224       325 SPTLSLGLALSLACRLLKLTPEEALSAATLNAAYALGLGREGRGTLEAGKDADLVVWSAPS  385 (409)
T ss_pred             CHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCC
T ss_conf             2246788999988875203546766554321244514443233420025655357861777


No 104
>cd01305 archeal_chlorohydrolases Predicted chlorohydrolases. These metallo-dependent hydrolases from archea are part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. They have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. Some members of this subgroup are predicted to be chlorohyrolases.
Probab=97.80  E-value=1.3e-05  Score=54.21  Aligned_cols=21  Identities=14%  Similarity=0.189  Sum_probs=18.1

Q ss_pred             HCCCCCHHHHHHHHHHHHHHH
Q ss_conf             516989999999881517998
Q gi|254780301|r  346 HGQQISLKKLIRALSTRPAQI  366 (431)
Q Consensus       346 ~~~gls~~eal~~aT~npA~~  366 (431)
                      .+..++++++|+|||+|+||.
T Consensus       243 ~~~~~~a~~vl~mAT~~GAk~  263 (263)
T cd01305         243 LQGYLSPLEILRMATVNAAEF  263 (263)
T ss_pred             CCCCCCHHHHHHHHHHHCCCC
T ss_conf             678999999999981130279


No 105
>PRK06886 hypothetical protein; Validated
Probab=96.90  E-value=0.00011  Score=48.37  Aligned_cols=21  Identities=14%  Similarity=0.305  Sum_probs=18.8

Q ss_pred             CCHHHHHHHHHHHHHHHCCCC
Q ss_conf             899999998815179980999
Q gi|254780301|r  350 ISLKKLIRALSTRPAQIFNLP  370 (431)
Q Consensus       350 ls~~eal~~aT~npA~~lgl~  370 (431)
                      .+.++++.++|.||||+|||+
T Consensus       308 ~~~e~~~~~~T~n~ak~lgl~  328 (328)
T PRK06886        308 PNLEEMVNIASINGRKVLGLE  328 (328)
T ss_pred             CCHHHHHHHHCCCHHHHHCCC
T ss_conf             889999888603288873889


No 106
>pfam00449 Urease_alpha Urease alpha-subunit, N-terminal domain. The N-terminal domain is a composite domain and plays a major trimer stabilising role by contacting the catalytic domain of the symmetry related alpha-subunit.
Probab=96.59  E-value=0.0023  Score=39.79  Aligned_cols=33  Identities=30%  Similarity=0.394  Sum_probs=28.8

Q ss_pred             CEEEECCEEECCCCCEEEEEEEEEECCEEEEECCC
Q ss_conf             26996429999888850001089979999983178
Q gi|254780301|r    3 SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGAD   37 (431)
Q Consensus         3 ~llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~~   37 (431)
                      |++|+|+.|+|..+ + .++||.|+||||++||+.
T Consensus        67 D~VITnalIiD~~G-I-~KaDIGIkdGrI~gIGKA   99 (121)
T pfam00449        67 DLVITNALIIDYWG-I-VKADIGIKDGRIVGIGKA   99 (121)
T ss_pred             CEEEEEEEEECCCC-C-EECCCCCCCCEEEEEECC
T ss_conf             18998579963677-2-872454017889886357


No 107
>cd01292 metallo-dependent_hydrolases Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The family includes urease alpha, adenosine deaminase, phosphotriesterase  dihydroorotases, allantoinases, hydantoinases, AMP-, adenine and cytosine deaminases, imidazolonepropionase, aryldialkylphosphatase, chlorohydrolases, formylmethanofuran dehydrogenases and others.
Probab=96.58  E-value=0.0071  Score=36.61  Aligned_cols=22  Identities=23%  Similarity=0.332  Sum_probs=18.0

Q ss_pred             HHCCCCCHHHHHHHHHHHHHHH
Q ss_conf             6516989999999881517998
Q gi|254780301|r  345 FHGQQISLKKLIRALSTRPAQI  366 (431)
Q Consensus       345 ~~~~gls~~eal~~aT~npA~~  366 (431)
                      ..+..+|++++++|+|+||||+
T Consensus       254 ~~~~~~~~~~~l~~aT~n~Ara  275 (275)
T cd01292         254 VLRLGLSLEEALRLATINPARA  275 (275)
T ss_pred             HCCCCCCHHHHHHHHHHHHHCC
T ss_conf             7564899999999983874279


No 108
>pfam07908 D-aminoacyl_C D-aminoacylase, C-terminal region. D-aminoacylase (EC:3.5.1.81) hydrolyses a wide variety of N-acyl derivatives of neutral D-amino acids, in a zinc-dependent manner. The enzyme is composed of a small beta-barrel domain and a larger catalytic alpha/beta-barrel. The C-terminal region featured in this family forms part of the beta-barrel domain, together with a short N-terminal segment. The beta-strands of both barrels were found to superimpose well. The small beta-barrel domain does not seem to contribute to the substrate-binding site or to be involved in the catalytic process.
Probab=79.84  E-value=1.7  Score=21.29  Aligned_cols=15  Identities=13%  Similarity=0.102  Sum_probs=13.4

Q ss_pred             EEEEEECCEEEEEEC
Q ss_conf             899999999998624
Q gi|254780301|r  416 VVRTYISGKQVYTLE  430 (431)
Q Consensus       416 V~~tiv~G~iVy~~e  430 (431)
                      +++|||||+++|+..
T Consensus        20 i~~V~VNG~~~~~~g   34 (48)
T pfam07908        20 IEAVIVNGVLVVRDG   34 (48)
T ss_pred             EEEEEECCEEEEECC
T ss_conf             699999999999899


No 109
>cd01310 TatD_DNAse TatD like proteins;  E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity.
Probab=65.88  E-value=5.2  Score=18.14  Aligned_cols=34  Identities=12%  Similarity=0.205  Sum_probs=24.8

Q ss_pred             CHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             0136788867651698999999988151799809
Q gi|254780301|r  335 ETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN  368 (431)
Q Consensus       335 ~~~~~~~~~~~~~~gls~~eal~~aT~npA~~lg  368 (431)
                      .........+..-.++|++++.+.++.|.-++||
T Consensus       218 ~~i~~v~~~lA~i~~~~~~el~~~~~~N~~~lFG  251 (251)
T cd01310         218 AYVKHVAEKIAELKGISVEEVAEVTTENAKRLFG  251 (251)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCC
T ss_conf             8999999999988498999999999999998659


No 110
>pfam01423 LSM LSM domain. The LSM domain contains Sm proteins as well as other related LSM (Like Sm) proteins. The U1, U2, U4/U6, and U5 small nuclear ribonucleoprotein particles (snRNPs) involved in pre-mRNA splicing contain seven Sm proteins (B/B', D1, D2, D3, E, F and G) in common, which assemble around the Sm site present in four of the major spliceosomal small nuclear RNAs. The U6 snRNP binds to the LSM (Like Sm) proteins. Sm proteins are also found in archaebacteria, which do not have any splicing apparatus suggesting a more general role for Sm proteins. All Sm proteins contain a common sequence motif in two segments, Sm1 and Sm2, separated by a short variable linker. This family also includes the bacterial Hfq (host factor Q) proteins. Hfq are also RNA-binding proteins, that form hexameric rings.
Probab=58.83  E-value=11  Score=16.14  Aligned_cols=32  Identities=13%  Similarity=0.333  Sum_probs=18.9

Q ss_pred             EEEECCEEECCCCCEEEEEEEEEECCEEEEEC
Q ss_conf             69964299998888500010899799999831
Q gi|254780301|r    4 FVLNNTRIIDPSRDIDEVGAIIVENGIILAAG   35 (431)
Q Consensus         4 llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig   35 (431)
                      ++++|++.....+....-+.++|++..|..|.
T Consensus        34 lvL~~~~e~~~~~~~~~l~~~~iRG~~I~~I~   65 (66)
T pfam01423        34 LVLDDVEETIKDGKVNKLGLVLIRGNNIVLIS   65 (66)
T ss_pred             EEEEEEEEEECCCCEEECCEEEEECCEEEEEE
T ss_conf             09916999936997729670999499999984


