BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780301|ref|YP_003064714.1| dihydroorotase [Candidatus
Liberibacter asiaticus str. psy62]
         (431 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780301|ref|YP_003064714.1| dihydroorotase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254039978|gb|ACT56774.1| dihydroorotase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 431

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/431 (100%), Positives = 431/431 (100%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG
Sbjct: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV
Sbjct: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA
Sbjct: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS
Sbjct: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
           IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL
Sbjct: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS
Sbjct: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY
Sbjct: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420

Query: 421 ISGKQVYTLES 431
           ISGKQVYTLES
Sbjct: 421 ISGKQVYTLES 431


>gi|315122274|ref|YP_004062763.1| dihydroorotase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495676|gb|ADR52275.1| dihydroorotase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 431

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/431 (74%), Positives = 379/431 (87%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MTSFVLNN RIIDPSRDIDE+GAIIVENGII+A+G+D LN + PTSA + +C GLVAVPG
Sbjct: 1   MTSFVLNNIRIIDPSRDIDEIGAIIVENGIIIASGSDVLNQELPTSAQVRNCKGLVAVPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +IDARVTL GSP++Y+ NI   SKEA AGGITSIIL P  +S+ +DEYTFIKYA ++I+ 
Sbjct: 61  LIDARVTLEGSPEKYANNIVKTSKEAAAGGITSIILTPFSVSTAMDEYTFIKYAFKKIQE 120

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            SL+NVYPTACLT  MEGK+I+EMRLLQEQG VSF+ +  SI+DTQVLL+SMKYAHMLNA
Sbjct: 121 NSLVNVYPTACLTCKMEGKKINEMRLLQEQGAVSFVHNSRSIYDTQVLLDSMKYAHMLNA 180

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           IV+LDTHD+FLGS+G +NE ++A+ LGL GIP+ISET+PLARDLL+AQHTGGHYHAS IS
Sbjct: 181 IVSLDTHDYFLGSKGTMNESMLADCLGLEGIPAISETIPLARDLLVAQHTGGHYHASAIS 240

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
            PQSI+++ +AK +  KATCGISINNL LNENDV MYNS RKVLPPLRSE ER+ MVE+L
Sbjct: 241 TPQSISILNYAKENKIKATCGISINNLALNENDVGMYNSFRKVLPPLRSEEERVGMVESL 300

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G+IDIIVSDHTP H+DTKLLPFAEA+FGSIGLETMLSAALRLFHGQQISLKKLI+++S
Sbjct: 301 ASGNIDIIVSDHTPHHIDTKLLPFAEATFGSIGLETMLSAALRLFHGQQISLKKLIQSMS 360

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           TRPAQIFN+PGGTL+ G AADIALIDLN+QW VK+DDM S ++NTVFDKE+FTG+VV TY
Sbjct: 361 TRPAQIFNIPGGTLRAGVAADIALIDLNHQWIVKSDDMLSSYRNTVFDKEYFTGRVVETY 420

Query: 421 ISGKQVYTLES 431
           +SG+ +Y LES
Sbjct: 421 VSGECIYKLES 431


>gi|241204125|ref|YP_002975221.1| dihydroorotase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858015|gb|ACS55682.1| dihydroorotase, multifunctional complex type [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 429

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 220/426 (51%), Positives = 295/426 (69%), Gaps = 1/426 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            VL N RIIDPSR++DEVG II ENG+ILAAG  A N   P  A+I DCTGLVA PG++D
Sbjct: 5   IVLKNVRIIDPSRNLDEVGTIIAENGVILAAGGKAQNQGAPDGAVIRDCTGLVATPGLVD 64

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           ARV +     E+ + I ++S+ A AGG+TSII+MP      +D+   +++  +  R  + 
Sbjct: 65  ARVHVGEPGGEHRETIASVSRAAAAGGVTSIIMMP-DTDPIIDDIALVEFVKKTARDTAA 123

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NVYP A +T  + G+E++E+ LL + G V+F  +  S+HDTQVL   M YA    A++ 
Sbjct: 124 VNVYPAAAITKGLAGEEMTEIGLLMQAGAVAFTDAHSSVHDTQVLRRIMTYAREFGAVIC 183

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
            +T D +LG+ GV++EG+ A++LGL GIP  +E +PL RDL IAQ T G YHA++IS+P+
Sbjct: 184 CETRDKYLGANGVMHEGLFASWLGLSGIPKEAELIPLERDLRIAQLTRGRYHAAMISVPE 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+  I+ A++   K TCGISINNL LNEND+  Y +  K+ PPLR E +R++M +AL  G
Sbjct: 244 SVEAIERARSRGAKVTCGISINNLALNENDIGEYRTFFKLYPPLRPEDDRVAMADALASG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDIIVS H P+ +DTK LPF EA  G+IGLETML+AALRL HG Q+SL +LI A+STRP
Sbjct: 304 AIDIIVSSHDPQDVDTKRLPFGEAEDGAIGLETMLAAALRLHHGGQVSLMRLIDAMSTRP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           AQIF L  GTL+ G AADIALIDL+  W V  D + S  KNT F+   F+G+ V TY+SG
Sbjct: 364 AQIFGLNAGTLKPGAAADIALIDLDEPWLVAKDMLLSRSKNTPFEDARFSGRAVATYVSG 423

Query: 424 KQVYTL 429
           K V+ +
Sbjct: 424 KLVHAI 429


>gi|116251504|ref|YP_767342.1| dihydroorotase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256152|emb|CAK07233.1| putative dihydroorotase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 429

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 219/426 (51%), Positives = 295/426 (69%), Gaps = 1/426 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            VL N RIIDPSR++DEVG II ENG+I AAG  A N   P  A+I DCTGLVA PG++D
Sbjct: 5   IVLKNVRIIDPSRNLDEVGTIIAENGVIFAAGHKAQNQGAPDGAVIRDCTGLVATPGLVD 64

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           ARV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++  +  R  + 
Sbjct: 65  ARVHVGEPGGEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDIALVEFVKKTARDTAA 123

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NVYP A +T  + G+E++E+ LL + G V+F  +  S+HDTQVL   M YA    A+V+
Sbjct: 124 VNVYPAAAITKGLAGEEMTEIGLLMQAGAVAFTDAHSSVHDTQVLRRIMTYAREFGAVVS 183

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
            +T D +LG+ GV++EG+ A++LGL GIP  +E +PL RDL IAQ T G YHA++IS+P+
Sbjct: 184 CETRDKYLGANGVMHEGLFASWLGLSGIPKEAELIPLERDLRIAQLTRGRYHAAMISVPE 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+  I+ A++   K TCGISINNL LNEND+  Y +  K+ PPLR E +R++M +A+  G
Sbjct: 244 SVEAIERARSRGAKVTCGISINNLALNENDIGEYRTFFKLYPPLRPEDDRVAMADAVASG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDIIVS H P+ +DTK LPF+EA  G+IGLETML+AALRL HG Q+SL +LI A+STRP
Sbjct: 304 AIDIIVSSHDPQDVDTKRLPFSEAEDGAIGLETMLAAALRLHHGGQVSLMRLIDAMSTRP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           AQIF L  GTL+ G AADIALIDL+  W V  D + S  KNT F+   F+G+ V TY+SG
Sbjct: 364 AQIFGLNAGTLKPGAAADIALIDLDEPWLVAKDMLLSRSKNTPFEDARFSGRAVATYVSG 423

Query: 424 KQVYTL 429
           K V+ +
Sbjct: 424 KLVHAI 429


>gi|209548901|ref|YP_002280818.1| dihydroorotase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534657|gb|ACI54592.1| dihydroorotase, multifunctional complex type [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 434

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 216/420 (51%), Positives = 290/420 (69%), Gaps = 1/420 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            VL N RI+DPSR++DEVG II  NG+ILAAG+ A N   P  A I DCTGLVA PG++D
Sbjct: 5   IVLQNVRIVDPSRNLDEVGTIIAANGVILAAGSAAQNQGAPEGADIRDCTGLVATPGLVD 64

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           ARV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++  +  R  + 
Sbjct: 65  ARVHIGEPGGEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDIALVEFVKKTARDTAA 123

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NVYP A LT  + G+E++E+ LL + G V+F  +  S+HDTQVL   M YA    A++ 
Sbjct: 124 VNVYPAAALTKGLSGEEMTEIGLLMQAGAVAFTDAHSSVHDTQVLRRIMTYAREFGAVIC 183

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
            +T D +LG+ GV++EG+ A++LGL GIP  +E +PL RDL IA+ T G YHA++IS+PQ
Sbjct: 184 CETRDKYLGANGVMHEGLFASWLGLSGIPREAELIPLERDLRIAELTRGRYHAAMISVPQ 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+  I+ A++   K T GISINNL LNEND+  Y +  K+ PPLR E +R++MVEAL  G
Sbjct: 244 SVEAIERARSRGAKVTSGISINNLALNENDIGEYRTFFKLYPPLRPEDDRVAMVEALASG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDIIVS H P+ +DTK LPF EA  G++GLETML+AALRL HG Q+SL +LI A+STRP
Sbjct: 304 AIDIIVSSHDPQDVDTKRLPFGEAEDGAVGLETMLAAALRLHHGGQVSLMRLIDAMSTRP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+IF LP GTL+ G AADIALIDL+  W V  D + S  KNT F+   F+G+ + TY+SG
Sbjct: 364 AEIFGLPAGTLKPGAAADIALIDLDEPWLVAKDMLLSRSKNTPFEDARFSGRAIATYVSG 423


>gi|218674770|ref|ZP_03524439.1| dihydroorotase [Rhizobium etli GR56]
          Length = 429

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 216/426 (50%), Positives = 297/426 (69%), Gaps = 1/426 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            VL N RI+DPSR++DEVG II +NG+ILAAG+ A N   P SA++ DCTGLVA PG++D
Sbjct: 5   IVLKNVRIVDPSRNLDEVGTIIAKNGVILAAGSAAQNQGTPDSAVVRDCTGLVATPGLVD 64

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           ARV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++  +  R  + 
Sbjct: 65  ARVHIGEPGGEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDIALVEFVKKTARDTAA 123

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + VYP A +T ++ G+E++E+ LL + G V+F  +  S+HDTQVL   M YA    A+V 
Sbjct: 124 VKVYPAAAITKHLAGEEMTEIGLLMQAGAVAFTDAHSSVHDTQVLRRIMTYAREFGAVVC 183

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
            +T D +LG+ GV++EG+ A++LGL GIP  +E +PL RDL IA+ T G YHA++IS+PQ
Sbjct: 184 CETRDKYLGANGVMHEGLFASWLGLSGIPREAELIPLERDLRIAELTRGRYHAAMISVPQ 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+  I+ A++   K T GISINNL LNEND+  Y +  K+ PPLR E +R++MV+AL +G
Sbjct: 244 SVEAIELARSRGAKVTSGISINNLALNENDIGEYRTFFKLYPPLRPEDDRVAMVDALARG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDIIVS H P+ +DTK LPF EA+ G++GLETML+AALRL HG Q+SL +LI A+STRP
Sbjct: 304 AIDIIVSSHDPQDVDTKRLPFGEAADGAVGLETMLAAALRLHHGGQVSLMRLIDAMSTRP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+IF L  GTL+ G AADI LIDL+  W V  D + S  KNT F+   F+G+ V TY+SG
Sbjct: 364 AEIFGLDAGTLKPGAAADITLIDLDEPWLVAKDMLLSRSKNTPFEDARFSGRAVATYVSG 423

Query: 424 KQVYTL 429
           K V+ L
Sbjct: 424 KLVHAL 429


>gi|86357275|ref|YP_469167.1| dihydroorotase [Rhizobium etli CFN 42]
 gi|86281377|gb|ABC90440.1| probable dihydroorotase protein [Rhizobium etli CFN 42]
          Length = 429

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/426 (50%), Positives = 294/426 (69%), Gaps = 1/426 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            VL N RI+DPSR++DE+G II +NG+ILAAG+ A N   P  A++ DCTGLVA PG++D
Sbjct: 5   IVLKNVRIVDPSRNLDEIGTIIAKNGVILAAGSGAQNQGAPEGAVVRDCTGLVATPGLVD 64

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           ARV +     E+ + I + S+ A AGGITSII+MP      +D+   +++  +  R  + 
Sbjct: 65  ARVHIGEPGGEHRETIASASRAAAAGGITSIIMMP-DTDPVIDDIALVEFVKKTARDTAA 123

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NVYP A LT  + G+E++E+ LL + G V+F  +  S+H+TQVL   M YA    A+++
Sbjct: 124 VNVYPAAALTKGLAGEEMTEIGLLTQAGAVAFTDAHSSVHNTQVLRRIMTYAREFGAVIS 183

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
            +T D +LG+ GV++EG+ A++LGL GIP  +E +PL RDL +A+ T G YHA++IS+P+
Sbjct: 184 CETRDKYLGANGVMHEGLFASWLGLSGIPKEAELIPLERDLRVAELTRGRYHAAMISVPE 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+  I+ A++   K T GISINNL LNEND+  Y +  K+ PPLR E +R++M EAL  G
Sbjct: 244 SVEAIERARSRGAKVTSGISINNLALNENDIGEYRTFFKLYPPLRPEDDRVAMAEALANG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDIIVS H P+ +DTK LPF EA+ G++GLETML+AALRL HG Q+ L +LI A+STRP
Sbjct: 304 AIDIIVSSHDPQDVDTKRLPFGEAADGAVGLETMLAAALRLHHGGQVGLMRLIDAMSTRP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           AQIF L  GTL+ G AADI LIDL+  W V  D + S  KNT F+   F+G+ V TY+SG
Sbjct: 364 AQIFGLEAGTLKPGAAADITLIDLDEPWLVAKDMLLSRSKNTPFEDARFSGRAVATYVSG 423

Query: 424 KQVYTL 429
           K V+ L
Sbjct: 424 KLVHAL 429


>gi|222085616|ref|YP_002544146.1| dihydroorotase protein [Agrobacterium radiobacter K84]
 gi|221723064|gb|ACM26220.1| dihydroorotase protein [Agrobacterium radiobacter K84]
          Length = 429

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 217/427 (50%), Positives = 293/427 (68%), Gaps = 1/427 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S VL N RIIDPSR++DEVG IIVENG+I++AG DA     P  A + DCTGLVAVPG++
Sbjct: 4   SIVLQNVRIIDPSRNLDEVGTIIVENGLIVSAGKDAKIQAAPKGAEVRDCTGLVAVPGLV 63

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           DARV +     E+ + I + S+ A AGG+TS I+MP      +D+   +++  +  R  +
Sbjct: 64  DARVHVGEPGGEHRETIASASRAAAAGGVTSFIMMP-DTDPIIDDIALVEFVKKTARDTA 122

