BLAST/PSIBLAST alignment of GI: 254780301 and GI: 86357275 at iteration 1
>gi|86357275|ref|YP_469167.1| dihydroorotase [Rhizobium etli CFN 42] Length = 429
>gi|86281377|gb|ABC90440.1| probable dihydroorotase protein [Rhizobium etli CFN 42] Length = 429
 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/426 (50%), Positives = 294/426 (69%), Gaps = 1/426 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            VL N RI+DPSR++DE+G II +NG+ILAAG+ A N   P  A++ DCTGLVA PG++D
Sbjct: 5   IVLKNVRIVDPSRNLDEIGTIIAKNGVILAAGSGAQNQGAPEGAVVRDCTGLVATPGLVD 64

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           ARV +     E+ + I + S+ A AGGITSII+MP      +D+   +++  +  R  + 
Sbjct: 65  ARVHIGEPGGEHRETIASASRAAAAGGITSIIMMP-DTDPVIDDIALVEFVKKTARDTAA 123

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NVYP A LT  + G+E++E+ LL + G V+F  +  S+H+TQVL   M YA    A+++
Sbjct: 124 VNVYPAAALTKGLAGEEMTEIGLLTQAGAVAFTDAHSSVHNTQVLRRIMTYAREFGAVIS 183

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
            +T D +LG+ GV++EG+ A++LGL GIP  +E +PL RDL +A+ T G YHA++IS+P+
Sbjct: 184 CETRDKYLGANGVMHEGLFASWLGLSGIPKEAELIPLERDLRVAELTRGRYHAAMISVPE 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+  I+ A++   K T GISINNL LNEND+  Y +  K+ PPLR E +R++M EAL  G
Sbjct: 244 SVEAIERARSRGAKVTSGISINNLALNENDIGEYRTFFKLYPPLRPEDDRVAMAEALANG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDIIVS H P+ +DTK LPF EA+ G++GLETML+AALRL HG Q+ L +LI A+STRP
Sbjct: 304 AIDIIVSSHDPQDVDTKRLPFGEAADGAVGLETMLAAALRLHHGGQVGLMRLIDAMSTRP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           AQIF L  GTL+ G AADI LIDL+  W V  D + S  KNT F+   F+G+ V TY+SG
Sbjct: 364 AQIFGLEAGTLKPGAAADITLIDLDEPWLVAKDMLLSRSKNTPFEDARFSGRAVATYVSG 423

Query: 424 KQVYTL 429
           K V+ L
Sbjct: 424 KLVHAL 429