No 111
>cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences. They function to mediate RNA-RNA interactions and RNA biogenesis.  All Sm proteins contain a common sequence motif in two segments, Sm1 and Sm2, separated by a short variable linker. Eukaryotic Sm proteins form part of specific small nuclear ribonucleoproteins (snRNPs) that are involved in the processing of pre-mRNAs to mature mRNAs, and are a major component of the eukaryotic spliceosome. Most snRNPs consist of seven Sm proteins (B/B', D1, D2, D3, E, F and G) arranged in a ring on a uridine-rich sequence (Sm site), plus a small nuclear RNA (snRNA) (either U1, U2, U5 or U4/6). Since archaebacteria do not have any splicing apparatus, Sm proteins of archaebacteria may play a more general role. Archaeal Lsm proteins are likely to represent the ancestral Sm domain.
Probab=54.22  E-value=13  Score=15.65  Aligned_cols=33  Identities=18%  Similarity=0.404  Sum_probs=16.0

Q ss_pred             EEEECCEEECCCCCEEEEEEEEEECCEEEEECC
Q ss_conf             699642999988885000108997999998317
Q gi|254780301|r    4 FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGA   36 (431)
Q Consensus         4 llI~n~~iid~~~~~~~~~~I~I~~gkI~~Ig~   36 (431)
                      +++.||.-++..+....-+.++|+++-|.-|.|
T Consensus        36 lvL~da~E~~~~~~~~~lg~v~iRG~nV~~IsP   68 (68)
T cd01731          36 LVLEDAEEIDDGEPVRKYGRVVIRGDNVLFISP   68 (68)
T ss_pred             EEECCEEEEECCEEEEECCEEEEECCEEEEEEC
T ss_conf             898246999178067496569998999999939


No 112
>PTZ00240 60S ribosomal protein P0; Provisional
Probab=53.27  E-value=13  Score=15.56  Aligned_cols=59  Identities=15%  Similarity=0.228  Sum_probs=38.4

Q ss_pred             HHCCC----CCCEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCC-CEEEEEEEEEEEECCEEEEEEC
Q ss_conf             98099----997246687267899869897885377852024886567-7278228899999999998624
Q gi|254780301|r  365 QIFNL----PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFD-KEFFTGKVVRTYISGKQVYTLE  430 (431)
Q Consensus       365 ~~lgl----~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~-g~~~~g~V~~tiv~G~iVy~~e  430 (431)
                      +.||+    ++|+|+.=+  |.+++.....-.-+..+++.+.+-.||. |.    .+..+|=+|. ||+.|
T Consensus       146 qalgIptkI~kG~IeI~~--d~~vvk~Ge~V~~s~A~lL~kL~I~Pf~~Gl----~~~~vyd~G~-iy~~~  209 (323)
T PTZ00240        146 QALNIATKIAKGMVEIVT--EKKVLSVGDKVDNSTATLLQKLNISPFYYQV----EVLSVWDRGV-LFTRE  209 (323)
T ss_pred             HHCCCCEEECCCEEEEEE--CCEEECCCCCCCHHHHHHHHHCCCCCEEEEE----EEEEEEECCE-ECCHH
T ss_conf             767985154176599964--4089437988189999999965997458327----8999952880-32788


No 113
>PRK05451 dihydroorotase; Provisional
Probab=52.08  E-value=14  Score=15.44  Aligned_cols=55  Identities=13%  Similarity=0.028  Sum_probs=31.9

Q ss_pred             EEECCEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             8951727141147899983114378899998707873212454556643331667777677
Q gi|254780301|r   56 VAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALE  116 (431)
Q Consensus        56 ~v~PGlID~H~Hl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  116 (431)
                      +.++==-|.|+||++ |..     ..........+++....++...+..........+...
T Consensus         5 i~i~~PdD~HvHlRd-G~~-----l~~v~~~~a~~f~raivMPNl~PPi~t~~~a~~Yr~r   59 (345)
T PRK05451          5 LTIRRPDDWHLHLRD-GAM-----LKAVVPYTARQFGRAIVMPNLVPPVTTVAQALAYRER   59 (345)
T ss_pred             EEECCCCEEEEECCC-CHH-----HHHHHHHHHHHCCEEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             675681504666538-557-----8989999997679899899999998999999999999


No 114
>cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit D3 heterodimerizes with subunit B and three such heterodimers form a hexameric ring structure with alternating B and D3 subunits. The D3 - B heterodimer also assembles into a heptameric ring containing D1, D2, E, F, and G subunits. Sm-like proteins exist in archaea as well as prokaryotes which form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=50.39  E-value=15  Score=15.27  Aligned_cols=33  Identities=9%  Similarity=0.181  Sum_probs=18.2

Q ss_pred             CCCEEEECCEEECCCCCEEEEEEEEEECCEEEEE
Q ss_conf             9626996429999888850001089979999983
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAA   34 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~~~~~~I~I~~gkI~~I   34 (431)
                      |+ +.++|+++...++....-..+.|++..|..|
T Consensus        34 MN-~~L~~v~~t~~~g~~~~l~~v~IRGs~Ir~i   66 (70)
T cd01721          34 MN-CQLKDVTVTARDGRVSQLEQVYIRGSKIRFF   66 (70)
T ss_pred             CC-CEEEEEEEECCCCCEEECCEEEECCCEEEEE
T ss_conf             67-4998999998899897566599907658999


No 115
>TIGR01020 rpsE_arch ribosomal protein S5; InterPro: IPR005711   Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.    Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , .   This model finds eukaryotic ribosomal protein S2 as well as archaeal ribosomal protein S5.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015935 small ribosomal subunit.
Probab=49.59  E-value=4  Score=18.90  Aligned_cols=34  Identities=21%  Similarity=0.363  Sum_probs=23.4

Q ss_pred             EEEECCEEEEECCCCCCCCCC-CCCEEEECCCCEEE-CCEE
Q ss_conf             899799999831786556667-88779988798895-1727
Q gi|254780301|r   24 IIVENGIILAAGADALNAKFP-TSALIHDCTGLVAV-PGII   62 (431)
Q Consensus        24 I~I~~gkI~~Ig~~~~~~~~~-~~~~vID~~G~~v~-PGlI   62 (431)
                      =||++|+|+.|.. +...+.| ...|+||    +++ |.|=
T Consensus        19 RLVKeGkIksidE-I~~~~lPIkE~EIvD----~LLGP~L~   54 (220)
T TIGR01020        19 RLVKEGKIKSIDE-IFRRNLPIKEPEIVD----ALLGPDLN   54 (220)
T ss_pred             EEEECCCCCCHHH-HHHCCCCCCCHHHHH----EECCCCCC
T ss_conf             0650662456799-984589821233411----01088878


No 116
>TIGR02303 HpaG-C-term 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, C-terminal subunit; InterPro: IPR012684    This entry represents one of two subunits/domains of the bifunctional isomerase/decarboxylase involved in 4-hydroxyphenylacetate degradation . In Escherichia coli and some other species, this enzyme is encoded by a single polypeptide containing both this domain and the closely related N-terminal domain (IPR012686 from INTERPRO). In other species such as Pasteurella multocida, these domains are found as two separate proteins (usually as tandem genes). Together, these domains carry out the decarboxylation of 5-oxopent-3-ene-1,2,5-tricarboxylic acid (OPET) to 2-hydroxy-2,4-diene-1,7-dioate (HHDD) and the subsequent isomerization to 2-oxohept-3-ene-1,7-dioate (OHED).; GO: 0008704 5-carboxymethyl-2-hydroxymuconate delta-isomerase activity, 0018800 5-oxopent-3-ene-125-tricarboxylate decarboxylase activity.
Probab=45.04  E-value=15  Score=15.16  Aligned_cols=28  Identities=14%  Similarity=0.380  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHC--CCCCCEECCCCCCCEEEE
Q ss_conf             98815179980--999972466872678998
Q gi|254780301|r  357 RALSTRPAQIF--NLPGGTLQTGTAADIALI  385 (431)
Q Consensus       357 ~~aT~npA~~l--gl~~G~I~~Gk~ADlvi~  385 (431)
                      ..+|++|-.++  |=.||. .-=|.-|.|.+
T Consensus       205 ~~mTL~PgD~ilTGTPKG~-~dv~pGD~v~~  234 (249)
T TIGR02303       205 EFMTLEPGDVILTGTPKGL-SDVKPGDVVRL  234 (249)
T ss_pred             HCCCCCCCCEEEECCCCCC-CCCCCCCEEEE
T ss_conf             1024785648870588875-22355878999