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++NVYP A LT  + G+E++E+ LL+E G V F  +   +HDTQVL   M YA    A++
Sbjct: 123 VVNVYPAAALTKGLAGEEMTEVGLLREAGAVVFTDAHSGVHDTQVLRRIMTYAREFGAVI 182

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           + +T D +LG+ GV++EG+ A++LGL GIP  +E +PL RDL IA  T  HYHA++IS+P
Sbjct: 183 SCETRDKYLGANGVMHEGLFASWLGLSGIPKEAELIPLERDLRIAALTRSHYHAAMISVP 242

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S   I+ A++   K TCGISINNL LNEND+  Y +  K+ PPLRSE +R +M+EAL  
Sbjct: 243 ESAEAIRLARSRGAKVTCGISINNLALNENDIGEYRTFFKLYPPLRSEDDRSAMIEALAD 302

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G IDIIVS H P+ +DTK LPF EA  G++GLET+L+AALRL H  Q+SL +LI ALSTR
Sbjct: 303 GTIDIIVSSHDPQDVDTKRLPFGEAEDGAVGLETLLAAALRLHHSGQVSLMRLIDALSTR 362

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PAQIF L  GTL+ G  ADIALIDL+  W V  D + S  KNT F+    +G+ V TY++
Sbjct: 363 PAQIFGLDAGTLKPGAKADIALIDLDEPWLVAKDMLLSRSKNTPFEDARMSGRAVATYVA 422

Query: 423 GKQVYTL 429
           GK V++L
Sbjct: 423 GKLVHSL 429


>gi|190891324|ref|YP_001977866.1| dihydroorotase [Rhizobium etli CIAT 652]
 gi|190696603|gb|ACE90688.1| probable dihydroorotase protein [Rhizobium etli CIAT 652]
          Length = 429

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 213/426 (50%), Positives = 294/426 (69%), Gaps = 1/426 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            VL N RI+DPSR++DEVG II ENG+ILAAG+ A N   P  A++ DC GLVA PG++D
Sbjct: 5   IVLKNVRIVDPSRNLDEVGTIIAENGVILAAGSAAQNQGAPDGAVVRDCAGLVATPGLVD 64

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           ARV +     E+ + I + S+ A AGG++SI++MP      +D+   +++  +  R  + 
Sbjct: 65  ARVHIGEPGGEHRETIASASRAAAAGGVSSIVVMP-DTDPVIDDIALVEFVKKTARDTAS 123

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NVYP A +T  + G+E++E+ LL + G V+F  +  S+HDTQVL   M YA    A+++
Sbjct: 124 VNVYPAAAITKGLAGEEMTEIGLLMQAGAVAFTDAHSSVHDTQVLRRIMTYAREFGAVIS 183

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
            +T D +LG+ GV++EG+ A++LGL GIP  +E +PL RDL IA  T G YHA++IS+PQ
Sbjct: 184 CETRDKYLGANGVMHEGLFASWLGLSGIPREAELIPLERDLRIAALTRGRYHAAMISVPQ 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+  I+ A++   K T GISINNL LNEND+  Y +  K+ PPLR E +R++MVEAL +G
Sbjct: 244 SVEAIELARSRGAKVTSGISINNLALNENDIGEYRTFFKLYPPLRPEDDRVAMVEALARG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDIIVS H P+ +DTK LPF EA+ G++GLETML+AALRL HG Q+SL +LI A+STRP
Sbjct: 304 AIDIIVSAHDPQDVDTKRLPFGEAADGAVGLETMLAAALRLHHGGQVSLMRLIDAMSTRP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+IF L  GTL+ G  ADI LIDL+  W V  D + S  KNT F+   F+G+ V TY+SG
Sbjct: 364 AEIFGLAAGTLKPGAPADITLIDLDEPWLVAKDMLLSRSKNTPFEDARFSGRAVATYVSG 423

Query: 424 KQVYTL 429
           K V+ L
Sbjct: 424 KLVHAL 429


>gi|227821658|ref|YP_002825628.1| dihydroorotase [Sinorhizobium fredii NGR234]
 gi|227340657|gb|ACP24875.1| dihydroorotase [Sinorhizobium fredii NGR234]
          Length = 430

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 207/426 (48%), Positives = 285/426 (66%), Gaps = 2/426 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVEN-GIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
            VL N RI+DPSR++DE G I+V N G ILAAG DA+N   P  A + DC GL AVPG++
Sbjct: 5   LVLQNLRIVDPSRNLDETGTIVVGNDGRILAAGKDAMNQGVPAGAFVKDCAGLTAVPGLV 64

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           DARV +     EY + I + S+ A  GG+TS I MP   +  +DE   +++  +  R K+
Sbjct: 65  DARVFVGEPGSEYRETIESASRAAATGGVTSFIAMP-DTNPVIDEIALVEFVQKTARDKA 123

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+NV+P A LT  + G E+SE+ LL++ G V F      +HD+ VL  +M YA   +A+V
Sbjct: 124 LVNVHPAAALTKGLLGAEMSELGLLRDAGAVCFTNGRQPVHDSLVLRRAMTYAREFDAVV 183

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           AL+T D +LG+ GV+NEG++A++LGL GIP  +E +PL RDL IA  T   YHA+ +S+P
Sbjct: 184 ALETRDKYLGANGVMNEGLLASWLGLPGIPREAEIIPLERDLRIAALTKAAYHAAEVSLP 243

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S   ++ A+      TCGISIN+L LNEND+  Y +  K+ PPLR E +R++MVEAL  
Sbjct: 244 ESADAVQAARERGANVTCGISINHLTLNENDIGEYRTFFKLSPPLRGEDDRVAMVEALAT 303

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G IDIIVS H P+  DTK LPFA+A+ G+IGLET+ +AALRL+H  Q+ L +LI ALSTR
Sbjct: 304 GKIDIIVSSHDPQGADTKRLPFADAADGAIGLETLAAAALRLYHSGQVPLMRLIDALSTR 363

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA IF L  GTL+ G  ADI ++DL+  W +   ++ S  KNT F+   FTG+VV+TY+ 
Sbjct: 364 PAAIFGLDAGTLKPGAKADITVLDLDEPWILYEKELVSRSKNTPFENARFTGRVVQTYVG 423

Query: 423 GKQVYT 428
           GK V++
Sbjct: 424 GKLVHS 429


>gi|307317861|ref|ZP_07597299.1| dihydroorotase, multifunctional complex type [Sinorhizobium
           meliloti AK83]
 gi|306896623|gb|EFN27371.1| dihydroorotase, multifunctional complex type [Sinorhizobium
           meliloti AK83]
          Length = 430

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/426 (48%), Positives = 289/426 (67%), Gaps = 2/426 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIV-ENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
            VL N RI+DPSR +DE+GAIIV ++G ILAAG DA N   P  A + DC GL AVPG++
Sbjct: 5   LVLQNLRIVDPSRKLDEIGAIIVGDDGRILAAGKDAQNQGVPADAFVKDCAGLTAVPGLV 64

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           DARV +     E+ + I + S+ A  GG+TS I MP      +D+   +++  +  R K+
Sbjct: 65  DARVFVGEPGSEHRETIESASRAAATGGVTSFIAMP-DTDPVIDDIALVEFVQKTARDKA 123

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+NV+P A LT  + G+E++E+ LL++ G V F      +HDT VL  +M YA    A+V
Sbjct: 124 LVNVHPAAALTKGLLGQEMTEIGLLRDAGAVCFTNGRQPVHDTLVLRRAMTYAREFGAVV 183

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           AL T D +LG+ GV+NEG++A++LGL G+P  +E +PL RDL IA  T   YHA+ IS+P
Sbjct: 184 ALGTRDKYLGANGVMNEGLLASWLGLPGVPREAEIIPLERDLRIAGLTRAAYHAAEISVP 243

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S   I+ A+   T  TCGISIN+L LNEND+  Y +  K+ PPLR+E +R++MVEAL  
Sbjct: 244 ESAETIRIARERGTNVTCGISINHLTLNENDIGEYRTFFKLSPPLRTEDDRVAMVEALAD 303

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G IDIIVS H P+ +DTK LPFA+A+ G+IGLET+ +AALRL+H  ++ L +LI ALSTR
Sbjct: 304 GTIDIIVSSHDPQDVDTKRLPFADAADGAIGLETLAAAALRLYHSGEVPLMRLIDALSTR 363

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA IF L  GTL+ G  ADIA+IDL+  W +  + + S  KNT F+   FTG+VV+TY++
Sbjct: 364 PAAIFGLDAGTLKPGARADIAVIDLDEPWVLHKETLVSRSKNTPFENARFTGRVVQTYVA 423

Query: 423 GKQVYT 428
           G+ V++
Sbjct: 424 GELVHS 429


>gi|15965056|ref|NP_385409.1| dihydroorotase [Sinorhizobium meliloti 1021]
 gi|307301128|ref|ZP_07580897.1| dihydroorotase, multifunctional complex type [Sinorhizobium
           meliloti BL225C]
 gi|15074235|emb|CAC45882.1| Dihydroorotase [Sinorhizobium meliloti 1021]
 gi|306904083|gb|EFN34669.1| dihydroorotase, multifunctional complex type [Sinorhizobium
           meliloti BL225C]
          Length = 430

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/426 (48%), Positives = 288/426 (67%), Gaps = 2/426 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIV-ENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
            VL N RI+DPSR +DE+G IIV ++G ILAAG DA N   P  A + DC GL AVPG++
Sbjct: 5   LVLQNLRIVDPSRKLDEIGTIIVGDDGRILAAGKDAQNQGVPADAFVKDCAGLTAVPGLV 64

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           DARV +     E+ + I + S+ A  GG+TS I MP      +D+   +++  +  R K+
Sbjct: 65  DARVFVGEPGSEHRETIESASRAAATGGVTSFIAMP-DTDPVIDDIALVEFVQKTARDKA 123

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+NV+P A LT  + G+E++E+ LL++ G V F      +HDT VL  +M YA    A+V
Sbjct: 124 LVNVHPAAALTKGLLGQEMTEIGLLRDAGAVCFTNGRQPVHDTLVLRRAMTYAREFGAVV 183

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           AL T D +LG+ GV+NEG++A++LGL G+P  +E +PL RDL IA  T   YHA+ IS+P
Sbjct: 184 ALGTRDKYLGANGVMNEGLLASWLGLPGVPREAEIIPLERDLRIAGLTRAAYHAAEISVP 243

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S   I+ A+   T  TCGISIN+L LNEND+  Y +  K+ PPLR+E +R++MVEAL  
Sbjct: 244 ESAETIRIARERGTNVTCGISINHLTLNENDIGEYRTFFKLSPPLRTEDDRVAMVEALAD 303

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G IDIIVS H P+ +DTK LPFA+A+ G+IGLET+ +AALRL+H  ++ L +LI ALSTR
Sbjct: 304 GTIDIIVSSHDPQDVDTKRLPFADAADGAIGLETLAAAALRLYHSGEVPLMRLIDALSTR 363

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           P+ IF L  GTL+ G  ADIA+IDL+  W +  + + S  KNT F+   FTG+VV+TY++
Sbjct: 364 PSAIFGLDAGTLKPGARADIAVIDLDEPWVLHKETLVSRSKNTPFENARFTGRVVQTYVA 423

Query: 423 GKQVYT 428
           G+ V++
Sbjct: 424 GELVHS 429


>gi|15888632|ref|NP_354313.1| dihydroorotase [Agrobacterium tumefaciens str. C58]
 gi|15156360|gb|AAK87098.1| dihydroorotase [Agrobacterium tumefaciens str. C58]
          Length = 430

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 208/426 (48%), Positives = 293/426 (68%), Gaps = 3/426 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIV-ENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           VL N RI+DPSR++DE G+I++  +G ILAAG DA N   P  A + DCTG+VAVPG++D
Sbjct: 6   VLKNLRIVDPSRNLDETGSIVIGADGTILAAGKDAHNQGAPDGATVRDCTGIVAVPGLVD 65

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           ARV +     E+ + I + S+ A AGG+TSII+MP      +D+   ++Y  +  R K++
Sbjct: 66  ARVFVGEPGGEHRETIESASRAAAAGGVTSIIVMP-DTDPVIDDIALVEYVKKTARDKAI 124

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NV+P A LT  + G+E++E  +L+E G V+F     ++ DT VL  +M YA  L A++A
Sbjct: 125 VNVHPAAALTKGLRGEEMTEFGMLKEAGAVAFTNGRKALSDTLVLRRAMTYARELGAVIA 184

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L+T D ++G  G +NEG+ A++LGL G+P  +E +PL RDL IA  T   YHA+ IS+P+
Sbjct: 185 LETRDKYIGG-GDMNEGLFASWLGLSGVPKEAEIIPLERDLRIAGLTQAIYHAAKISVPE 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S   I+ A+    KATCGISIN+L LNEND+  Y +  K+ PPLR+E +R +MVEAL+ G
Sbjct: 244 SAEAIRIARQRGVKATCGISINHLTLNENDIGEYRTFFKLSPPLRAEDDRKAMVEALKDG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDIIVS H P+ +DTK LPF++A+ G++GLETML+AALRL+H  ++ L +LI ALSTRP
Sbjct: 304 TIDIIVSSHDPQDVDTKRLPFSDAASGAVGLETMLAAALRLYHSGEVPLMRLIDALSTRP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+IF L  GTL+ G  ADI LIDL+  W V  D + S  KNT F+   F+G+ V TY++G
Sbjct: 364 AKIFGLDAGTLKAGAKADITLIDLDEPWLVARDQLVSKSKNTPFEDARFSGRAVATYVAG 423

Query: 424 KQVYTL 429
           K V++L
Sbjct: 424 KAVHSL 429


>gi|150396158|ref|YP_001326625.1| dihydroorotase [Sinorhizobium medicae WSM419]
 gi|150027673|gb|ABR59790.1| dihydroorotase, multifunctional complex type [Sinorhizobium medicae
           WSM419]
          Length = 430

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 211/426 (49%), Positives = 289/426 (67%), Gaps = 2/426 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIV-ENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
            VL N RI+DPSR +DE G IIV ++G ILAAG DA N   P  A++ DC GL+AVPG++
Sbjct: 5   LVLQNLRIVDPSRSLDENGTIIVTDDGRILAAGKDAQNQGAPAGAVVKDCAGLIAVPGLV 64

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           DARV L     E+ + I + S+ A AGG+TS I MP      +DE   +++  +  R K+
Sbjct: 65  DARVFLGEPGSEHRETIESASRAAAAGGVTSFISMP-DAEPVIDEIALVEFVQKTARDKA 123