No 117
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284   This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species. This enzyme is involved in type II fatty acid biosynthesis, where the individual metabolic transformations are carried out by different enzymes rather than by a single enzyme as occurs in type I fatty acid biosynthesis .   Structural studies show that the enzyme is a tetramer which forms a typical Rossman fold , . Unlike other members of the short-chain dehydrogenase/reductase superfamily, the enzyme undergoes a marked conformational change upon binding of the NADP(H)cofactor. This conformational change aligns the side chains of the catalytic triad at the active site in an active conformation and increases the affinity of the enzyme for its substrate.; GO: 0004316 3-oxoacyl-[acyl-carrier-protein] reductase activity, 0051287 NAD binding, 0006633 fatty acid biosynthetic process.
Probab=44.08  E-value=7.1  Score=17.28  Aligned_cols=10  Identities=30%  Similarity=0.750  Sum_probs=7.8

Q ss_pred             EEECCEEECC
Q ss_conf             8951727141
Q gi|254780301|r   56 VAVPGIIDAR   65 (431)
Q Consensus        56 ~v~PGlID~H   65 (431)
                      .|.||||++=
T Consensus       174 aVAPGFI~Td  183 (238)
T TIGR01830       174 AVAPGFIETD  183 (238)
T ss_pred             EECCCCCCCC
T ss_conf             8748998970


No 118
>PTZ00135 ribosomal phosphoprotein P0; Provisional
Probab=43.45  E-value=19  Score=14.59  Aligned_cols=59  Identities=20%  Similarity=0.282  Sum_probs=37.8

Q ss_pred             HHCCC----CCCEECCCCCCCEEEECCCCCEEECHHHHHCCCCCCCCC-CEEEEEEEEEEEECCEEEEEEC
Q ss_conf             98099----997246687267899869897885377852024886567-7278228899999999998624
Q gi|254780301|r  365 QIFNL----PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFD-KEFFTGKVVRTYISGKQVYTLE  430 (431)
Q Consensus       365 ~~lgl----~~G~I~~Gk~ADlvi~D~~~~~~i~~~~~~s~~~~tp~~-g~~~~g~V~~tiv~G~iVy~~e  430 (431)
                      +.||+    ++|+|+.=+  |.+|+.....-.-+..+++++.+-.||. |.    ++..+|=||. ||+.+
T Consensus       139 qalgIptKI~kGkIeI~~--d~~vvk~GekV~~s~A~lL~kL~I~Pf~~GL----~l~~vyd~G~-iy~p~  202 (312)
T PTZ00135        139 QALGISTKIVKGQIEIQN--HVHLIKQGDKVTASSATLLQKLNMKPFSYGL----KVEKVYDSGV-IYDAS  202 (312)
T ss_pred             HHCCCCEEEECCEEEEEE--CEEEECCCCCCCHHHHHHHHHHCCCCEEEEE----EEEEEEECCC-CCCHH
T ss_conf             866996476366699941--4089427987289899999861987647546----8999961891-62799


No 119
>PRK06361 hypothetical protein; Provisional
Probab=42.36  E-value=19  Score=14.48  Aligned_cols=33  Identities=24%  Similarity=0.358  Sum_probs=26.7

Q ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             367888676516989999999881517998099
Q gi|254780301|r  337 MLSAALRLFHGQQISLKKLIRALSTRPAQIFNL  369 (431)
Q Consensus       337 ~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl  369 (431)
                      .........+++||++++++...+.+|++++++
T Consensus       183 ~~~~gv~~Arra~L~~~dv~ntls~~~~~~~~~  215 (216)
T PRK06361        183 TYETARKVALGAGLTEAELKEALSNNPKLLLKL  215 (216)
T ss_pred             CHHHHHHHHHHCCCCHHHHHHHHHHCHHHHHHH
T ss_conf             889999999984999999999987699999730


No 120
>cd01311 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM). This reaction is part of the protocatechuate (PCA) 4,5-cleavage pathway. PCA is one of the most important intermediate metabolites in the bacterial pathways for various phenolic compounds, including lignin, which is the most abundant aromatic material in nature.
Probab=40.66  E-value=12  Score=15.85  Aligned_cols=14  Identities=21%  Similarity=0.325  Sum_probs=11.0

Q ss_pred             CEEECCCCCCCCCC
Q ss_conf             72714114789998
Q gi|254780301|r   60 GIIDARVTLTGSPD   73 (431)
Q Consensus        60 GlID~H~Hl~~~~~   73 (431)
                      |-||+|.|+..+..
T Consensus         1 GaiD~H~Hv~dp~~   14 (263)
T cd01311           1 GAVDAHMHVFDPGY   14 (263)
T ss_pred             CCEECCEEEECCCC
T ss_conf             97855124568998


No 121
>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit; InterPro: IPR006309   These represent DnaQ, the DNA polymerase III epsilon subunit, as found in most Proteobacteria. It consists largely of an exonuclease region as described in IPR006055 from INTERPRO. In Gram-positive bacteria, closely related regions are found both in the Gram-positive type DNA polymerase III alpha subunit and as an additional N-terminal domain of a DinG-family helicase. Both are not included in this set of sequences, as they are smaller proteins.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication.
Probab=39.97  E-value=21  Score=14.24  Aligned_cols=35  Identities=23%  Similarity=0.347  Sum_probs=22.5

Q ss_pred             EEC-CCCCEEEEEEEEEECCEEEEECCCCCCCCCCCCCEEEE--CCCC
Q ss_conf             999-88885000108997999998317865566678877998--8798
Q gi|254780301|r   11 IID-PSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHD--CTGL   55 (431)
Q Consensus        11 iid-~~~~~~~~~~I~I~~gkI~~Ig~~~~~~~~~~~~~vID--~~G~   55 (431)
                      |+| .+++....+-.--+|.||++||          +.|+||  .+|+
T Consensus         4 iLDTETTGl~~~~G~~~~GhRivEIG----------avE~vnr~~tG~   41 (246)
T TIGR01406         4 ILDTETTGLDPKGGLPYIGHRIVEIG----------AVELVNRMLTGK   41 (246)
T ss_pred             EECCCCCCCCCCCCCCCCCCEEEEEE----------EEEEECCCCCCC
T ss_conf             71155568776677685686268882----------185673503887


No 122
>PRK00737 small nuclear ribonucleoprotein; Provisional
Probab=35.73  E-value=25  Score=13.82  Aligned_cols=14  Identities=7%  Similarity=0.401  Sum_probs=6.2

Q ss_pred             EEEEEECCEEEEEC
Q ss_conf             10899799999831
Q gi|254780301|r   22 GAIIVENGIILAAG   35 (431)
Q Consensus        22 ~~I~I~~gkI~~Ig   35 (431)
                      +.++|+++-|.-|.
T Consensus        58 g~v~IRGnnVi~Is   71 (72)
T PRK00737         58 GKVVIRGDNVVYVS   71 (72)
T ss_pred             CEEEEECCEEEEEE
T ss_conf             65999899999981


No 123
>COG2131 ComEB Deoxycytidylate deaminase [Nucleotide transport and metabolism]
Probab=35.22  E-value=25  Score=13.77  Aligned_cols=21  Identities=43%  Similarity=0.756  Sum_probs=16.8

Q ss_pred             EEEEEEEEECCEEEEECCCCC
Q ss_conf             000108997999998317865
Q gi|254780301|r   19 DEVGAIIVENGIILAAGADAL   39 (431)
Q Consensus        19 ~~~~~I~I~~gkI~~Ig~~~~   39 (431)
                      ...|.++++|++|.++|-+..
T Consensus        28 ~~VGAvIvkd~rIiatGYNG~   48 (164)
T COG2131          28 RQVGAVIVKDGRIIATGYNGA   48 (164)
T ss_pred             CCEEEEEEECCEEEEEECCCC
T ss_conf             545689986995998513888