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+NVYP A LT  + GKE++E+ LL++ G V        +HDT VL  +M YA    A+V
Sbjct: 124 LVNVYPAAALTKGLLGKEMTEIGLLRDAGAVCLTNGRQPVHDTLVLRRAMTYAREFGAVV 183

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           AL+T D +LG+ GV+NEG++A++LGL G+P  +E +PL RDL IA  T   YHA+ IS+P
Sbjct: 184 ALETRDKYLGANGVMNEGLLASWLGLPGVPREAEIIPLERDLRIAALTKAAYHAAKISVP 243

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S A I+ AK   +  T GISINNL LNEND+  Y +  K+ PPLR+E +R++MVEAL  
Sbjct: 244 ESAACIRVAKESGSSVTSGISINNLTLNENDIGEYRTFFKLSPPLRTEDDRVAMVEALAS 303

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G IDIIVS H P+ +DTK LPFA+A+ G+IGLET+ +AALRL+H   + L +LI ALSTR
Sbjct: 304 GTIDIIVSSHDPQDVDTKRLPFADAADGAIGLETLAAAALRLYHSGHVPLMRLIDALSTR 363

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA IF L  GTL+ G  ADIA+ID++  W +  + + S  KNT F+   FTG+VV+TY++
Sbjct: 364 PAAIFGLDAGTLKPGARADIAVIDIDEPWVLHKETLVSRSKNTPFENARFTGRVVQTYVA 423

Query: 423 GKQVYT 428
           G+ V++
Sbjct: 424 GELVHS 429


>gi|325292669|ref|YP_004278533.1| dihydroorotase [Agrobacterium sp. H13-3]
 gi|325060522|gb|ADY64213.1| dihydroorotase [Agrobacterium sp. H13-3]
          Length = 430

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/426 (48%), Positives = 291/426 (68%), Gaps = 3/426 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIV-ENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           VL N RI+DPSR++DEVG+I++  +G IL +G  A N   P  A + DC GL+AVPG++D
Sbjct: 6   VLKNLRIVDPSRNLDEVGSIVIGADGTILDSGGQAHNQGVPEGATVRDCKGLLAVPGLVD 65

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           ARV +     E+ + I + S+ A AGG+TSII+MP      +D+   ++Y  +  R K+L
Sbjct: 66  ARVFVGEPGGEHRETIESASRAAAAGGVTSIIVMP-DTDPVIDDIALVEYVKKAARDKAL 124

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NV+P A LT  + G+E++E+ +L+E G V+F     ++ DT VL  +M YA  L A++A
Sbjct: 125 VNVHPAAALTKGLNGEEMTEIGMLKEAGAVAFTNGRRALSDTLVLRRAMTYARELGAVIA 184

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L+T D ++G  G +NEG+ A++LGL GIP  +E +PL RDL IA  T   YHA+ IS+P+
Sbjct: 185 LETRDKYIGG-GDMNEGLFASWLGLSGIPKEAEIIPLERDLRIAGLTQAIYHAAKISVPE 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S   I+ A+    KATCGISIN+L LNEND+  Y +  K+ PPLR+E +R +MVEAL+ G
Sbjct: 244 SAEAIRLARQRGVKATCGISINHLTLNENDIGEYRTFFKLSPPLRAEDDRKAMVEALKDG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDIIVS H P+ +DTK LPF++A+ G++GLETML+AALRL H  ++ L +LI ALSTRP
Sbjct: 304 TIDIIVSSHDPQDVDTKRLPFSDAASGAVGLETMLAAALRLHHSGEVPLMRLIDALSTRP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+IF L  GTL+ G  ADI LIDL+  W V  D + S  KNT F+   F+G+ V TY++G
Sbjct: 364 AKIFGLDAGTLKAGAKADITLIDLDEPWLVARDQLVSKSKNTPFEDARFSGRAVATYVAG 423

Query: 424 KQVYTL 429
           K V++L
Sbjct: 424 KAVHSL 429


>gi|222148312|ref|YP_002549269.1| dihydroorotase [Agrobacterium vitis S4]
 gi|221735300|gb|ACM36263.1| dihydroorotase [Agrobacterium vitis S4]
          Length = 430

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/427 (48%), Positives = 283/427 (66%), Gaps = 3/427 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIV-ENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
            V  N RIIDPSR +DEVG+IIV  +G ILA+GADA N   P  A I DC GLVA PG++
Sbjct: 5   LVFTNARIIDPSRSLDEVGSIIVGADGRILASGADARNQGAPEGAEIRDCKGLVAAPGLV 64

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           DA+V +     E+ + + +  K A AGG+TS ++MP      +D+   +++     R KS
Sbjct: 65  DAQVFVGEPGGEHRETLASAGKAAAAGGVTSFVMMP-DTDPVIDDIALVEFIKNAAREKS 123

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            +N+YP A LT  + G+E++E  LLQ+ G V F      + DT VL  +M YA    A++
Sbjct: 124 PVNIYPAAALTRRLRGEEMTEFGLLQQAGAVCFTNGRHGLDDTLVLRRAMTYAREFGAVI 183

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           +L+ H+ +LG+ GV+NEG+ A++LGL G+P  +E +PL RDL IA  T   YHA+ IS+P
Sbjct: 184 SLELHEKYLGN-GVMNEGLFASWLGLSGVPKEAEIIPLERDLRIAGLTRAKYHAAKISVP 242

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S+  IK A+A     TCGISINNL LNEND+  Y +  K+ PPLR+E +R++MVEAL  
Sbjct: 243 GSVEAIKLARARGANVTCGISINNLSLNENDIGEYRTFFKLAPPLRAEDDRVAMVEALAS 302

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           GDIDIIVS H P+ +DTK LPF +A+ G++GLET+L+AALRL H  Q+ L +LI A+STR
Sbjct: 303 GDIDIIVSAHDPQDVDTKRLPFGDAADGAVGLETLLAAALRLHHAGQVPLMRLIDAMSTR 362

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA IF L  GTL+ G  ADI LIDL+  W V  + + S  KNT F+   F+G+ V TY++
Sbjct: 363 PAAIFGLDAGTLKPGAKADIVLIDLDEPWLVAKETLLSRSKNTPFEDARFSGRAVATYVA 422

Query: 423 GKQVYTL 429
           G+ V++L
Sbjct: 423 GRPVFSL 429


>gi|153010988|ref|YP_001372202.1| dihydroorotase [Ochrobactrum anthropi ATCC 49188]
 gi|151562876|gb|ABS16373.1| dihydroorotase, multifunctional complex type [Ochrobactrum anthropi
           ATCC 49188]
          Length = 428

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/428 (43%), Positives = 284/428 (66%), Gaps = 1/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +  N RIIDPSR +DE G++++ +G I+AAGADA N   P  A I D  G   +PG
Sbjct: 1   MSAILFENARIIDPSRGLDETGSVLIRDGKIVAAGADARNQGAPEGAEIIDLNGKAVLPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++DARV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++     R 
Sbjct: 61  LVDARVFVGEPGAEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDVALVEFVKRTARD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++NV+P A +T  + G+E++E+ LL++ G V+F +   +I +TQ++  ++ YA   NA
Sbjct: 120 TAVVNVHPAAAITKGLRGEEMTEIGLLRDAGAVAFTEGRQTIANTQLMRRALTYARDFNA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++A +T D FLG+ GV+NEG+ A++LGL G P  +E +PL RDL +A  T  +YHA+ +S
Sbjct: 180 VIACETRDPFLGANGVMNEGLFASWLGLSGSPREAEVIPLERDLRLAALTNSNYHAAQLS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S   ++ AK    K T G+SIN+L LNEND+  + +  ++ PPLR E +R++MVEA+
Sbjct: 240 CAMSAEAVRRAKDLGAKVTAGVSINHLSLNENDIGEFRTFFRLSPPLRGEQDRLAMVEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G IDI+VS H P+ +DTK LPFA+A  G+IGLET+L AALRL+H   I L +L+  LS
Sbjct: 300 KNGTIDIVVSAHDPQDVDTKRLPFADAEAGAIGLETLLGAALRLYHNDSIPLLRLVEVLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA+IF L  GTL+ G  AD+A++DL+  W V+ +D+ S+ KN+ F+   F G+VV T 
Sbjct: 360 TAPARIFGLDAGTLKPGAKADLAIVDLDEPWIVREEDLHSLSKNSCFESARFQGRVVHTL 419

Query: 421 ISGKQVYT 428
           ++GK VY+
Sbjct: 420 VAGKTVYS 427


>gi|239833966|ref|ZP_04682294.1| dihydroorotase, multifunctional complex type [Ochrobactrum
           intermedium LMG 3301]
 gi|239822029|gb|EEQ93598.1| dihydroorotase, multifunctional complex type [Ochrobactrum
           intermedium LMG 3301]
          Length = 428

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/428 (42%), Positives = 285/428 (66%), Gaps = 1/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +  N RI+DPSR +DE G++++ +G I+AAGA+A N   P  A I D  G   +PG
Sbjct: 1   MSAILFENARIVDPSRGLDETGSVLIRDGKIVAAGANARNQGAPEGAEIVDLNGKAVLPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++DARV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++     R 
Sbjct: 61  MVDARVFIGEPGAEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDVALVEFVKRTARD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++NV+P A +T  + G+E++E+ LL++ G V+F +   +I +TQ++  ++ YA   NA
Sbjct: 120 TAVVNVHPAAAITKGLRGEEMTEIGLLRDAGAVAFTEGRQTIANTQLMRRALTYARDFNA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++A +T D +LG+ GV+NEG+ A++LGL G P  +E +PL RDL +A  T  +YHA+ +S
Sbjct: 180 VIACETRDPYLGANGVMNEGLFASWLGLSGSPREAEVIPLERDLRLAALTNSNYHAAQLS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S   ++ AK    K T G+SIN+L LNEND+  + +  ++ PPLRSE +R++MVEA+
Sbjct: 240 CEMSAEAVRRAKDLGAKVTAGVSINHLSLNENDIGEFRTFFRLSPPLRSEQDRLAMVEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G IDI+VS H P+ +DTK LPF++A  G+IGLET+L AALRL+H   I L +L+  LS
Sbjct: 300 KNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLETLLGAALRLYHNDSIPLLRLVEVLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA+IF L  GTL+ G  AD+A++DL   W V+A+D+ S+ KN+ F+   F G+VV T 
Sbjct: 360 TAPAKIFGLDAGTLKPGAKADLAIVDLEEPWVVRAEDLHSLSKNSCFESARFQGRVVHTL 419

Query: 421 ISGKQVYT 428
           ++GK VY+
Sbjct: 420 VAGKTVYS 427


>gi|23500344|ref|NP_699784.1| dihydroorotase [Brucella suis 1330]
 gi|23463959|gb|AAN33789.1| dihydroorotase, multifunctional complex type [Brucella suis 1330]
          Length = 428

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/428 (43%), Positives = 283/428 (66%), Gaps = 1/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +  N RI+DPSR +DE G++++ENG I+AAG++A N   P  A I D  G   +PG
Sbjct: 1   MSAILFENARIVDPSRGLDETGSLLIENGKIVAAGSEARNQGAPEGAEIVDLDGKAVMPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D+RV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++     R 
Sbjct: 61  LVDSRVFIGEPGAEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDVALVEFVKRTARD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++NV+PTA +T  + G+E++E  LL+  G V+F +   +I +TQ++  ++ YA   NA
Sbjct: 120 TAIVNVHPTAAITKGLHGEEMTEFGLLRAAGAVAFTEGRNTIANTQIMRRALTYARDFNA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++A +T D FLG+ GV+NEG+ A++LGL G P  +E +PL RDL +A  T   YHA  +S
Sbjct: 180 VIACETRDPFLGANGVMNEGLFASWLGLSGTPREAEVIPLERDLRLAALTRSRYHAVQLS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S   ++ AK   T  T G+SIN+L LNEND+  + +  ++ PPLR E +R++MVEA+
Sbjct: 240 CAMSADAMRRAKDLGTNVTAGVSINHLSLNENDIGEFRTFFRLSPPLRGEEDRLAMVEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G IDI+VS H P+ +DTK LPF++A  G+IGLET+L+AALRL+H   I L +L+  LS
Sbjct: 300 KNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLETLLAAALRLYHNDNIPLLRLVEVLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA+IF L  GTL+ G +ADIA++DL   W V+ +D+ S  KN+ F+   F G+VVRT 
Sbjct: 360 TAPAKIFGLNAGTLKPGASADIAIVDLEEPWVVREEDLHSRSKNSCFESARFQGRVVRTI 419