No 124
>TIGR01286 nifK nitrogenase molybdenum-iron protein beta chain; InterPro: IPR005976    The enzyme responsible for nitrogen fixation, the nitrogenase, shows a high degree of conservation of structure, function, and amino acid sequence across wide phylogenetic ranges. All known Mo-nitrogenases consist of two components, component I (also called dinitrogenase, or Fe-Mo protein), an alpha2beta2 tetramer encoded by the nifD and nifK genes, and component II (dinitrogenase reductase, or Fe protein) a homodimer encoded by the nifH gene , . Two operons, nifDK and nifEN, encode a tetrameric (alpha2beta2 and N2E2) enzymatic complex. Nitrogenase contains two unusual rare metal clusters; one of them is the iron molybdenum cofactor (FeMo-co), which is considered to be the site of dinitrogen reduction and whose biosynthesis requires the products of nifNE and of some other nif genes . It has been proposed that NifNE might serve as a scaffold upon which FeMo-co is built and then inserted into component I .; GO: 0016163 nitrogenase activity, 0009399 nitrogen fixation, 0016612 molybdenum-iron nitrogenase complex.
Probab=33.77  E-value=12  Score=15.72  Aligned_cols=10  Identities=20%  Similarity=0.650  Sum_probs=6.3

Q ss_pred             ECCEEECCCC
Q ss_conf             5172714114
Q gi|254780301|r   58 VPGIIDARVT   67 (431)
Q Consensus        58 ~PGlID~H~H   67 (431)
                      +|.||=+|+-
T Consensus       185 TPsFVGSHit  194 (526)
T TIGR01286       185 TPSFVGSHIT  194 (526)
T ss_pred             CCCCCCCEEC
T ss_conf             7773265002


No 125
>TIGR00491 aIF-2 translation initiation factor aIF-2; InterPro: IPR004544 Initiation factor 2 (IF-2) is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-2 promotes the GTP-dependent binding of the initiator tRNA to the small subunit of the ribosome. IF-2 is a protein of about 70 to 95 Kd which contains a central GTP-binding domain flanked by a highly variable N-terminal domain and a more conserved C-terminal domain. Some members of this family undergo protein self splicing that involves a post-translational excision of the intein followed by peptide ligation.; GO: 0003743 translation initiation factor activity, 0005525 GTP binding, 0006413 translational initiation, 0005622 intracellular.
Probab=33.50  E-value=18  Score=14.63  Aligned_cols=47  Identities=21%  Similarity=0.196  Sum_probs=28.3

Q ss_pred             EEEEEECCEEEEECCCCCCCCC-----------------------CCCCEEEECCCCEEECCEEECCCCCC
Q ss_conf             1089979999983178655666-----------------------78877998879889517271411478
Q gi|254780301|r   22 GAIIVENGIILAAGADALNAKF-----------------------PTSALIHDCTGLVAVPGIIDARVTLT   69 (431)
Q Consensus        22 ~~I~I~~gkI~~Ig~~~~~~~~-----------------------~~~~~vID~~G~~v~PGlID~H~Hl~   69 (431)
                      .|=+|++||.+.+|....+.-.                       -++.++||..| ||+-=-.++|..+.
T Consensus       487 sdGlienGrltklGrealniWknhefGkenidymkslieniafvevedveiidydG-yvydlttethnfia  556 (1145)
T TIGR00491       487 SDGLIENGRLTKLGREALNIWKNHEFGKENIDYMKSLIENIAFVEVEDVEIIDYDG-YVYDLTTETHNFIA  556 (1145)
T ss_pred             CCCCEECCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHEEEEEEEEEEEECCC-EEEEECCCHHHHHH
T ss_conf             37721155201332678876520134612578999887410035652057873276-26740100012322


No 126
>PRK00912 ribonuclease P protein component 3; Provisional
Probab=32.10  E-value=28  Score=13.44  Aligned_cols=43  Identities=14%  Similarity=0.157  Sum_probs=32.0

Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCC---CCEECCCC
Q ss_conf             13678886765169899999998815179980999---97246687
Q gi|254780301|r  336 TMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP---GGTLQTGT  378 (431)
Q Consensus       336 ~~~~~~~~~~~~~gls~~eal~~aT~npA~~lgl~---~G~I~~Gk  378 (431)
                      ........+..-.||+.+++.++.+.+|.+++...   ++.|.+|=
T Consensus       186 R~p~d~~~l~~~~Gl~~~~a~~als~~p~~il~~~r~r~~~i~~gv  231 (237)
T PRK00912        186 RSPKEMIALAEVFGLEEDEALEALTSVPEKIIEKNRNRKNYVIEGV  231 (237)
T ss_pred             CCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCE
T ss_conf             7999999999985999999999999989999984577776446661


No 127
>TIGR00399 metG_C_term methionyl-tRNA synthetase, beta subunit; InterPro: IPR004495   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases . The methionyl-tRNA synthetase (metG) (6.1.1.10 from EC) is a class I amino acyl-tRNA ligase. This family describes a region of the methionyl-tRNA synthetase that is present at the C-terminus of MetG in some species (Escherichia coli, Bacillus subtilis, Thermotoga maritima, Methanobacterium thermoautotrophicum), and as a separate beta chain in Aquifex aeolicus. It is absent in a number of other species (e.g. Mycoplasma genitalium, Mycobacterium tuberculosis), while Pyrococcus horikoshii has both a full length MetG and a second protein homologous to the beta chain only.; GO: 0000166 nucleotide binding, 0004825 methionine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006431 methionyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=32.07  E-value=28  Score=13.44  Aligned_cols=40  Identities=18%  Similarity=0.404  Sum_probs=29.7

Q ss_pred             CC-HHHHHHH-----HHHHHHHH-CCC-CCCE-ECCCCCC----CEEEECCCC
Q ss_conf             89-9999998-----81517998-099-9972-4668726----789986989
Q gi|254780301|r  350 IS-LKKLIRA-----LSTRPAQI-FNL-PGGT-LQTGTAA----DIALIDLNY  389 (431)
Q Consensus       350 ls-~~eal~~-----aT~npA~~-lgl-~~G~-I~~Gk~A----Dlvi~D~~~  389 (431)
                      .+ |++.+--     +=+-|||. +|. ..|= |+.|..=    ||.|+||++
T Consensus        88 Y~~PEeLvGk~vivv~NLKPaKl~~Gv~SeGMiLAae~~g~nfk~l~lls~~~  140 (149)
T TIGR00399        88 YTDPEELVGKKVIVVANLKPAKLKFGVKSEGMILAAEDDGKNFKNLFLLSPDK  140 (149)
T ss_pred             CCCCHHHCCCEEEEEECCCCHHHCCCCCCCCCEEEEECCCCCEEEEEEECCCC
T ss_conf             78704743977999704876012377343351788526997245788866678


No 128
>COG3618 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only]
Probab=30.80  E-value=15  Score=15.15  Aligned_cols=16  Identities=31%  Similarity=0.210  Sum_probs=12.5

Q ss_pred             EECCEEECCCCCCCCC
Q ss_conf             9517271411478999
Q gi|254780301|r   57 AVPGIIDARVTLTGSP   72 (431)
Q Consensus        57 v~PGlID~H~Hl~~~~   72 (431)
                      -++.+||+|.|+..++
T Consensus         5 ~~~~~IDtH~Hl~~~~   20 (279)
T COG3618           5 APQMIIDTHAHLWDPG   20 (279)
T ss_pred             CCCCCCCHHHHHHCCC
T ss_conf             4345402134653566


No 129
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit. Members of this protein family are the B subunit, product of the glpB gene, of a three-subunit, membrane-anchored, FAD-dependent anaerobic glycerol-3-phosphate dehydrogenase.
Probab=30.44  E-value=30  Score=13.27  Aligned_cols=15  Identities=27%  Similarity=0.244  Sum_probs=9.9

Q ss_pred             CEEECCEEECCCCCC
Q ss_conf             889517271411478
Q gi|254780301|r   55 LVAVPGIIDARVTLT   69 (431)
Q Consensus        55 ~~v~PGlID~H~Hl~   69 (431)
                      ....-|.||.=.++.
T Consensus        36 L~fsSGsiDlLg~~P   50 (419)
T TIGR03378        36 LHFSSGSLDLLSRLP   50 (419)
T ss_pred             CCCCCCCHHHHCCCC
T ss_conf             212353576503599


No 130
>cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet.  LSm10 is an SmD1-like protein which is thought to bind U7 snRNA along with LSm11 and five other Sm subunits to form a 7-member ring structure. LSm10 and the U7 snRNP of which it is a part are thought to play an important role in histone mRNA 3' processing.
Probab=29.05  E-value=31  Score=13.12  Aligned_cols=10  Identities=30%  Similarity=0.275  Sum_probs=3.6

Q ss_pred             EEEEECCEEE
Q ss_conf             0899799999
Q gi|254780301|r   23 AIIVENGIIL   32 (431)
Q Consensus        23 ~I~I~~gkI~   32 (431)
                      .+.|++..|.
T Consensus        64 ~~~IRGs~IR   73 (78)
T cd01733          64 EIMVTGRNIR   73 (78)
T ss_pred             EEEECCCEEE
T ss_conf             7999176689


No 131
>cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm4 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=28.74  E-value=32  Score=13.08  Aligned_cols=34  Identities=12%  Similarity=0.025  Sum_probs=23.0

Q ss_pred             CCCEEEECCEEECCCCCE-EEEEEEEEECCEEEEEC
Q ss_conf             962699642999988885-00010899799999831
Q gi|254780301|r    1 MTSFVLNNTRIIDPSRDI-DEVGAIIVENGIILAAG   35 (431)
Q Consensus         1 M~~llI~n~~iid~~~~~-~~~~~I~I~~gkI~~Ig   35 (431)
                      |+ +.++|++....++.. ..-..+.|++..|..|-
T Consensus        35 MN-~~L~~v~~t~~~G~~~~~~~~v~IRGs~Iryi~   69 (76)
T cd01723          35 MN-IHLREVICTSKDGDKFWKMPECYIRGNTIKYLR   69 (76)
T ss_pred             CC-CEEEEEEEECCCCCCCCCCCEEEEECCEEEEEE
T ss_conf             58-199899999889986254872999798899999


No 132
>TIGR01901 adhes_NPXG filamentous haemagglutinin family N-terminal domain; InterPro: IPR008638   This entry represents a conserved domain found near the N-terminus of a number of large, repetitive bacterial proteins, including many proteins of over 2500 amino acids. A number of the members of this family have been designated adhesins, filamentous haemagglutinins, haem/haemopexin-binding protein, etc. Members generally have a signal sequence, then an intervening region, then the region described in this entry. Following this region, proteins typically have regions rich in repeats but may show no homology between the repeats of one member and the repeats of another. This domain is suggested to be a carbohydrate-dependent haemagglutination activity site .   In Bordetella pertussis, the infectious agent in childhood whooping cough, filamentous haemagglutinin (FHA) is a surface-exposed and secreted protein that acts as a major virulence attachment factor, functioning as both a primary adhesin and an immunomodulator to bind the bacterial to cells of the respiratory epithelium . The FHA molecule has a globular head that consists of two domains: a shaft and a flexible tail. Its sequence contains two regions of tandem 19-residue repeats, where the repeat motif consists of short beta-helical strands separated by beta-turns ..
Probab=28.41  E-value=31  Score=13.19  Aligned_cols=18  Identities=44%  Similarity=0.591  Sum_probs=14.6

Q ss_pred             CEECC-CCCCCEEEECCCC
Q ss_conf             72466-8726789986989
Q gi|254780301|r  372 GTLQT-GTAADIALIDLNY  389 (431)
Q Consensus       372 G~I~~-Gk~ADlvi~D~~~  389 (431)
                      |.|++ |+.|||.|++|+-
T Consensus        57 G~l~v~G~~A~vfl~NPNG   75 (97)
T TIGR01901        57 GNLQVNGKKAQVFLINPNG   75 (97)
T ss_pred             EEEEECCCCEEEEEECCCC
T ss_conf             0367429841499883897


No 133
>KOG0203 consensus
Probab=26.49  E-value=26  Score=13.65  Aligned_cols=17  Identities=41%  Similarity=0.501  Sum_probs=10.4

Q ss_pred             CEECCCCCCCEEEECCC
Q ss_conf             72466872678998698
Q gi|254780301|r  372 GTLQTGTAADIALIDLN  388 (431)
Q Consensus       372 G~I~~Gk~ADlvi~D~~  388 (431)
                      ||----..||++++|-|
T Consensus       734 GSDvsKqAADmILLDDN  750 (1019)
T KOG0203         734 GSDVSKQAADMILLDDN  750 (1019)
T ss_pred             CCHHHHHHCCEEEECCC
T ss_conf             30677742446986175


No 134
>TIGR00856 pyrC_dimer dihydroorotase, homodimeric type; InterPro: IPR004721   Dihydroorotase belongs to MEROPS peptidase family M38 (clan MJ), where it is classified as a non-peptidase homologue. DHOase catalyses the third step in the de novo biosynthesis of pyrimidine, the conversion of ureidosuccinic acid (N-carbamoyl-L-aspartate) into dihydroorotate. Dihydroorotase binds a zinc ion which is required for its catalytic activity .   In bacteria, DHOase is a dimer of identical chains of about 400 amino-acid residues (gene pyrC). In the metazoa, DHOase is part of a large multi-functional protein known as 'rudimentary' in Drosophila melanogaster and CAD in mammals and which catalyzes the first three steps of pyrimidine biosynthesis . The DHOase domain is located in the central part of this polyprotein. In yeast, DHOase is encoded by a monofunctional protein (gene URA4). However, a defective DHOase domain  is found in a multifunctional protein (gene URA2) that catalyzes the first two steps of pyrimidine biosynthesis.   The comparison of DHOase sequences from various sources shows  that there are two highly conserved regions. The first located in the N-terminal extremity contains two histidine residues suggested  to be involved in binding the zinc ion. The second is found in the C-terminal part. Members of this family of proteins are predicted to adopt a TIM barrel fold .   This family represents the homodimeric form of dihydroorotase 3.5.2.3 from EC. It is found in bacteria, plants and fungi; URA4 of yeast is a member of this group of sequences.  ; GO: 0004151 dihydroorotase activity, 0019856 pyrimidine base biosynthetic process.
Probab=26.39  E-value=35  Score=12.82  Aligned_cols=67  Identities=12%  Similarity=0.090  Sum_probs=40.4

Q ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECC
Q ss_conf             714114789998311437889999870787321245455664333166777767766431012232100013
Q gi|254780301|r   62 IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLT  133 (431)
Q Consensus        62 ID~H~Hl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  133 (431)
                      +|.|.|++++..     +..-.-.....|+.....++...+..........+....................
T Consensus         8 ~D~HlHvRega~-----lk~V~P~~~~~Gfs~A~iMPNL~pP~~~~~~~~~Y~~~il~~~p~G~~f~pLMsl   74 (364)
T TIGR00856         8 DDWHLHVREGAM-----LKAVLPYTSEGGFSRAIIMPNLKPPVTTVDRAIEYRERILKAVPAGGDFTPLMSL   74 (364)
T ss_pred             CCEEEECCCHHH-----HHHCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEE
T ss_conf             750653470235-----5214773113651489977888777478788999999999855588985621466


No 135
>cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=25.38  E-value=37  Score=12.70  Aligned_cols=31  Identities=10%  Similarity=0.174  Sum_probs=11.6

Q ss_pred             EEEECCEEECCCCCEEEEEEEEEECCEEEEE
Q ss_conf             6996429999888850001089979999983
Q gi|254780301|r    4 FVLNNTRIIDPSRDIDEVGAIIVENGIILAA   34 (431)
Q Consensus         4 llI~n~~iid~~~~~~~~~~I~I~~gkI~~I   34 (431)
                      ++|.|+.-+...+....-+.++|+++-|..|
T Consensus        32 lvL~~~~e~~~~~~~~~lg~v~iRG~nI~~i   62 (63)
T cd00600          32 LVLDDVEETIKEGKKRVLGLVLIRGDNVRLV   62 (63)
T ss_pred             EEECCEEEECCCCCCCCCCEEEEECCEEEEE
T ss_conf             0986799991799344912799928989998