Query: 421 ISGKQVYT 428
           ++GK VY+
Sbjct: 420 VAGKTVYS 427


>gi|62317543|ref|YP_223396.1| dihydroorotase [Brucella abortus bv. 1 str. 9-941]
 gi|83269524|ref|YP_418815.1| dihydroorotase [Brucella melitensis biovar Abortus 2308]
 gi|161620662|ref|YP_001594548.1| dihydroorotase [Brucella canis ATCC 23365]
 gi|163844752|ref|YP_001622407.1| dihydroorotase [Brucella suis ATCC 23445]
 gi|189022798|ref|YP_001932539.1| dihydroorotase [Brucella abortus S19]
 gi|225629092|ref|ZP_03787125.1| dihydroorotase, multifunctional complex type [Brucella ceti str.
           Cudo]
 gi|237817091|ref|ZP_04596083.1| dihydroorotase, multifunctional complex type [Brucella abortus str.
           2308 A]
 gi|254691040|ref|ZP_05154294.1| dihydroorotase [Brucella abortus bv. 6 str. 870]
 gi|254695653|ref|ZP_05157481.1| dihydroorotase [Brucella abortus bv. 3 str. Tulya]
 gi|254698824|ref|ZP_05160652.1| dihydroorotase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254702975|ref|ZP_05164803.1| dihydroorotase [Brucella suis bv. 3 str. 686]
 gi|254705904|ref|ZP_05167732.1| dihydroorotase [Brucella pinnipedialis M163/99/10]
 gi|254711131|ref|ZP_05172942.1| dihydroorotase [Brucella pinnipedialis B2/94]
 gi|254712410|ref|ZP_05174221.1| dihydroorotase [Brucella ceti M644/93/1]
 gi|254715482|ref|ZP_05177293.1| dihydroorotase [Brucella ceti M13/05/1]
 gi|254732271|ref|ZP_05190849.1| dihydroorotase [Brucella abortus bv. 4 str. 292]
 gi|256015377|ref|YP_003105386.1| dihydroorotase [Brucella microti CCM 4915]
 gi|256029512|ref|ZP_05443126.1| dihydroorotase [Brucella pinnipedialis M292/94/1]
 gi|256157707|ref|ZP_05455625.1| dihydroorotase [Brucella ceti M490/95/1]
 gi|256253321|ref|ZP_05458857.1| dihydroorotase [Brucella ceti B1/94]
 gi|256256225|ref|ZP_05461761.1| dihydroorotase [Brucella abortus bv. 9 str. C68]
 gi|260167397|ref|ZP_05754208.1| dihydroorotase [Brucella sp. F5/99]
 gi|260544779|ref|ZP_05820600.1| amidohydrolase [Brucella abortus NCTC 8038]
 gi|260568112|ref|ZP_05838581.1| amidohydrolase [Brucella suis bv. 4 str. 40]
 gi|260756636|ref|ZP_05868984.1| dihydroorotase [Brucella abortus bv. 6 str. 870]
 gi|260760066|ref|ZP_05872414.1| dihydroorotase [Brucella abortus bv. 4 str. 292]
 gi|260763305|ref|ZP_05875637.1| dihydroorotase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882453|ref|ZP_05894067.1| dihydroorotase [Brucella abortus bv. 9 str. C68]
 gi|261216053|ref|ZP_05930334.1| dihydroorotase [Brucella abortus bv. 3 str. Tulya]
 gi|261217217|ref|ZP_05931498.1| dihydroorotase [Brucella ceti M13/05/1]
 gi|261220437|ref|ZP_05934718.1| dihydroorotase [Brucella ceti B1/94]
 gi|261313333|ref|ZP_05952530.1| dihydroorotase [Brucella pinnipedialis M163/99/10]
 gi|261318722|ref|ZP_05957919.1| dihydroorotase [Brucella pinnipedialis B2/94]
 gi|261320088|ref|ZP_05959285.1| dihydroorotase [Brucella ceti M644/93/1]
 gi|261753584|ref|ZP_05997293.1| dihydroorotase [Brucella suis bv. 3 str. 686]
 gi|261756807|ref|ZP_06000516.1| amidohydrolase [Brucella sp. F5/99]
 gi|265986520|ref|ZP_06099077.1| dihydroorotase [Brucella pinnipedialis M292/94/1]
 gi|265996212|ref|ZP_06108769.1| dihydroorotase [Brucella ceti M490/95/1]
 gi|294853602|ref|ZP_06794274.1| dihydroorotase [Brucella sp. NVSL 07-0026]
 gi|297249582|ref|ZP_06933283.1| dihydroorotase [Brucella abortus bv. 5 str. B3196]
 gi|62197736|gb|AAX76035.1| PyrC-2, dihydroorotase, multifunctional complex type [Brucella
           abortus bv. 1 str. 9-941]
 gi|82939798|emb|CAJ12806.1| Dihydroorotase multifunctional complex type:Amidohydrolase
           [Brucella melitensis biovar Abortus 2308]
 gi|161337473|gb|ABX63777.1| dihydroorotase, multifunctional complex type [Brucella canis ATCC
           23365]
 gi|163675475|gb|ABY39585.1| dihydroorotase, multifunctional complex type [Brucella suis ATCC
           23445]
 gi|189021372|gb|ACD74093.1| Amidohydrolase [Brucella abortus S19]
 gi|225615588|gb|EEH12637.1| dihydroorotase, multifunctional complex type [Brucella ceti str.
           Cudo]
 gi|237787904|gb|EEP62120.1| dihydroorotase, multifunctional complex type [Brucella abortus str.
           2308 A]
 gi|255998037|gb|ACU49724.1| dihydroorotase [Brucella microti CCM 4915]
 gi|260098050|gb|EEW81924.1| amidohydrolase [Brucella abortus NCTC 8038]
 gi|260154777|gb|EEW89858.1| amidohydrolase [Brucella suis bv. 4 str. 40]
 gi|260670384|gb|EEX57324.1| dihydroorotase [Brucella abortus bv. 4 str. 292]
 gi|260673726|gb|EEX60547.1| dihydroorotase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676744|gb|EEX63565.1| dihydroorotase [Brucella abortus bv. 6 str. 870]
 gi|260871981|gb|EEX79050.1| dihydroorotase [Brucella abortus bv. 9 str. C68]
 gi|260917660|gb|EEX84521.1| dihydroorotase [Brucella abortus bv. 3 str. Tulya]
 gi|260919021|gb|EEX85674.1| dihydroorotase [Brucella ceti B1/94]
 gi|260922306|gb|EEX88874.1| dihydroorotase [Brucella ceti M13/05/1]
 gi|261292778|gb|EEX96274.1| dihydroorotase [Brucella ceti M644/93/1]
 gi|261297945|gb|EEY01442.1| dihydroorotase [Brucella pinnipedialis B2/94]
 gi|261302359|gb|EEY05856.1| dihydroorotase [Brucella pinnipedialis M163/99/10]
 gi|261736791|gb|EEY24787.1| amidohydrolase [Brucella sp. F5/99]
 gi|261743337|gb|EEY31263.1| dihydroorotase [Brucella suis bv. 3 str. 686]
 gi|262550509|gb|EEZ06670.1| dihydroorotase [Brucella ceti M490/95/1]
 gi|264658717|gb|EEZ28978.1| dihydroorotase [Brucella pinnipedialis M292/94/1]
 gi|294819257|gb|EFG36257.1| dihydroorotase [Brucella sp. NVSL 07-0026]
 gi|297173451|gb|EFH32815.1| dihydroorotase [Brucella abortus bv. 5 str. B3196]
          Length = 428

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/428 (43%), Positives = 283/428 (66%), Gaps = 1/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +  N RI+DPSR +DE G++++ENG I+AAG++A N   P  A I D  G   +PG
Sbjct: 1   MSAILFENARIVDPSRGLDETGSLLIENGKIVAAGSEARNQGAPEGAEIVDLDGKAVMPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D+RV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++     R 
Sbjct: 61  LVDSRVFIGEPGAEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDVALVEFVKRTARD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++NV+P A +T  + G+E++E  LL+  G V+F +   +I +TQ++  ++ YA   NA
Sbjct: 120 TAIVNVHPAAAITKGLHGEEMTEFGLLRAAGAVAFTEGRNTIANTQIMRRALTYARDFNA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++A +T D FLG+ GV+NEG+ A++LGL G P  +E +PL RDL +A  T   YHA+ +S
Sbjct: 180 VIACETRDPFLGANGVMNEGLFASWLGLSGTPREAEVIPLERDLRLAALTRSRYHAAQLS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S   ++ AK   T  T G+SIN+L LNEND+  + +  ++ PPLR E +R++MVEA+
Sbjct: 240 CAMSADAMRRAKDLGTNVTAGVSINHLSLNENDIGEFRTFFRLSPPLRGEEDRLAMVEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G IDI+VS H P+ +DTK LPF++A  G+IGLET+L+AALRL+H   I L +L+  LS
Sbjct: 300 KNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLETLLAAALRLYHNDNIPLLRLVEVLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA+IF L  GTL+ G +ADIA++DL   W V+ +D+ S  KN+ F+   F G+VVRT 
Sbjct: 360 TAPAKIFGLNAGTLKPGASADIAIVDLEEPWVVREEDLHSRSKNSCFESARFQGRVVRTI 419

Query: 421 ISGKQVYT 428
           ++GK VY+
Sbjct: 420 VAGKTVYS 427


>gi|256059207|ref|ZP_05449413.1| dihydroorotase [Brucella neotomae 5K33]
 gi|261323156|ref|ZP_05962353.1| dihydroorotase [Brucella neotomae 5K33]
 gi|261299136|gb|EEY02633.1| dihydroorotase [Brucella neotomae 5K33]
          Length = 428

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/428 (43%), Positives = 283/428 (66%), Gaps = 1/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +  N RI+DPSR +DE G++++ENG I+AAG++A N   P  A I D  G   +PG
Sbjct: 1   MSAILFENARIVDPSRGLDETGSLLIENGKIVAAGSEARNQGAPEGAEIVDLDGKAVMPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D+RV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++     R 
Sbjct: 61  LVDSRVFIGEPGAEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDVALVEFVKRTARD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++NV+P A +T  + G+E++E  LL+  G V+F +   +I +TQ++  ++ YA   NA
Sbjct: 120 TAIVNVHPAAAITKGLHGEEMTEFGLLRAAGAVAFTEGRNTIANTQIMRRALTYARDFNA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++A +T D FLG+ GV+NEG+ A++LGL G P  +E +PL RDL +A  T   YHA+ +S
Sbjct: 180 VIACETRDPFLGANGVMNEGLFASWLGLSGTPREAEVIPLERDLRLAALTRSRYHAAQLS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S   ++ AK   T  T G+SIN+L LNEND+  + +  ++ PPLR E +R++MVEA+
Sbjct: 240 CAMSADAMRRAKDLGTNVTAGVSINHLSLNENDIGEFRTFFRLSPPLRGEEDRLAMVEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G IDI+VS H P+ +DTK LPF++A  G+IGLET+L+AALRL+H   I L +L+  LS
Sbjct: 300 KNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLETLLAAALRLYHNDNIPLLRLVEVLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA+IF L  GTL+ G +ADIA++DL   W V+ +D+ S  KN+ F+   F G+VVRT 
Sbjct: 360 TAPAKIFGLNAGTLKPGASADIAIVDLEEPWVVREEDLHSRSKNSCFESARFRGRVVRTI 419

Query: 421 ISGKQVYT 428
           ++GK VY+
Sbjct: 420 VAGKTVYS 427


>gi|148558275|ref|YP_001257587.1| dihydroorotase [Brucella ovis ATCC 25840]
 gi|148369560|gb|ABQ62432.1| dihydroorotase, multifunctional complex type [Brucella ovis ATCC
           25840]
          Length = 428

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/428 (43%), Positives = 283/428 (66%), Gaps = 1/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +  N RI+DPSR +DE G++++ENG I+AAG++A N   P  A I D  G   +PG
Sbjct: 1   MSAILFENARIVDPSRGLDETGSLLIENGKIVAAGSEARNQGAPEVAEIVDLDGKAVMPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D+RV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++     R 
Sbjct: 61  LVDSRVFIGEPGAEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDVALVEFVKRTARD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++NV+P A +T  + G+E++E  LL+  G V+F +   +I +TQ++  ++ YA   NA
Sbjct: 120 TAIVNVHPAAAITKGLHGEEMTEFSLLRAAGAVAFTEGRNTIANTQIMRRALTYARDFNA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++A +T D FLG+ GV+NEG+ A++LGL G P  +E +PL RDL +A  T   YHA+ +S
Sbjct: 180 VIACETRDPFLGANGVMNEGLFASWLGLSGTPREAEVIPLERDLRLAALTRSRYHAAQLS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S   ++ AK   T  T G+SIN+L LNEND+  + +  ++ PPLR E +R++MVEA+
Sbjct: 240 CAMSADAMRRAKDLGTNVTAGVSINHLSLNENDIGEFRTFFRLSPPLRGEEDRLAMVEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G IDI+VS H P+ +DTK LPF++A  G+IGLET+L+AALRL+H   I L +L+  LS
Sbjct: 300 KNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLETLLAAALRLYHNDNIPLLRLVEVLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA+IF L  GTL+ G +ADIA++DL   W V+ +D+ S  KN+ F+   F G+VVRT 
Sbjct: 360 TAPAKIFGLNAGTLKPGASADIAIVDLEEPWVVREEDLHSRSKNSCFESARFQGRVVRTI 419

Query: 421 ISGKQVYT 428
           ++GK VY+
Sbjct: 420 VAGKTVYS 427


>gi|306841752|ref|ZP_07474438.1| dihydroorotase, multifunctional complex type [Brucella sp. BO2]
 gi|306288157|gb|EFM59544.1| dihydroorotase, multifunctional complex type [Brucella sp. BO2]
          Length = 428

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/428 (42%), Positives = 282/428 (65%), Gaps = 1/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +  N RI+DPSR +DE G++++ENG I+AAG++A N   P  A I D  G   +PG
Sbjct: 1   MSAILFENARIVDPSRGLDETGSLLIENGKIVAAGSEARNQGAPEGAEIVDLDGKAVMPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D+RV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++     R 
Sbjct: 61  LVDSRVFIGEPGAEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDVALVEFVKRTARD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++NV+P A +T  + G+E++E  LL+  G V+F +   +I +TQ++  ++ YA   NA
Sbjct: 120 TAIVNVHPAAAITKGLHGEEMTEFGLLRAAGAVAFTEGRNTIANTQIMRRALTYARDFNA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++A +T D FLG+ GV+NEG+ A++LGL G P  +E +PL RDL +A  T   YHA+ +S
Sbjct: 180 VIACETRDPFLGANGVMNEGLFASWLGLSGTPREAEVIPLERDLRLAALTRSRYHAAQLS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S   ++ AK      T G+SIN+L LNEND+  + +  ++ PPLR E +R++MVEA+
Sbjct: 240 CAMSADAMRRAKDLGANVTAGVSINHLSLNENDIGEFRTFFRLSPPLRGEEDRLAMVEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G IDI+VS H P+ +DTK LPF++A  G+IGLET+L+AALRL+H   I L +L+  LS
Sbjct: 300 KNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLETLLAAALRLYHNDSIPLLRLVEVLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA+IF L  GTL+ G +ADIA++DL   W V+ +D+ S  KN+ F+   F G+VVRT 
Sbjct: 360 TAPAKIFGLDAGTLKPGASADIAIVDLEEPWVVREEDLHSRSKNSCFESARFQGRVVRTI 419

Query: 421 ISGKQVYT 428
           ++GK VY+
Sbjct: 420 VAGKTVYS 427


>gi|254720413|ref|ZP_05182224.1| dihydroorotase [Brucella sp. 83/13]
 gi|265985432|ref|ZP_06098167.1| dihydroorotase [Brucella sp. 83/13]
 gi|306839010|ref|ZP_07471831.1| dihydroorotase, multifunctional complex type [Brucella sp. NF 2653]
 gi|264664024|gb|EEZ34285.1| dihydroorotase [Brucella sp. 83/13]
 gi|306405916|gb|EFM62174.1| dihydroorotase, multifunctional complex type [Brucella sp. NF 2653]
          Length = 428

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/428 (42%), Positives = 282/428 (65%), Gaps = 1/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +  N RI+DPSR +DE G++++ENG I+AAG++A N   P    I D  G   +PG
Sbjct: 1   MSAILFENARIVDPSRGLDETGSLLIENGKIVAAGSEARNQGAPEGVEIVDLDGKAVMPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D+RV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++     R 
Sbjct: 61  LVDSRVFIGEPGAEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDVALVEFVKRTARD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++NV+P A +T  + G+E++E  LL+  G V+F +   +I +TQ++  ++ YA   NA
Sbjct: 120 TAIVNVHPAAAITKGLHGEEMTEFGLLRAAGAVAFTEGRNTIANTQIMRRALTYARDFNA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++A +T D FLG+ GV+NEG+ A++LGL G P  +E +PL RDL +A  T   YHA+ +S
Sbjct: 180 VIACETRDPFLGANGVMNEGLFASWLGLSGTPREAEVIPLERDLRLAALTRSRYHAAQLS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S   ++ AK   T  T G+SIN+L LNEND+  + +  ++ PPLR E +R++MVEA+
Sbjct: 240 CAMSADAMRRAKDLGTNVTAGVSINHLSLNENDIGEFRTFFRLSPPLRGEEDRLAMVEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G IDI+VS H P+ +DTK LPF++A  G+IGLET+L+AALRL+H   I L +L+  LS
Sbjct: 300 KNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLETLLAAALRLYHNDNIPLLRLVEVLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA+IF L  GTL+ G +ADIA++DL   W V+ +D+ S  KN+ F+   F G+VVRT 
Sbjct: 360 TAPAKIFGLDAGTLKPGASADIAIVDLEEPWVVREEDLHSRSKNSCFESARFLGRVVRTI 419

Query: 421 ISGKQVYT 428
           ++GK VY+
Sbjct: 420 VAGKTVYS 427


>gi|17989014|ref|NP_541647.1| dihydroorotase [Brucella melitensis bv. 1 str. 16M]
 gi|225686386|ref|YP_002734358.1| dihydroorotase [Brucella melitensis ATCC 23457]
 gi|256043497|ref|ZP_05446424.1| dihydroorotase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256111483|ref|ZP_05452497.1| dihydroorotase [Brucella melitensis bv. 3 str. Ether]
 gi|256262473|ref|ZP_05465005.1| amidohydrolase [Brucella melitensis bv. 2 str. 63/9]
 gi|260564692|ref|ZP_05835177.1| amidohydrolase [Brucella melitensis bv. 1 str. 16M]
 gi|265989915|ref|ZP_06102472.1| dihydroorotase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265992980|ref|ZP_06105537.1| dihydroorotase [Brucella melitensis bv. 3 str. Ether]
 gi|17984853|gb|AAL53911.1| dihydroorotase [Brucella melitensis bv. 1 str. 16M]
 gi|225642491|gb|ACO02404.1| dihydroorotase, multifunctional complex type [Brucella melitensis
           ATCC 23457]
 gi|260152335|gb|EEW87428.1| amidohydrolase [Brucella melitensis bv. 1 str. 16M]
 gi|262763850|gb|EEZ09882.1| dihydroorotase [Brucella melitensis bv. 3 str. Ether]
 gi|263000584|gb|EEZ13274.1| dihydroorotase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092209|gb|EEZ16506.1| amidohydrolase [Brucella melitensis bv. 2 str. 63/9]
 gi|326410758|gb|ADZ67822.1| dihydroorotase [Brucella melitensis M28]
 gi|326554050|gb|ADZ88689.1| dihydroorotase [Brucella melitensis M5-90]
          Length = 428

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/428 (42%), Positives = 282/428 (65%), Gaps = 1/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +  N RI+DPSR +DE G++++ENG I+AAG++A N   P  A I D  G   +PG
Sbjct: 1   MSAILFENARIVDPSRGLDETGSLLIENGKIVAAGSEARNQGAPEGAEIVDLDGKAVMPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D+RV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++     R 
Sbjct: 61  LVDSRVFIGEPGAEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDVALVEFVKRTARD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++NV+P A +T  + G+E++E  LL+  G V+F +   +I +TQ++  ++ YA   NA
Sbjct: 120 TAIVNVHPAAAITKGLHGEEMTEFGLLRAAGAVAFTEGRNTIANTQIMRRALTYARDFNA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++A +T D  LG+ GV+NEG+ A++LGL G P  +E +PL RDL +A  T   YHA+ +S
Sbjct: 180 VIACETRDPLLGANGVMNEGLFASWLGLSGTPREAEVIPLERDLRLAALTRSRYHAAQLS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S   ++ AK   T  T G+SIN+L LNEND+  + +  ++ PPLR E +R++MVEA+
Sbjct: 240 CAMSADAMRRAKDLGTNVTAGVSINHLSLNENDIGEFRTFFRLSPPLRGEEDRLAMVEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G IDI+VS H P+ +DTK LPF++A  G+IGLET+L+AALRL+H   I L +L+  LS
Sbjct: 300 KNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLETLLAAALRLYHNDNIPLLRLVEVLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA+IF L  GTL+ G +ADIA++DL   W V+ +D+ S  KN+ F+   F G+VVRT 
Sbjct: 360 TAPAKIFGLNAGTLKPGASADIAIVDLEEPWVVREEDLHSRSKNSCFESARFQGRVVRTI 419

Query: 421 ISGKQVYT 428
           ++GK VY+
Sbjct: 420 VAGKTVYS 427


>gi|306845934|ref|ZP_07478501.1| dihydroorotase, multifunctional complex type [Brucella sp. BO1]
 gi|306273569|gb|EFM55414.1| dihydroorotase, multifunctional complex type [Brucella sp. BO1]
          Length = 428

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/428 (42%), Positives = 280/428 (65%), Gaps = 1/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +  N RI+DPSR +DE G++++EN  I+AAG++A N   P  A I D  G   +PG
Sbjct: 1   MSAILFENARIVDPSRGLDETGSLLIENSKIVAAGSEARNQGAPEGAEIVDLDGKAVMPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D+RV +     E+ + I + S+ A AGG+TSII+MP      +D+   +++     R 
Sbjct: 61  LVDSRVFIGEPGAEHRETIASASRAAAAGGVTSIIMMP-DTDPVIDDVALVEFVKRTARD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++NV+P A +T  + G+E++E  LL+  G V+F +   +I +TQ++  ++ YA   NA
Sbjct: 120 TAIVNVHPAAAITKGLHGEEMTEFGLLRAAGAVAFTEGRNTIANTQIMRRALTYARDFNA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++A +T D FLG+ GV+NEG+ A++LGL G P  +E +PL RDL +A  T   YHA+ +S
Sbjct: 180 VIACETRDPFLGANGVMNEGLFASWLGLSGTPREAEVIPLERDLRLAALTRSRYHAAQLS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S   ++ AK   T  T G+SIN+L LNEND+  + +  ++ PPLR E +R++MVEA+
Sbjct: 240 CAMSADAMRRAKDLGTNVTAGVSINHLSLNENDIGEFCTFFRLSPPLRGEEDRLAMVEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G IDI+VS H P+ +DTK LPF++A  G+IGLET+L+AALRL+H   I L +L   LS
Sbjct: 300 KNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLETLLAAALRLYHNDSIPLLRLAEVLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA+IF L  GTL+ G  ADIA++DL   W V+ +D+ S  KN+ F+   F G+VVRT 
Sbjct: 360 TAPAKIFGLDAGTLKPGANADIAIVDLEEPWVVREEDLHSRSKNSCFESARFQGRVVRTI 419

Query: 421 ISGKQVYT 428
           ++GK VY+
Sbjct: 420 VAGKTVYS 427


>gi|163759338|ref|ZP_02166424.1| dihydroorotase [Hoeflea phototrophica DFL-43]
 gi|162283742|gb|EDQ34027.1| dihydroorotase [Hoeflea phototrophica DFL-43]
          Length = 428

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/427 (44%), Positives = 270/427 (63%), Gaps = 1/427 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT+ +L N RI+DPS+ +DE G+I++ +G I A GA   N   P      D  GL+AVPG
Sbjct: 1   MTTRLLQNLRIVDPSQSMDETGSILIVDGKIAAIGAAVGNKDIPAGCETEDYVGLIAVPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++DA V +     E+ + I + S+ A  GG+TSII+MP      +D+   + +     R 
Sbjct: 61  LVDACVHIGEPGAEHRETIASASRAAAKGGVTSIIMMP-DTEPMIDDVALVDFVQRLARD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           +++++VYP A LT  ++G+E++E  LL E G V       ++ +  V+  +M YA    A
Sbjct: 120 EAIVHVYPAAALTKGLKGEEMTEFGLLLEAGAVWLCNGRHTVGNPAVMRRAMTYARDFGA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +VA+ T D  L + GV+NEG+ A++LGL GIP  +E +PL RDL +A  T   YHA  IS
Sbjct: 180 VVAVATQDRHLSATGVMNEGLYASWLGLSGIPREAEIIPLERDLRLAALTRSRYHAMSIS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
           +P+S  +I+ AKA     T GISIN+L LNE D+  Y +  ++ PPLR+E +R +MV AL
Sbjct: 240 VPESAEIIRVAKAKGLSVTAGISINHLTLNETDIGEYRTFFRLSPPLRTEDDRRAMVAAL 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G IDIIVS H P+ +DTK LPF +A  G+IGLET+L+AALRL+H   + L +L+ A+S
Sbjct: 300 ADGAIDIIVSAHDPQDVDTKRLPFGDAENGAIGLETLLAAALRLYHSGDVELMRLVDAMS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           TRPAQI  L  GTL+ G  ADIALID  Y W +  DD++S  KN+ F+   FTGKV++T 
Sbjct: 360 TRPAQILGLDAGTLKVGARADIALIDPEYPWVLSKDDIASKSKNSAFEDARFTGKVLQTL 419

Query: 421 ISGKQVY 427
           ++G  VY
Sbjct: 420 VAGATVY 426


>gi|110633711|ref|YP_673919.1| dihydroorotase [Mesorhizobium sp. BNC1]
 gi|110284695|gb|ABG62754.1| dihydroorotase [Chelativorans sp. BNC1]
          Length = 428

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/428 (42%), Positives = 283/428 (66%), Gaps = 1/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M+  V  N R++DPSR +DE+G +IV+   I+A+GA A N   P  A + +C G   +PG
Sbjct: 1   MSVTVFTNARLVDPSRGLDEIGTLIVDGENIVASGASAQNQGHPDGASVVNCGGKAILPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D+RV +     E+ + I +  + A AGG+TSII+MP   S  +D+   +++ L   R 
Sbjct: 61  LVDSRVFIGEPGAEHRETIASAGRAAAAGGVTSIIMMP-DTSPVIDDVALVEFVLRTARE 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            S +N++P A +T  + G E+SE  LL++ G V   +   +I D+ V+  ++ YA  ++ 
Sbjct: 120 TSCVNIFPAAAITKGLAGHEMSEFGLLRDAGAVMVTEGRHTIADSLVMRRALTYARDMDM 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +++  T D  LGS GV+NEG++A++LGL GIP  +E +PL+RDL++A  T   YHA+ IS
Sbjct: 180 VISHSTQDPDLGSSGVMNEGLLASWLGLPGIPREAEAIPLSRDLMLAALTQSRYHAAEIS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S A +K AK   T+AT G+SINNL LNENDV  Y +  ++ PPLR E +R++MVEA+
Sbjct: 240 TAMSSAAVKRAKDEGTRATAGVSINNLCLNENDVGEYRTFFRLSPPLRCEEDRLAMVEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G ID+I S H P+ +DTK LPF++A+ G+IGLET LSAALRL+H   + L +L+ ALS
Sbjct: 300 KDGTIDVIHSAHDPQDVDTKRLPFSDAAVGAIGLETFLSAALRLYHSGDVPLLRLVEALS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA++F LPGG+L+ G  AD+ L+DL+  W V+ +++ S+ KNT F++    G+V++T 
Sbjct: 360 TAPARLFGLPGGSLKPGAPADLILVDLDAPWIVREENIRSLSKNTSFEEARMQGRVLQTM 419

Query: 421 ISGKQVYT 428
           ++G  V+T
Sbjct: 420 VAGSTVFT 427


>gi|121602852|ref|YP_989128.1| dihydroorotase [Bartonella bacilliformis KC583]
 gi|120615029|gb|ABM45630.1| dihydroorotase family protein [Bartonella bacilliformis KC583]
          Length = 431

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/425 (42%), Positives = 278/425 (65%), Gaps = 1/425 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V  N RI+DPSR IDE+G +I+ENG+I  AG ++LN   P SA I D +    +PG++D+
Sbjct: 6   VFQNARIVDPSRAIDEIGTVIIENGLITVAGKESLNQGTPESAEIIDASNKAILPGLVDS 65

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
           RV +     E+ + I + S+ A AGGITS ++MP      +D    +K+     +  SL+
Sbjct: 66  RVFIGEPGAEHRETIASASQAAAAGGITSFLMMP-DTQPVIDNVALVKFITRTAQEMSLV 124

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           N+YP A +T  + G++I+E  LL+  G+++F +   ++ ++ ++  +M YA   +  +  
Sbjct: 125 NIYPVAAITQGLNGQKIAEFGLLKNAGVIAFSEGKKTLQNSSIMRRAMTYARDFDVALIH 184

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
           +T D  L  +GV+NEG++A++LGL G+P  +E +PL RDL +A  T  +YHA+ IS   S
Sbjct: 185 ETQDKDLTGQGVMNEGLLASWLGLSGVPREAEVIPLERDLRLAALTKVNYHAAQISTAMS 244

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
              I+ AK HNTK + G+SIN+L LNEND+  Y +  +++PPLRSE +R++M+EA+  G 
Sbjct: 245 ADAIRLAKQHNTKISAGVSINHLSLNENDIGEYRTFFRLIPPLRSEEDRIAMIEAINDGT 304

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID+IVS H P+ +DTK LPF +A+ G+IG+ET+LSAALRL+H + +SL +LI  LST PA
Sbjct: 305 IDVIVSSHDPQDVDTKRLPFQDAAAGAIGMETLLSAALRLYHNKSVSLLRLIELLSTAPA 364

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++F L  GTL  G  AD+ L+DL+  W +  D + S  KNT F+   F G+V++T++ GK
Sbjct: 365 KLFGLNAGTLMKGAPADLILVDLDEPWVLSPDILHSRSKNTPFENTRFQGRVIQTFVKGK 424

Query: 425 QVYTL 429
            V+ L
Sbjct: 425 SVFNL 429


>gi|13470873|ref|NP_102442.1| dihydroorotase [Mesorhizobium loti MAFF303099]
 gi|14021616|dbj|BAB48228.1| probable noncatalytic chain of dihydroorotase [Mesorhizobium loti
           MAFF303099]
          Length = 428