No 136
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter; InterPro: IPR005898   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     Bacteria have elaborate pathways for the production of toxins and secondary metabolites. Many such compounds, including syringomycin and pyoverdine are synthesized on non-ribosomal templates consisting of a multienzyme complex. On several occasions the proteins of the complex and transporter protein are present on the same operon. Often times these compounds cross the biological membrane by specific transporters. This model describes a family of cyclic peptide transporters in bacteria. Syringomycin is an amphipathic, cyclic lipodepsipeptide when inserted into host causes formation of channels, permeable to a variety of cations. On the other hand, pyoverdine is a cyclic octa-peptidyl dihydroxyquinoline, which is efficient in sequestering iron for uptake.; GO: 0005524 ATP binding, 0015197 peptide transporter activity, 0015833 peptide transport, 0016021 integral to membrane.
Probab=24.84  E-value=37  Score=12.63  Aligned_cols=52  Identities=21%  Similarity=0.279  Sum_probs=31.4

Q ss_pred             CEECCCCCCCEEEECCCCCEE-ECHHHHHCCC----CCCCCCCEEEEEEEEEEEECCEEEE
Q ss_conf             724668726789986989788-5377852024----8865677278228899999999998
Q gi|254780301|r  372 GTLQTGTAADIALIDLNYQWT-VKADDMSSIH----KNTVFDKEFFTGKVVRTYISGKQVY  427 (431)
Q Consensus       372 G~I~~Gk~ADlvi~D~~~~~~-i~~~~~~s~~----~~tp~~g~~~~g~V~~tiv~G~iVy  427 (431)
                      =.++.--.-++.++|++++|. ++-.+++...    .-+||.   + |-+..+|-.|++||
T Consensus       316 P~~~~S~~~nvlll~~~K~~~S~~L~~V~~~~~~~~~S~~F~---L-GPI~L~I~~G~~Vy  372 (555)
T TIGR01194       316 PELLLSDADNVLLLDHDKSVDSLELKDVRYSYKDVESSEGFA---L-GPIDLRIASGDLVY  372 (555)
T ss_pred             CCCCCCCCCCEEEECCCCCCCCEEEECEECCCCCCCCCCCCC---C-CCCCCEEECCCEEE
T ss_conf             873466643403334777603202100004788888888842---1-76112574352899


No 137
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252   This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria. Proteins in this entry are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ). They are restricted to a subset of endospore-forming species, and probably participate in the program of endospore formation. We propose the designation LonC..
Probab=24.10  E-value=39  Score=12.54  Aligned_cols=51  Identities=25%  Similarity=0.356  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCEECCCCCCCE---EEEC------CCCCEEECHHHH---HCCCCCCCCCCEE
Q ss_conf             9999998815179980999972466872678---9986------989788537785---2024886567727
Q gi|254780301|r  352 LKKLIRALSTRPAQIFNLPGGTLQTGTAADI---ALID------LNYQWTVKADDM---SSIHKNTVFDKEF  411 (431)
Q Consensus       352 ~~eal~~aT~npA~~lgl~~G~I~~Gk~ADl---vi~D------~~~~~~i~~~~~---~s~~~~tp~~g~~  411 (431)
                      ..+++.--|+.|=|+.++         .||.   ++|.      ++..-+|..+++   .+.+..|||+-..
T Consensus       378 V~e~Ia~YTieGRkAvnI---------LAD~Yg~~ly~~~~~~~~~d~~~I~~~dv~evv~~sRl~Py~~~~  440 (616)
T TIGR02903       378 VEELIARYTIEGRKAVNI---------LADVYGYALYKKAEALKEEDKVTITADDVKEVVQISRLSPYEKVK  440 (616)
T ss_pred             HHHHHHHCCCCCHHHHHH---------HHHHHHHHHHCCCCCCCCCCCEEEEHHHHHHHHHHCCCCCHHHCC
T ss_conf             487872147131122234---------654676765304555677774266186777677530457501124


No 138
>pfam02457 DisA_N DisA bacterial checkpoint controller nucleotide-binding. The DisA protein is a bacterial checkpoint protein that dimerizes into an octameric complex. The protein consists of three distinct domains. This domain is the first and is a globular, nucleotide-binding region; the next 146-289 residues constitute the DisA-linker family, pfam10635, that consists of an elongated bundle of three alpha helices (alpha-6, alpha-10, and alpha-11), one side of which carries an additional three helices (alpha7-9), which thus forms a spine like-linker between domains 1 and 3. The C-terminal residues, of domain 3, are represented by family HHH, pfam00633, the specific DNA-binding domain. The octameric complex thus has structurally linked nucleotide-binding and DNA-binding HhH domains and the nucleotide-binding domains are bound to a cyclic di-adenosine phosphate such that DisA is a specific di-adenylate cyclase. The di-adenylate cyclase activity is strongly suppressed by binding to branch
Probab=24.06  E-value=39  Score=12.54  Aligned_cols=24  Identities=38%  Similarity=0.547  Sum_probs=15.2

Q ss_pred             ECCCCCEEEEEEEEEECCEEEEECC
Q ss_conf             9988885000108997999998317
Q gi|254780301|r   12 IDPSRDIDEVGAIIVENGIILAAGA   36 (431)
Q Consensus        12 id~~~~~~~~~~I~I~~gkI~~Ig~   36 (431)
                      |.+.. ..-+|.|+|++|+|.+.+-
T Consensus        48 F~~~s-plhDGAvII~~~~i~aa~~   71 (122)
T pfam02457        48 FYPNT-PLHDGAVIIRGGRIVAAGC   71 (122)
T ss_pred             CCCCC-CCCCEEEEEECCCEEEEEE
T ss_conf             67998-7775599998993799999


No 139
>KOG2902 consensus
Probab=23.60  E-value=35  Score=12.81  Aligned_cols=58  Identities=16%  Similarity=0.154  Sum_probs=28.0

Q ss_pred             EECCEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             951727141147899983114378899998707873212454556643331667777677664
Q gi|254780301|r   57 AVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR  119 (431)
Q Consensus        57 v~PGlID~H~Hl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  119 (431)
                      -+|+.-|+|+|++....-..     -......||+.....++...+..........+......
T Consensus         6 ~i~~~~DmHvHlR~g~ml~a-----VvP~~a~ggvs~AyvMPNL~PPiTt~da~i~YkK~i~k   63 (344)
T KOG2902           6 TITQPDDMHVHLRDGDMLHA-----VVPHSASGGVSRAYVMPNLKPPITTTDAAIIYKKFIMK   63 (344)
T ss_pred             ECCCCCCEEEEECCCCEEEE-----ECCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             43886514688626870244-----25411469646899747888983128999999999985


No 140
>TIGR01517 ATPase-IIB_Ca calcium-translocating P-type ATPase, PMCA-type; InterPro: IPR006408   This family describes the P-type ATPase responsible for translocating calcium ions across the plasma membrane of eukaryotes , out of the cell. In some organisms, this type of pump may also be found in vacuolar membranes . In humans and mice, at least, there are multiple isoforms of the PMCA pump with overlapping but not redundant functions. Accordingly, there are no human diseases linked to PMCA defects, although alterations of PMCA function do elicit physiological effects . The calcium P-type ATPases have been characterised as Type IIB based on a phylogenetic analysis which distinguishes this group from the Type IIA SERCA calcium pump .; GO: 0005388 calcium-transporting ATPase activity, 0005509 calcium ion binding, 0005524 ATP binding, 0015085 calcium ion transmembrane transporter activity, 0006816 calcium ion transport, 0016020 membrane.
Probab=22.88  E-value=41  Score=12.39  Aligned_cols=22  Identities=5%  Similarity=0.090  Sum_probs=13.4

Q ss_pred             CCCEEEECCCC-EEECCEEECCC
Q ss_conf             88779988798-89517271411
Q gi|254780301|r   45 TSALIHDCTGL-VAVPGIIDARV   66 (431)
Q Consensus        45 ~~~~vID~~G~-~v~PGlID~H~   66 (431)
                      .|..|+.+.|+ +|+-=-+++..
T Consensus       224 SGt~V~~G~g~MlvTaVG~~S~~  246 (885)
T TIGR01517       224 SGTKVLEGSGRMLVTAVGVNSFT  246 (885)
T ss_pred             CCCEEEEECCCEEEEEEEEECCC
T ss_conf             04545501130789983333155


No 141
>COG4464 CapC Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]
Probab=22.71  E-value=41  Score=12.37  Aligned_cols=41  Identities=20%  Similarity=0.272  Sum_probs=19.5

Q ss_pred             EEECCCCCCCC---CCCCCCCHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             27141147899---983114378899998707873212454556
Q gi|254780301|r   61 IIDARVTLTGS---PDEYSKNITTLSKEAVAGGITSIILMPLGM  101 (431)
Q Consensus        61 lID~H~Hl~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  101 (431)
                      +||.|+|+--.   |-...+.-....+.+...|++.........
T Consensus         1 MIDIH~HIlp~iDDGp~s~eesl~ml~~A~~qGvt~iVaTsHh~   44 (254)
T COG4464           1 MIDIHSHILPDIDDGPKSLEESLAMLREAVRQGVTKIVATSHHL   44 (254)
T ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             94501346678788987589999999999975760795133324


No 142
>PRK03642 hypothetical protein; Provisional
Probab=22.57  E-value=41  Score=12.35  Aligned_cols=12  Identities=8%  Similarity=0.396  Sum_probs=8.1

Q ss_pred             EEEEECCEEEEE
Q ss_conf             089979999983
Q gi|254780301|r   23 AIIVENGIILAA   34 (431)
Q Consensus        23 ~I~I~~gkI~~I   34 (431)
                      -+++++|||+.-
T Consensus        60 v~V~r~Gkiv~~   71 (432)
T PRK03642         60 LLVIKDNHIVKR   71 (432)
T ss_pred             EEEEECCEEEEE
T ss_conf             999989999998


No 143
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III; InterPro: IPR004655   Beta-ketoacyl-acyl carrier protein synthase III (FabH), in general, initiates elongation in type II fatty acid synthase systems found in bacteria and plants. It is responsible for producing the multitude of fatty acid structures found in bacterial membranes . The two members of this subfamily from Bacillus subtilis differ from each other, and from FabH from Escherichia coli, in acyl group specificity. Active site residues include Cys112, His244 and Asn274 of Escherichia coli FabH. Cys-112 is the site of acyl group attachment. ; GO: 0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity, 0006633 fatty acid biosynthetic process.
Probab=21.83  E-value=43  Score=12.26  Aligned_cols=13  Identities=31%  Similarity=0.680  Sum_probs=5.7

Q ss_pred             CCEECCCCCCCEEEEC
Q ss_conf             9724668726789986
Q gi|254780301|r  371 GGTLQTGTAADIALID  386 (431)
Q Consensus       371 ~G~I~~Gk~ADlvi~D  386 (431)
                      .|+|++|   |++||.
T Consensus       302 ~G~iK~G---d~~LL~  314 (329)
T TIGR00747       302 TGRIKKG---DLLLLV  314 (329)
T ss_pred             CCCCCCC---CEEEEE
T ss_conf             1777724---488876


No 144
>smart00651 Sm snRNP Sm proteins. small nuclear ribonucleoprotein particles (snRNPs) involved in pre-mRNA splicing
Probab=21.42  E-value=44  Score=12.21  Aligned_cols=32  Identities=13%  Similarity=0.169  Sum_probs=15.8

Q ss_pred             EEEECCEEECCCC-CEEEEEEEEEECCEEEEEC
Q ss_conf             6996429999888-8500010899799999831
Q gi|254780301|r    4 FVLNNTRIIDPSR-DIDEVGAIIVENGIILAAG   35 (431)
Q Consensus         4 llI~n~~iid~~~-~~~~~~~I~I~~gkI~~Ig   35 (431)
                      ++++|+....+.+ ....-+.++|+++.|..|.
T Consensus        34 lvL~~~~e~~~~~~~~~~lg~v~iRG~~I~~i~   66 (67)
T smart00651       34 LVLEDVEETVKDGEKKRKLGLVFIRGNNIVYII   66 (67)
T ss_pred             EEECEEEEEECCCCEEEECCCEEEECCEEEEEE
T ss_conf             298729999658977829460999598999998


No 145
>TIGR02428 pcaJ_scoB_fam 3-oxoacid CoA-transferase, B subunit; InterPro: IPR012791   CoA-transferases catalyse the reversible transfer of of coenzyme A from CoA-thioesters to free acids, and can be divided into three families . Family I includes transferases for 3-oxoacids (2.8.3.5 from EC, 2.8.3.6 from EC), short-chain fatty acids (2.8.3.8 from EC, 2.8.3.9 from EC) and glutaconate (2.8.3.12 from EC). Most of the family I enzymes use acetyl-CoA or succinyl-CoA as CoA donors, and are composed of two separate polypeptides, subunits A and B, which generally aggregate as heterodimers or heterotetramers. The eukaryotic enzymes, however, are generally composed of a single two-domain polypetide representing a fusion of the A and B subunits. The transfer of CoA from one substrate to another occurs via a ping pong mechanism which involves the formation of thioester bond between CoA and a conserved glutamate residue at the active site of the enzyme .   This entry represents the B subunit of family I CoA-transferases, which contains the conserved active-site glutamate residue. This domain forms a three-layer alpha-beta-alpha sandwich where the central layer is a mixed beta-sheet, against which helices pack from both sides , . The active site is thought to be located at the interface of the A and B subunits and formed by loops from both subunits.; GO: 0008410 CoA-transferase activity.
Probab=21.30  E-value=41  Score=12.39  Aligned_cols=41  Identities=24%  Similarity=0.276  Sum_probs=26.3

Q ss_pred             EEEEEEEE--ECCEEEEECCCCCCCCCCCCCEEEECCCC--EEECCEE
Q ss_conf             00010899--79999983178655666788779988798--8951727
Q gi|254780301|r   19 DEVGAIIV--ENGIILAAGADALNAKFPTSALIHDCTGL--VAVPGII   62 (431)
Q Consensus        19 ~~~~~I~I--~~gkI~~Ig~~~~~~~~~~~~~vID~~G~--~v~PGlI   62 (431)
                      .+..+|..  ||| |..+||-..  +-.++...|||.++  +++||==
T Consensus        35 Peg~~v~LqSENG-ilG~GP~P~--~G~~D~dliNAGK~~vT~~pGAS   79 (208)
T TIGR02428        35 PEGIEVILQSENG-ILGMGPAPE--EGEEDPDLINAGKQPVTLLPGAS   79 (208)
T ss_pred             CCCCEEEEEECCC-CCCCCCCCC--CCCCCHHHHHCCCCEEEEECCCC
T ss_conf             8887488760245-116887567--88778455530787576543886


No 146
>pfam04457 DUF504 Protein of unknown function (DUF504). Family of uncharacterized proteins.
Probab=21.28  E-value=44  Score=12.19  Aligned_cols=15  Identities=7%  Similarity=0.344  Sum_probs=12.5

Q ss_pred             EEEEE-EECCEEEEEE
Q ss_conf             88999-9999999862
Q gi|254780301|r  415 KVVRT-YISGKQVYTL  429 (431)
Q Consensus       415 ~V~~t-iv~G~iVy~~  429 (431)
                      +|..+ ..+|++||+|
T Consensus        41 RI~eI~~~dG~viW~R   56 (56)
T pfam04457        41 RILEIRRKDGEVIWKR   56 (56)
T ss_pred             EEEEEEECCCCEEECC
T ss_conf             7999982188197649


No 147
>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism]
Probab=21.27  E-value=44  Score=12.19  Aligned_cols=21  Identities=19%  Similarity=0.121  Sum_probs=11.7