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 184/428 (42%), Positives = 275/428 (64%), Gaps = 1/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ V    RI+DPSR IDEVG++IVE   I+AAG   LN   P  A+I DC G   +PG
Sbjct: 1   MSTTVFERARIVDPSRGIDEVGSVIVEGRKIVAAGKATLNQGAPEGAIIVDCAGKAIIPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +ID RV +     E+ + I + S  A AGG+TS+++MP      +D    +++ L   + 
Sbjct: 61  LIDGRVFIGEPGGEHRETIASASVAAAAGGVTSVVMMP-DTDPVIDNVALVEFVLRTAKD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++N++P A +T  ++G+E++E  LL+E G V+F     +I  + V+  ++ YA    A
Sbjct: 120 TAIVNIFPAAAITKGLDGREMTEFGLLREAGAVAFTDGRHTIASSLVMRRALTYARDFGA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +  +T D  LGS GV+NEG+ A++LGL GIP  +E++PL RDL +A+ T G YHA+ IS
Sbjct: 180 TIVHETQDADLGSSGVMNEGLYASWLGLSGIPREAESIPLERDLALARLTRGSYHAAKIS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              +   +  AKA     T G+SI+NL LNENDV  Y +  ++ PPLR+E +R++M+EA+
Sbjct: 240 TAMAANAVTRAKADGAAVTSGVSIHNLSLNENDVGEYRTFFRLTPPLRAEEDRLAMIEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G +DIIVS H P+ +DTK LPFA+A+ G+IGLET+L AALRL+H   + L +L+  LS
Sbjct: 300 RDGTVDIIVSSHDPQDVDTKRLPFADAAAGAIGLETLLGAALRLYHNGDVPLLRLVETLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA++F LPGGTL  G+ AD+AL+DL+  W V    + S  KNT F+     GKV++T 
Sbjct: 360 TAPARLFGLPGGTLTPGSVADLALVDLDEPWIVSESGIRSRSKNTCFEGARLQGKVLQTL 419

Query: 421 ISGKQVYT 428
           ++G+ V++
Sbjct: 420 VAGRTVFS 427


>gi|319783704|ref|YP_004143180.1| dihydroorotase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169592|gb|ADV13130.1| dihydroorotase, multifunctional complex type [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 428

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 185/429 (43%), Positives = 275/429 (64%), Gaps = 1/429 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M+  V    RI+DPSR +DE+GA+IV+   I+AAG  ALN   P  A+I DC G   +PG
Sbjct: 1   MSITVFERARIVDPSRGMDEIGAVIVDGRKIVAAGKAALNQGAPEGAIIIDCAGKAIIPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D RV +     E+ + I + S  A AGG+TSI++MP      +D    +++ L   + 
Sbjct: 61  LVDGRVFIGEPGGEHRETIASASVAAAAGGVTSIVMMP-DTDPVIDNVALVEFVLRTAKD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++NV+P A +T  ++G+E++E  LL+E G V+F     +I    V+  ++ YA    A
Sbjct: 120 TAIVNVFPAAAITKGLDGREMTEFGLLREAGAVAFTDGRHTIPSALVMRRALTYARDFGA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +  +T D  LGS GV+NEG+ A++LGL GIP  +E++PL RDL +A+ T G YHA+ IS
Sbjct: 180 TIVHETQDADLGSSGVMNEGLYASWLGLSGIPREAESIPLERDLALARLTRGSYHAAKIS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              +   +  AKA     T G++I+NL LNENDV  Y +  ++ PPLR+E +R++M+EA+
Sbjct: 240 TAMAANAVTRAKADGVTVTSGVAIHNLSLNENDVGEYRTFFRLTPPLRAEEDRLAMIEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G IDIIVS H P+ +DTK LPFA+A+ G+IGLET+L AALRL+H   + L +LI  LS
Sbjct: 300 RDGTIDIIVSSHDPQDVDTKRLPFADAAAGAIGLETLLGAALRLYHNGDVPLLRLIETLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA++F LPGGTL+ G  AD+AL+DL+  W V    + S  KNT F+     GKV++T 
Sbjct: 360 TAPAKLFGLPGGTLKPGALADLALVDLDEPWIVSESGIRSRSKNTCFEGARLQGKVLQTL 419

Query: 421 ISGKQVYTL 429
           ++G+ V+++
Sbjct: 420 VAGRTVFSV 428


>gi|240850659|ref|YP_002972059.1| dihydroorotase [Bartonella grahamii as4aup]
 gi|240267782|gb|ACS51370.1| dihydroorotase [Bartonella grahamii as4aup]
          Length = 433

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 175/426 (41%), Positives = 273/426 (64%), Gaps = 1/426 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V  N RIIDPSR +DE+G +IVENG I+AAG +ALN  FP  A I +      +PG++DA
Sbjct: 6   VFQNARIIDPSRAVDEIGTVIVENGRIIAAGKEALNQGFPEEAEIVNAQNKAILPGLVDA 65

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
           RV +    +E+ + I + S+ A AGGITS ++MP      +D    +++    ++ KS +
Sbjct: 66  RVFVGELGNEHCETIASTSQSAAAGGITSFLMMP-DTRPVIDNVALVEFIRHTVQEKSSV 124

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           N+YP A +T    G++I+E  LL++ G V+F +   ++  + V+  +M YA   +  +  
Sbjct: 125 NIYPVAAITQGFNGQQITEFGLLKDAGAVAFYEGKKTLQSSSVMRRAMTYARDFDVPLMH 184

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
           +T D  L  +GV+NEG++A++LGL GIP  +E +PL RDL +A  T   YHA+ IS   S
Sbjct: 185 ETQDKDLTGQGVMNEGLLASWLGLSGIPREAEVIPLERDLRLAVLTQTRYHAAQISTALS 244

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
              ++  K  + K + G+SIN+L  NEND+  Y +  +++PPLR+E +R++M+EA++ G 
Sbjct: 245 ADALRLGKKRSEKISAGVSINHLSFNENDIGEYRTSFRLMPPLRTEEDRIAMIEAIKDGT 304

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID+IVS H P+  DTK LPF +A+ G+IG+ET+LSAALRL+H + +SL ++   +ST PA
Sbjct: 305 IDVIVSSHDPQSKDTKHLPFNDAAVGAIGMETLLSAALRLYHDESLSLLRITELVSTAPA 364

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++F L  GTL+ G  AD+ ++DL   W V  + + S  KNT F+   F G+V++T++ GK
Sbjct: 365 KLFGLNAGTLKKGAHADLIVVDLEEPWVVSKEKLYSCSKNTPFENARFQGRVLQTFVKGK 424

Query: 425 QVYTLE 430
            V+ L+
Sbjct: 425 TVFKLD 430


>gi|319408536|emb|CBI82189.1| dihydroorotase [Bartonella schoenbuchensis R1]
          Length = 430

 Score =  358 bits (920), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 181/428 (42%), Positives = 273/428 (63%), Gaps = 1/428 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            V  N RI+DPSR IDE+G +I+ENG+I+AAG +ALN   P  A I D      +PG++D
Sbjct: 1   MVFQNARIVDPSRAIDEIGTVIIENGLIIAAGKEALNQGTPEGAEIIDAQNKAILPGLVD 60

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           ARV +     E+ + I + S+ A AGGITS ++MP      +D    +++        SL
Sbjct: 61  ARVFVGEPGAEHRETIASASQSAAAGGITSFLMMP-DTQPVIDNVALVEFITRTAHETSL 119

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +N+YP A +T  + G+EI+E  LL+  G ++F +   ++ ++ V+  +M YA   +  + 
Sbjct: 120 VNIYPVAAITQGLGGQEIAEFGLLKNAGAIAFSEGKKTLQNSSVMRRAMTYARDFDVTLI 179

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
            +T D  L  +GV+NEG++A++LGL GIP  +E +PL RDL +A  T   YHA+ IS   
Sbjct: 180 HETQDKDLTGQGVMNEGLLASWLGLCGIPREAEIIPLERDLRLAALTQARYHAAQISTAM 239

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S   I+ AK +NTK + G+SIN+L LNENDV  Y +  +++PPLR+E +R++M+EA++ G
Sbjct: 240 SADAIRLAKQNNTKISAGVSINHLSLNENDVGEYRTFFRLMPPLRAEEDRIAMIEAIKDG 299

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            +DIIVS H P+ +DTK LPF +A  G+IG+ET+LS AL L+H + ISL +L   LST P
Sbjct: 300 TVDIIVSSHDPQDVDTKRLPFQDAQAGAIGMETLLSVALLLYHNEMISLLRLTELLSTAP 359

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++F L  GTL  G  AD+ L+DL+  W + +D + S  KNT F+   F G+V++T + G
Sbjct: 360 AKLFGLNAGTLIKGANADLILVDLDEPWILSSDMLHSRSKNTPFENTHFQGRVIQTLVKG 419

Query: 424 KQVYTLES 431
           + V+ L+ 
Sbjct: 420 QSVFKLDQ 427


>gi|319407288|emb|CBI80929.1| dihydroorotase [Bartonella sp. 1-1C]
          Length = 434

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 178/425 (41%), Positives = 275/425 (64%), Gaps = 1/425 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V  N RI+DPSR IDE+G +I+ENG+I+AAG +ALN   P  A I D      +PG++DA
Sbjct: 6   VFQNARIVDPSRAIDEIGTVIIENGLIVAAGKEALNQGIPEGAEIIDAQDKAILPGLVDA 65

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
           +V +     EY + I + S+ A AGGITS ++MP    + +D    IK+        SL+
Sbjct: 66  QVFIGEPGAEYPETIASASESAAAGGITSFLMMP-DTQTIIDNVALIKFITCRAHETSLV 124

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           N+YP A +T  ++G++I+E  LL++ G V+F +   ++ ++ V+  +M YA   +  +  
Sbjct: 125 NIYPVAAITQGLQGQKITEFGLLKDAGAVAFSEGKKTLQNSAVMRRAMIYARDFDIALIH 184

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
           +T DH L  +GV+NEG++A++LG  GIP  +E +PL RDL +A  T   YHA+ IS   S
Sbjct: 185 ETQDHDLSDQGVMNEGLLASWLGFSGIPREAEVIPLERDLRLAILTQTRYHAAQISTAMS 244

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
              I+ AK ++ K + G+SIN+L LNEND+  Y +  +++PPLR+E +R++M++A++   
Sbjct: 245 ADAIRLAKQNSEKISAGVSINHLSLNENDIGEYRTFFRLMPPLRAEEDRIAMIQAIKDRT 304

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           IDII S H P+ +D K LPF EA+ G+IG+ET+LSAALRL+H + + L +L+  LST PA
Sbjct: 305 IDIISSSHNPQSIDRKRLPFQEAAPGAIGMETLLSAALRLYHNETVPLVRLVELLSTAPA 364

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++F L  GTL  G  AD+ L+DL+  W +  D + S  KNT F+K  F G+V++T++ G+
Sbjct: 365 KLFGLNAGTLMKGAYADLILVDLDEPWVLSVDMLHSRSKNTPFEKARFQGRVLQTFVKGQ 424

Query: 425 QVYTL 429
            V+ +
Sbjct: 425 SVFKI 429


>gi|49475584|ref|YP_033625.1| dihydroorotase [Bartonella henselae str. Houston-1]
 gi|49238391|emb|CAF27618.1| Dihydroorotase [Bartonella henselae str. Houston-1]
          Length = 431

 Score =  357 bits (915), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 179/426 (42%), Positives = 277/426 (65%), Gaps = 1/426 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V  N RIIDPSR IDE+G +IVENG+I+AAG +ALN   P  A I +      +PG++DA
Sbjct: 6   VFQNARIIDPSRTIDEIGTVIVENGLIIAAGKEALNQGIPEGAEIINAQNKAILPGLVDA 65

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
           RV +    +E  + + + S+ A AGGITS ++MP   +  +D    +K+     +  S +
Sbjct: 66  RVFVGEPGNESRETLASASQSAAAGGITSFLMMP-NTNPVIDNIALVKFITHTAQEISSV 124

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           N+YP A +T    G+EI+E  LL++ G V+F +   ++ ++ V+  +M YA   +  +  
Sbjct: 125 NIYPVAAITQGFNGQEIAEFGLLKDAGAVAFSEGKKTLQNSSVMRRAMTYARDFDVPLMH 184

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
           +T D  L  +GV+NEG++A++LGL GIP  +E +PL RDL +A  T   YHA+ IS   S
Sbjct: 185 ETQDKDLIGQGVMNEGLLASWLGLSGIPREAEVIPLERDLRLAALTQTRYHAAQISTALS 244

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
              ++ +K  + K + G+SIN+L  NEND+  Y +  +++PPLR+E +R++M+EA++ G 
Sbjct: 245 ADALRLSKQRSEKISAGVSINHLSFNENDIGEYRTSFRLIPPLRTEEDRIAMIEAIKDGT 304

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           +DIIVS H P+ +D K LPF+EA+ G+IG+ET+LSAALRL+H   ISL +L   LST PA
Sbjct: 305 VDIIVSSHDPQSLDKKNLPFSEAAIGAIGMETLLSAALRLYHNGTISLLRLTELLSTTPA 364

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++F+L  GTL+ GT AD+ L+DL+  W V  + + S  KNT F+K  F G+V++T++ G+
Sbjct: 365 KLFDLNAGTLRKGTHADLILVDLDEPWIVSPEKLYSRSKNTPFEKAHFQGRVLQTFVKGQ 424

Query: 425 QVYTLE 430
            ++ L+
Sbjct: 425 SIFKLD 430


>gi|90417724|ref|ZP_01225636.1| dihydroorotase, multifunctional complex type [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337396|gb|EAS51047.1| dihydroorotase, multifunctional complex type [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 437

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 185/424 (43%), Positives = 271/424 (63%), Gaps = 1/424 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V+ + RIIDP+R +D VG ++V +G I+AAGADALN   P  A I D  GL+ VPG++DA
Sbjct: 8   VIEHVRIIDPARSLDAVGTVVVVDGHIVAAGADALNQGAPEGAEIIDGRGLLLVPGLVDA 67

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
           RV +     E+ + I + S  A AGG+TSI+ MP   +  +DE    ++ +   R  +++
Sbjct: 68  RVFIGEPGGEHRETIASASAAAAAGGVTSILTMP-DTNPVVDEVAIAEFVMRTARDTAVV 126

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           NV+P A LT  ++GKE+SE+ LL   G+ +F     +I D  +L   M YA   +A+V  
Sbjct: 127 NVFPAAALTRGLKGKEMSEIGLLAGAGVRAFTDGRHTIADPVLLRRIMTYARDFDALVMH 186