Q ss_pred             CCCCCHHHHHHHHHHHHHHHC
Q ss_conf             169899999998815179980
Q gi|254780301|r  347 GQQISLKKLIRALSTRPAQIF  367 (431)
Q Consensus       347 ~~gls~~eal~~aT~npA~~l  367 (431)
                      .++-|+.++|+++..--++..
T Consensus       151 GG~TPL~~aL~~a~ev~~r~~  171 (261)
T COG1240         151 GGKTPLADALRQAYEVLAREK  171 (261)
T ss_pred             CCCCCHHHHHHHHHHHHHHHH
T ss_conf             998843999999999999751


No 148
>PRK01424 S-adenosylmethionine:tRNA ribosyltransferase-isomerase; Provisional
Probab=20.90  E-value=29  Score=13.30  Aligned_cols=28  Identities=14%  Similarity=0.338  Sum_probs=12.4

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCEECCCC-CCCEEEE
Q ss_conf             989999999881517998099997246687-2678998
Q gi|254780301|r  349 QISLKKLIRALSTRPAQIFNLPGGTLQTGT-AADIALI  385 (431)
Q Consensus       349 gls~~eal~~aT~npA~~lgl~~G~I~~Gk-~ADlvi~  385 (431)
                      |-|...+|+.+..         .|.+.+|. ..||.|.
T Consensus       276 GTT~vRaLEs~~~---------~g~~~~~~g~TdlfI~  304 (366)
T PRK01424        276 GTTTLRTLESSCN---------NGIVKAGSFETDIFIT  304 (366)
T ss_pred             ECCHHHHHHHHHH---------CCCCCCCCCCCCEEEC
T ss_conf             4516887887751---------6985778883286978


No 149
>TIGR03221 muco_delta muconolactone delta-isomerase. Members of this protein family are muconolactone delta-isomerase (EC 5.3.3.4), the CatC protein of the ortho cleavage pathway for metabolizing aromatic compounds by way of catechol.
Probab=20.88  E-value=45  Score=12.14  Aligned_cols=42  Identities=17%  Similarity=0.227  Sum_probs=30.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCC-CEEC-----CCCCCCEEEECCCC
Q ss_conf             698999999988151799809999-7246-----68726789986989
Q gi|254780301|r  348 QQISLKKLIRALSTRPAQIFNLPG-GTLQ-----TGTAADIALIDLNY  389 (431)
Q Consensus       348 ~gls~~eal~~aT~npA~~lgl~~-G~I~-----~Gk~ADlvi~D~~~  389 (431)
                      ..|+++++-+.-...-|++-.+.+ |.+.     +|..|++-|||-+.
T Consensus        12 ~dm~~~~~~~l~a~Eka~a~~Lq~~Gkw~~lWRv~G~yan~sIfdv~s   59 (90)
T TIGR03221        12 VDMPAEKAAAIKAREKAYAQELQREGKWRHLWRVAGEYANYSIFDVES   59 (90)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEEECCC
T ss_conf             999999999999999999999996786168887257411578997498


No 150
>TIGR01978 sufC FeS assembly ATPase SufC; InterPro: IPR010230   Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] . FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems.   The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins , . It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly .   The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA . SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA , acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets.   In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins . Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen .   This entry represents SufC, which acts as an ATPase in the SUF system. SufC belongs to the ATP-binding cassette transporter family (IPR003439 from INTERPRO) but is no longer thought to be part of a transporter. The complex is reported as cytosolic or associated with the membrane.; GO: 0005524 ATP binding, 0006810 transport.
Probab=20.58  E-value=45  Score=12.10  Aligned_cols=33  Identities=18%  Similarity=0.262  Sum_probs=19.5

Q ss_pred             EEECCEEECCCCCEEEEEEEEEECCEEEEE-CCC
Q ss_conf             996429999888850001089979999983-178
Q gi|254780301|r    5 VLNNTRIIDPSRDIDEVGAIIVENGIILAA-GAD   37 (431)
Q Consensus         5 lI~n~~iid~~~~~~~~~~I~I~~gkI~~I-g~~   37 (431)
                      -|+|=+|==.+..+++.-++-|.-|-|.+| ||+
T Consensus         2 ~I~dLhv~~edk~IL~gvnL~v~~GE~HAiMGPN   35 (248)
T TIGR01978         2 KIKDLHVSVEDKEILKGVNLTVKKGEIHAIMGPN   35 (248)
T ss_pred             CEEEEEEEECCEECCCCCCCCCCCCEEEEEECCC
T ss_conf             0245788877886167867621685179986889


No 151
>cd00530 PTE Phosphotriesterase (PTE) catalyzes the hydrolysis of organophosphate nerve agents, including the chemical warfare agents VX, soman, and sarin as well as the insecticide paraoxon. PTE exists as a homodimer with one active site per monomer. The active site is located next to a binuclear metal center, at the C-terminal end of a TIM alpha- beta barrel motif.  The native enzyme contains two zinc ions at the active site however these can be replaced with other metals such as cobalt, cadmium, nickel or manganese and the enzyme remains active.
Probab=20.44  E-value=46  Score=12.08  Aligned_cols=33  Identities=15%  Similarity=0.297  Sum_probs=24.6

Q ss_pred             CHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             013678886765169899999998815179980
Q gi|254780301|r  335 ETMLSAALRLFHGQQISLKKLIRALSTRPAQIF  367 (431)
Q Consensus       335 ~~~~~~~~~~~~~~gls~~eal~~aT~npA~~l  367 (431)
                      ........-.+...|++.+++=++...||+|+|
T Consensus       261 ~~i~~~~iP~L~~~Gv~~~~i~~ilv~NP~r~L  293 (293)
T cd00530         261 DYILTRFIPRLRERGVTEEQLDTILVENPARFL  293 (293)
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHCHHHHC
T ss_conf             889998999999869999999999986979659


No 152
>PRK09875 putative hydrolase; Provisional
Probab=20.35  E-value=46  Score=12.07  Aligned_cols=32  Identities=19%  Similarity=0.301  Sum_probs=24.0

Q ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             36788867651698999999988151799809
Q gi|254780301|r  337 MLSAALRLFHGQQISLKKLIRALSTRPAQIFN  368 (431)
Q Consensus       337 ~~~~~~~~~~~~gls~~eal~~aT~npA~~lg  368 (431)
                      ......-...+.|+|.+++=++...||+|+|.
T Consensus       261 i~~~~iP~L~~~Gvs~~~I~~ilv~NP~r~F~  292 (292)
T PRK09875        261 LLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ  292 (292)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHCHHHHCC
T ss_conf             89878899998699999999999978697609


No 153
>COG0809 QueA S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) [Translation, ribosomal structure and biogenesis]
Probab=20.22  E-value=37  Score=12.69  Aligned_cols=10  Identities=30%  Similarity=0.345  Sum_probs=4.7

Q ss_pred             EEEEEEEEEC
Q ss_conf             0001089979
Q gi|254780301|r   19 DEVGAIIVEN   28 (431)
Q Consensus        19 ~~~~~I~I~~   28 (431)
                      ++.||++|=|
T Consensus        50 l~~GD~LVfN   59 (348)
T COG0809          50 LNPGDLLVFN   59 (348)
T ss_pred             CCCCCEEEEE
T ss_conf             4878789983


No 154
>pfam09987 DUF2226 Uncharacterized protein conserved in archaea (DUF2226). This domain, found in various hypothetical archaeal proteins, has no known function.
Probab=20.07  E-value=46  Score=12.03  Aligned_cols=25  Identities=32%  Similarity=0.223  Sum_probs=18.8

Q ss_pred             EECCCCCEEEEEEEEEECCEEEEEC
Q ss_conf             9998888500010899799999831
Q gi|254780301|r   11 IIDPSRDIDEVGAIIVENGIILAAG   35 (431)
Q Consensus        11 iid~~~~~~~~~~I~I~~gkI~~Ig   35 (431)
                      |..-.++.+..|.|+|+||+|+.+.
T Consensus        35 I~~k~g~~L~e~~i~VenGKIVg~y   59 (252)
T pfam09987        35 ITTRDGEDLYDAFIIVENGKVVGAY   59 (252)
T ss_pred             EEECCCCCCCEEEEEEECCEEEEEE
T ss_conf             9963687201258999889699999


Done!