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
           +T D  L   GV+NEG++A++LGL G P+ +E +PL RDL +A  TG  YHA+ +S+ +S
Sbjct: 187 ETQDAALTGNGVMNEGLLASWLGLPGAPAEAEIIPLERDLRLAALTGCRYHAAKLSLGES 246

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
             +++ AK   T AT G+SIN+L LNEND+  Y +  ++ PPLR E +R +MVEAL  G 
Sbjct: 247 ADVMRRAKRRGTAATAGVSINHLSLNENDIGEYRTFFRLSPPLRREEDRAAMVEALADGT 306

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           IDIIVS H P+  D K  PFAEA  G+IGLET+L AALRL H   + L ++I A++  PA
Sbjct: 307 IDIIVSSHDPQDADGKRRPFAEAESGAIGLETLLPAALRLHHSGAVPLARIIEAVTAAPA 366

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++  L  GTL +G+ AD+AL+DL   +    D + S  KNT F+   F G+V+RT+++G+
Sbjct: 367 KLLGLDRGTLASGSVADMALVDLEAPFLFSEDRIRSRSKNTAFENARFQGQVLRTFVAGR 426

Query: 425 QVYT 428
            V++
Sbjct: 427 TVFS 430


>gi|260459180|ref|ZP_05807435.1| dihydroorotase, multifunctional complex type [Mesorhizobium
           opportunistum WSM2075]
 gi|259034734|gb|EEW35990.1| dihydroorotase, multifunctional complex type [Mesorhizobium
           opportunistum WSM2075]
          Length = 428

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 181/429 (42%), Positives = 272/429 (63%), Gaps = 1/429 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ V    RI+DPSR IDE+G++IV+   I  AG  ALN   P  A+I DC G   +PG
Sbjct: 1   MSTTVFERARIVDPSRGIDEIGSVIVDGRKIATAGKAALNQGAPEGAIIIDCAGKTIIPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +ID RV +     E+ + I + S  A AGG+TS+++MP      +D    +++ L   + 
Sbjct: 61  LIDGRVFIGEPGGEHRETIASASLAAAAGGVTSVVMMP-DTDPVIDNVALVEFVLRTAKD 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++N++P A +T  ++G+E++E  LL+E G V+F     +I    V+  ++ YA    A
Sbjct: 120 TAVVNIFPAAAITKGLDGREMTEFGLLREAGAVAFTDGRHTISSALVMRRALTYARDFGA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +  +T D  L S GV+NEG+ A++LGL GIP  +E++PL RDL +A+ T G YHA+ IS
Sbjct: 180 TIVHETQDADLASAGVMNEGLYASWLGLSGIPREAESIPLERDLALARLTRGSYHAAKIS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              + A +  AKA     T G+SI+NL LNENDV  Y +  ++ PPLR+E +R++M+EA+
Sbjct: 240 TAMAAAAVTRAKADGADVTSGVSIHNLSLNENDVGEYRTFFRLTPPLRAEEDRLAMIEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G +DIIVS H P+ +DTK LPFA+A+ G+IGLET+L AALRL+H   + L +LI  LS
Sbjct: 300 RDGTVDIIVSSHDPQDVDTKRLPFADAAAGAIGLETLLGAALRLYHNGDVPLLRLIETLS 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA++F L GGTL+ G  AD+ L+DL+  W V    + S  KNT F+     GKV++T 
Sbjct: 360 TAPARLFGLSGGTLKPGAMADLVLVDLDEPWIVSEGGIRSRSKNTCFEGARLQGKVLQTL 419

Query: 421 ISGKQVYTL 429
           ++G+ V+++
Sbjct: 420 VAGRTVFSI 428


>gi|319404283|emb|CBI77876.1| dihydroorotase [Bartonella rochalimae ATCC BAA-1498]
          Length = 434

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 176/425 (41%), Positives = 272/425 (64%), Gaps = 1/425 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V  N RI+DPSR IDE+G +I+ENG+I+AAG +ALN   P  A   D       PG++DA
Sbjct: 6   VFQNARIVDPSRAIDEIGTVIIENGLIVAAGKEALNQGIPEGAETIDAQDKAIFPGLVDA 65

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
           +V +     EY + I + S+ A AGGITS ++MP    + +D    IK+        SL+
Sbjct: 66  QVFIGEPGAEYPETIASASQSAAAGGITSFLMMP-DTQTIIDNVALIKFITCTAHETSLV 124

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           N+YP A +T  ++G++I+E  LL++ G V+F +   ++ ++ V+  +M YA   +  +  
Sbjct: 125 NIYPVAAITQGLQGQKITEFGLLKDAGAVAFSEGKKTLQNSAVMRRAMIYARDFDIALIH 184

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
           +T DH L  +GV+NEG++A++LG  GIP  +E +PL RDL +A  T   YHA+ IS   S
Sbjct: 185 ETQDHDLSDQGVMNEGLLASWLGFSGIPREAEVIPLERDLRLAILTQTRYHAAQISTAMS 244

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
              I+ AK ++ K + G+SIN+L LNEND+  Y +  +++PPLR+E +R++M++A++   
Sbjct: 245 ADAIRLAKQNSEKISAGVSINHLSLNENDIGEYRTFFRLMPPLRAEEDRIAMIKAIKDRT 304

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           IDII S H P+ +D K LPF EA+ G+IG+ET+LSAALRL+H + + L +L+  LST PA
Sbjct: 305 IDIISSSHNPQSIDRKRLPFQEAAPGAIGMETLLSAALRLYHNETVPLLRLVELLSTAPA 364

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++F L  GTL  G  AD+ L+DL+  W +  D + S  KNT F+   F G+V++T++ G+
Sbjct: 365 KLFGLNAGTLMKGAHADLILVDLDEPWVLSVDTLHSRSKNTPFENARFQGRVLQTFVKGQ 424

Query: 425 QVYTL 429
            V+ +
Sbjct: 425 SVFKI 429


>gi|319405726|emb|CBI79349.1| dihydroorotase [Bartonella sp. AR 15-3]
          Length = 439

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 174/425 (40%), Positives = 271/425 (63%), Gaps = 1/425 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V  N RI+DPSR IDE+G +I+ENG+I+ AG +ALN   P  + I D      +PG+IDA
Sbjct: 6   VFQNARIVDPSRAIDEIGTVIIENGLIVTAGKEALNQGAPEGSEIIDAQDKAILPGLIDA 65

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
           +V +     E+ + I + S+ A AGGITS ++MP    + +D    IK         SL+
Sbjct: 66  QVFIEEPGAEHPETIDSASQSAAAGGITSFLMMP-DTQTIIDNVALIKLITCTAHETSLV 124

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           N+YP A +T  ++G+EI+E  LL+  G V+F +   ++ ++ ++ ++M YA   +  +  
Sbjct: 125 NIYPVAAITQGLKGQEITEFGLLKNAGAVAFSEGKKTLQNSAIMRHAMIYARDFDITLIH 184

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
           +T D+ L ++GV+NEG++A++LG  GIP  +E +PL RDL +A  T   YHA+ IS   S
Sbjct: 185 ETQDYDLSNQGVMNEGLLASWLGFSGIPREAEVIPLERDLRLAVLTQTRYHAAQISTAMS 244

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
              ++ AK H+ K + G+SIN+L LNEND+  Y +  +++PPLR+E +R++M+ A++ G 
Sbjct: 245 ADAVRLAKQHSEKISVGVSINHLSLNENDIGEYRTSFRLMPPLRAEEDRIAMINAIKDGT 304

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           IDII S H P+ +D K LPF EA+ G+IG+ET+LSAALRL+H   + L +L   LST PA
Sbjct: 305 IDIIASSHNPQGVDAKRLPFQEAATGAIGMETLLSAALRLYHNGTVPLLRLTELLSTAPA 364

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++F L  GTL  G  AD+ L+DL+  W +  + + S  KNT F+   F G+V++T++ G+
Sbjct: 365 KLFGLNAGTLMKGAPADLILVDLDEPWLLSLEMLHSRSKNTPFENARFQGRVLQTFVKGQ 424

Query: 425 QVYTL 429
            V+ +
Sbjct: 425 SVFKI 429


>gi|319898955|ref|YP_004159048.1| dihydroorotase [Bartonella clarridgeiae 73]
 gi|319402919|emb|CBI76470.1| dihydroorotase [Bartonella clarridgeiae 73]
          Length = 437

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 176/426 (41%), Positives = 275/426 (64%), Gaps = 3/426 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V  N RI+DPSR IDE+G +I++NG+I+ AG +ALN   P  A I D      +PG++DA
Sbjct: 6   VFQNARIVDPSRAIDEIGTVIIKNGLIVTAGKEALNQGIPEGAEIIDAQDKAILPGLVDA 65

Query: 65  RVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           +V   G P  E+ + I++ S+ A AGGITS ++MP    + +D    IK+        SL
Sbjct: 66  QV-FVGEPGIEHREMISSASQSAAAGGITSFLMMP-DTRTIIDNVALIKFITCTAHETSL 123

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +N++P A +T  ++G+EI+E  LL++ G ++F +   ++ ++ V+  +M YA   +  + 
Sbjct: 124 VNIHPVAAITQGLKGQEITEFGLLKDAGAIAFSEGKKTLQNSAVMRRAMTYARDFDVALI 183

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
            +T DH L  +GV+NEG++A++LG +GIP  +E +PL RDL +A  T   YHA+ IS   
Sbjct: 184 HETQDHDLTDQGVMNEGLLASWLGFLGIPREAEVIPLERDLRLAVLTQTRYHAAQISTAM 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S   ++ AK H+ K + G+SIN+L LNEND+  Y +  +++PPLR+E +R++M++A++ G
Sbjct: 244 SADAVRLAKQHSEKISVGVSINHLSLNENDIGEYRTFFRLMPPLRAEEDRIAMIKAIKDG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            +DII S H P+ +DTK LPF EA  G+IG+ET+LSAALRL+H + + L +L   LST P
Sbjct: 304 TLDIITSSHDPQGIDTKCLPFQEAETGAIGMETLLSAALRLYHNETVPLLRLAELLSTAP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++F L  GTL  G  AD+ L+DL   W +  D + S  KNT F+   F G+V++T++ G
Sbjct: 364 AKLFGLNAGTLMKGAHADLILVDLEEPWVLSLDMLHSRSKNTPFENAHFQGRVLQTFVKG 423

Query: 424 KQVYTL 429
           + V+ +
Sbjct: 424 QSVFKI 429


>gi|49474244|ref|YP_032286.1| dihydroorotase [Bartonella quintana str. Toulouse]
 gi|49239748|emb|CAF26130.1| Dihydroorotase [Bartonella quintana str. Toulouse]
          Length = 431

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 180/426 (42%), Positives = 271/426 (63%), Gaps = 1/426 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V  N RIIDPSR IDE+G +IVENG+I  AG +ALN   P  A I +      +PG++DA
Sbjct: 6   VFQNARIIDPSRTIDEIGTVIVENGLITVAGKEALNQGVPEGAEIINAQNKAILPGLVDA 65

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V +  S  EY + I + S+ A AGGITS ++MP      +D    +K+  +  +  S +
Sbjct: 66  CVFMGESRSEYCETIASASQSAAAGGITSFLMMP-DTYPIIDNVALVKFITQTAQEISSV 124

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           N+YP A +T    G+EI+E   L++ G V+F +   ++ ++ V+ ++M YA   +  +  
Sbjct: 125 NIYPVAAITQGFNGQEIAEFGFLRDAGAVAFSEGKKTLQNSSVMRHAMTYARDFDVPLIH 184

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
           +T D  L  +GV+NEG++A++LGL GIP  +E +PL RDL +A  T   YHA+ IS   S
Sbjct: 185 ETQDKDLTGQGVMNEGLLASWLGLSGIPREAEVIPLERDLRLAALTQTRYHAAQISTALS 244

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
              ++  K  N K + G+SIN+L LNEND+  Y +  +++PPLR+E +R++M+EA++ G 
Sbjct: 245 ADALRLGKQRNEKISAGVSINHLSLNENDIGEYRTSFRLMPPLRTEEDRIAMIEAIKDGT 304

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           +DIIVS H P+ +D K LPF+ A+ G+IG+ET+LSAALRL+H + ISL +L   LST PA
Sbjct: 305 VDIIVSSHDPQGIDRKHLPFSNAAVGAIGMETLLSAALRLYHNKTISLLRLTDLLSTTPA 364

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++F L  GTL+ G  AD+ L+DL+  W V  + + S  KNT F    F G+V++T++ GK
Sbjct: 365 KLFGLNAGTLRKGAHADLILVDLDEPWIVSTEKLYSRSKNTPFANARFQGRVLQTFVKGK 424

Query: 425 QVYTLE 430
            V+ L+
Sbjct: 425 LVFKLD 430


>gi|163868296|ref|YP_001609505.1| dihydroorotase [Bartonella tribocorum CIP 105476]
 gi|161017952|emb|CAK01510.1| dihydroorotase [Bartonella tribocorum CIP 105476]
          Length = 433

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 178/427 (41%), Positives = 270/427 (63%), Gaps = 1/427 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V    RIIDPSR IDEVG +IVENG I+AAG +ALN   P  A + +      +PG++DA
Sbjct: 6   VFQKARIIDPSRAIDEVGTVIVENGQIIAAGKEALNQGVPEGAEVINAQNKAILPGLVDA 65

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
           RV +    +E  + I + S+ A AGGITS ++MP      +D    +++        SLI
Sbjct: 66  RVFVGEPGNENRETIASASQAAAAGGITSFLMMP-DTHPVIDNVALVQFIKRTAGEVSLI 124

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           N+YP A +T    G+EI+E  LL+E G V+F +   ++ ++ V+  +M YA   +  +  
Sbjct: 125 NIYPVAAITQGFNGQEITEFGLLKEAGAVAFSEGKKTLQNSSVMRRAMTYARDFDVPLIH 184

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
           +T D  L  +GV+NEG++A++LGL GIP  +E +PL RDL +A  T   YHA+ IS   S
Sbjct: 185 ETQDKDLTGQGVMNEGLLASWLGLSGIPCEAEVIPLERDLRLAALTQTRYHAAQISTALS 244

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
              ++  K  + K + G+SIN+L LNEND+  Y +  +++PPLR+E +R++++EA++ G 
Sbjct: 245 ADALRLGKQRSEKISAGVSINHLSLNENDIGQYQTSFRLMPPLRTEEDRIALIEAIKDGT 304

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID+I+S H P+ +DTK LPF +A+ G+IG+ET+LSAALRL+H + +SL ++   LST PA
Sbjct: 305 IDVIISSHDPQGIDTKHLPFNDAAAGAIGMETLLSAALRLYHDESLSLLRITELLSTMPA 364

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++F L  GTL+ G  AD+ ++DL   W V  + + S  KNT FD   F G+V +T++ GK
Sbjct: 365 KLFGLNAGTLKKGAYADLIVVDLEEPWVVSTEKLYSRSKNTPFDNARFQGRVFQTFVKGK 424

Query: 425 QVYTLES 431
            V+ L+ 
Sbjct: 425 SVFKLDQ 431


>gi|255601097|ref|XP_002537603.1| dihydroorotase, putative [Ricinus communis]
 gi|223515764|gb|EEF24780.1| dihydroorotase, putative [Ricinus communis]
          Length = 329

 Score =  349 bits (895), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 166/321 (51%), Positives = 228/321 (71%)

Query: 105 LDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHD 164
           +D+   +++  +  + K+L+NVYP A +T ++ G+E++E+ LL E G V+F     SIHD
Sbjct: 9   IDDIALVEFVKKTAKDKALVNVYPAAAITKHLAGEEMTEIGLLMEAGAVAFTDGRSSIHD 68

Query: 165 TQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDL 224
           TQVL   M YA    A+++ +T D +LG+ GV+NEG+ A++LGL GIP  +E +PL RDL
Sbjct: 69  TQVLRRVMTYAREFGAVISCETRDKYLGATGVMNEGLFASWLGLGGIPKEAELIPLERDL 128

Query: 225 LIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVL 284
            +AQ T G+YHA++IS+P+S+  IK AK+   K TCGISINNL LNEND+  Y +  K+ 
Sbjct: 129 RVAQLTRGNYHAAMISVPESVDAIKLAKSRGAKVTCGISINNLALNENDIGEYRTFFKLY 188

Query: 285 PPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRL 344
           PPLR+E +R++MVEAL KG+IDIIVS H P+ +DTK LPF EA+ G++GLET+L+AALRL
Sbjct: 189 PPLRTEDDRVAMVEALAKGEIDIIVSSHDPQDVDTKRLPFGEAADGAVGLETLLAAALRL 248

Query: 345 FHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKN 404
            H  Q+SL +LI A+STRPAQIF L  GTL+ G  ADIALIDL   W V  D + S  KN
Sbjct: 249 HHSGQVSLMRLIDAMSTRPAQIFGLDAGTLKPGAKADIALIDLEEPWLVAKDMLLSRSKN 308

Query: 405 TVFDKEFFTGKVVRTYISGKQ 425
           T F+   F+G+ V TY+ G +
Sbjct: 309 TPFEDARFSGRAVATYVGGTK 329


>gi|115525375|ref|YP_782286.1| dihydroorotase [Rhodopseudomonas palustris BisA53]
 gi|115519322|gb|ABJ07306.1| dihydroorotase [Rhodopseudomonas palustris BisA53]
          Length = 433

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 178/424 (41%), Positives = 262/424 (61%), Gaps = 1/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N R+IDPSRD D +G +++ +G I  A      A  P    I +C G V  PG+ID
Sbjct: 8   ILLANARLIDPSRDFDGIGDVLIADGAIREARRGIGAAGVPEGTDIINCAGKVVTPGLID 67

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
            R  +      + +   + S+ A AGGIT+II  P   S  +D    + + L   R  ++
Sbjct: 68  MRAFVGEPGASHRETFASASQAAAAGGITTIICQP-DTSPAIDNSATVDFVLRRARDTAI 126

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +N++P A LT N+ G E++E+ LL+  G V+F     S+ + Q++  ++ YA   +A++ 
Sbjct: 127 VNIHPMAALTKNLAGAEMTEIGLLKAAGAVAFTDGDRSVMNAQLMRRALTYARDFDALIV 186

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L   GV+NEG  A+ LGL+G+P+ +E V L RD+ +   TGG YHA+ ++   
Sbjct: 187 HHTEDPNLVGEGVMNEGEFASRLGLIGVPNTAEAVVLERDMRLVALTGGRYHAASLTCVD 246

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           SI ++K A+    + T   SIN+L LNEND+  Y S  K+ PPLR+ET+R ++V AL  G
Sbjct: 247 SIEILKRARDAGLRVTASASINHLTLNENDIGPYRSFLKLSPPLRTETDREALVSALASG 306

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID+I+SDH P+ ++ K LPFAEA+ G+IGLETMLSA LRL H  ++SL  LIRA+STRP
Sbjct: 307 VIDVIMSDHNPQDVEVKRLPFAEAAAGAIGLETMLSAGLRLVHSGELSLLALIRAMSTRP 366

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++ NLPGGTL+ G+ AD+ +ID +  W V   ++ S  KNT FD+  F+G+V RT + G
Sbjct: 367 AELLNLPGGTLRAGSPADLIVIDADVPWVVDPTELKSKCKNTPFDEAKFSGRVARTIVGG 426

Query: 424 KQVY 427
           + VY
Sbjct: 427 RTVY 430


>gi|209884921|ref|YP_002288778.1| dihydroorotase (DHOase) [Oligotropha carboxidovorans OM5]
 gi|209873117|gb|ACI92913.1| dihydroorotase (DHOase) [Oligotropha carboxidovorans OM5]
          Length = 433

 Score =  344 bits (883), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 172/424 (40%), Positives = 262/424 (61%), Gaps = 1/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N R+IDPS D+D  G+++++NG+I  AG     +  P    I DC+G +  PG+ID
Sbjct: 8   ILLTNARLIDPSCDLDSAGSVLLQNGVIADAGPGVGQSSLPDGTEIIDCSGKIVAPGLID 67

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
            R  +      + +   + S+ A +GGIT+I+  P    + +D    + + L   R  ++
Sbjct: 68  MRAFIGEPGAGHRETFASASQAAASGGITTIVCQPETRPA-IDNSATVDFVLRRARDTAV 126

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +N++P A LT  + G E++E  LL+  G V+F     S+ + QV+  ++ YA   + ++ 
Sbjct: 127 VNIHPMAALTKGLAGDEMTEFGLLKAAGAVAFTDGAKSVINAQVMRRALTYARDFDVLIV 186

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L   GV+NEG +A+ LGL+G PS +E V L RD+ +   TGG YHA+ +S   
Sbjct: 187 HHTEDPNLSGEGVMNEGELASRLGLIGAPSAAEAVMLERDMRLVALTGGRYHAASVSCID 246

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ A+ +    +   SIN+L LNEND+  Y +  K+ PPLR+E +R S+V A+  G
Sbjct: 247 SLEILRRARDNGLAVSASASINHLALNENDIGPYRTYLKLSPPLRTEDDRQSLVAAVASG 306

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID+I+SDH P+ ++ K LPFAEA+ G+IGLETMLSA LRL H  +I L +L+RA+STRP
Sbjct: 307 LIDVIMSDHNPQDVEVKRLPFAEAAPGAIGLETMLSAGLRLVHSGEIELSRLLRAMSTRP 366

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++  LPGGTL+TG  ADI +IDL+  W +   D+ S  KNT FD+  FTG+ VRT + G
Sbjct: 367 AELLGLPGGTLRTGRPADIVVIDLDTPWVLDPADLKSQCKNTPFDEARFTGRAVRTLVGG 426

Query: 424 KQVY 427
           + V+
Sbjct: 427 RTVF 430


>gi|300022166|ref|YP_003754777.1| dihydroorotase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523987|gb|ADJ22456.1| dihydroorotase, multifunctional complex type [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 448

 Score =  342 bits (877), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 176/424 (41%), Positives = 263/424 (62%), Gaps = 4/424 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V  N R++DP+   DE G ++V++GII   G+  L    P  A + DC G V  PG+IDA
Sbjct: 20  VFINARLLDPASSRDEPGGLLVKDGIIADLGSH-LRRNAPEGATVIDCKGHVLAPGLIDA 78

Query: 65  RVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           +V  TG P  E+ + + T S  A AGG+T+I++MP   +  +D+ + + +     R  +L
Sbjct: 79  QV-FTGEPGYEHRETLKTASHAAAAGGVTTIVVMP-DTNPVIDQVSLVDFIQRRARDNAL 136

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           ++V+  A +T  ++G+E++E+ LL+  G ++F     S+ +T+V+ N + YA   NA+V 
Sbjct: 137 VHVHTMAAMTKGLKGEEMTEIGLLKRAGAIAFSNGKSSVVNTRVMRNVLSYAKDFNALVV 196

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D +L   G +N G +A+ LGL GI  I+ET+ L RD+ + + TGG YHA+ IS  +
Sbjct: 197 HHTEDPYLSGSGAMNSGEVASRLGLPGISKIAETITLERDVRLVEMTGGRYHAATISCQE 256

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ ++K AKA     TCG+SIN+L LNEND+  Y +  KV PPLR E +R +MV+ L  G
Sbjct: 257 SLDVVKAAKAKKLPVTCGVSINHLTLNENDIGPYRTFFKVRPPLRREEDRAAMVQGLANG 316

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
           DID+IVS H P+  DTK  PFAEA+ G++GLET+LSAALRL H   ++L  +++AL+  P
Sbjct: 317 DIDVIVSSHDPQDADTKRRPFAEAADGAVGLETLLSAALRLVHSGDVTLPAMLKALTINP 376

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++  L  G L  G  AD+ L D    W V  D + S  KNT FD+    G+V+RT ++G
Sbjct: 377 ARLLGLHSGRLAKGAIADLVLFDPGEPWVVNKDLLRSRSKNTPFDEAKMQGRVLRTVVAG 436

Query: 424 KQVY 427
           + VY
Sbjct: 437 ETVY 440


>gi|92117806|ref|YP_577535.1| dihydroorotase [Nitrobacter hamburgensis X14]
 gi|91800700|gb|ABE63075.1| dihydroorotase [Nitrobacter hamburgensis X14]
          Length = 433

 Score =  339 bits (869), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 171/425 (40%), Positives = 265/425 (62%), Gaps = 3/425 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N RI+DP+RD+D  G +++ +G++  A  D   A  P    I +C G +  PG+ID
Sbjct: 8   ILLANARIVDPARDLDGPGDVLIADGVVRDARRDIAAAGVPEGTDIINCAGKIVAPGLID 67

Query: 64  ARVTLTGSPDE-YSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
            R    G P   + +   + S+ A AGGIT+I+  P   S  +D    + + L   R  +
Sbjct: 68  IR-AFVGEPGAGHRETFASASRAAAAGGITTIVCQP-DTSPVIDNSATVDFVLRRARDTA 125

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++N++P A LT  + GKE++E+ LL+  G V+F     S+ + +V+  ++ YA   +A++
Sbjct: 126 IVNIHPMAALTKGLAGKEMTEIGLLKAAGAVAFTDGARSVMNARVMRRALTYARDFDALI 185

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
              T D  L   GV+NEG ++  LGL+GIP+ +E + L RD+ +   TGG YHA+ ++  
Sbjct: 186 VHHTEDAHLVGEGVMNEGELSARLGLMGIPAAAEAMVLERDMRLVALTGGRYHAASLTCA 245

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S+ ++K A+    + T   SIN+L LNEND+  Y +  K+ PPLRSE +R ++V AL  
Sbjct: 246 ESLDILKRARDAGLRVTASASINHLTLNENDIGPYRTFLKLSPPLRSEDDRRALVVALAS 305

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID+++SDH P+ ++TK LPFAEA+ G+IGLETML+AALRL H  ++  K LIRA+STR
Sbjct: 306 GLIDVVMSDHNPQDVETKRLPFAEAAAGAIGLETMLTAALRLVHNAELDFKTLIRAMSTR 365

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA++  LPGG+L+ G  AD+ +ID +  W +   D+ S  KNT FD+  F+G+VVRT + 
Sbjct: 366 PAELLGLPGGSLRPGAPADVIVIDPDTPWILDPADLKSQCKNTPFDESRFSGRVVRTIVG 425

Query: 423 GKQVY 427
           G+ V+
Sbjct: 426 GRTVF 430


>gi|299135142|ref|ZP_07028333.1| dihydroorotase, multifunctional complex type [Afipia sp. 1NLS2]
 gi|298590119|gb|EFI50323.1| dihydroorotase, multifunctional complex type [Afipia sp. 1NLS2]
          Length = 433

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 176/424 (41%), Positives = 256/424 (60%), Gaps = 3/424 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           +L N R+IDPS D+D  G +++ +G+I  AG     +  P  A I DC G V  PG+ID 
Sbjct: 9   LLINARLIDPSCDLDGRGGVLIHDGVIAEAGPGVGKSHAPEGAEIIDCAGKVIAPGLIDM 68

Query: 65  RVTLTGSPDE-YSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           R    G P   + +   + S+ A AGGIT+II  P       D    + + L   R  ++
Sbjct: 69  RA-FVGEPGAGHRETFASASQAAAAGGITTIICQP-DTKPVTDNSATVDFVLRRARDTAV 126

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +N++P A LT    G+E++E  LL+  G V+F     S+ + QV+  ++ YA     ++ 
Sbjct: 127 VNIHPMAALTKGFAGEEMTEFGLLKAAGAVAFTDGARSVTNAQVMRRALTYARDFGVLIV 186

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L   GV+NEG +A+ LGL+G PS +E V L RD+ +   TGG YHA+ +S  +
Sbjct: 187 HHTEDPNLAGEGVMNEGELASRLGLIGAPSAAEAVMLERDMRLVALTGGRYHAASVSCTE 246

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ A+      +   SIN+L LNEND+  Y +  K+ PPLR+E +R  +V A+  G
Sbjct: 247 SLDILRRAREAGLAVSASASINHLTLNENDIGPYKTFLKLSPPLRTEDDRKELVAAVASG 306

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID+I+SDH P+ ++ K LPFAEA+ G+IGLETMLSA LRL H  +I L +LIRA+STRP
Sbjct: 307 LIDVIMSDHNPQDVEVKRLPFAEAASGAIGLETMLSAGLRLVHNGEIELTRLIRAMSTRP 366

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++  LPGGTL+ G  ADI +IDL+  W +   D+ S  KNT FD+  FTG+ VRT + G
Sbjct: 367 AELLGLPGGTLRRGRPADIVVIDLDTPWILDPADLKSKCKNTPFDEARFTGRAVRTIVGG 426

Query: 424 KQVY 427
           + V+
Sbjct: 427 RTVF 430


>gi|298291507|ref|YP_003693446.1| dihydroorotase [Starkeya novella DSM 506]
 gi|296928018|gb|ADH88827.1| dihydroorotase, multifunctional complex type [Starkeya novella DSM
           506]
          Length = 432

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 175/423 (41%), Positives = 260/423 (61%), Gaps = 1/423 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           +L   RI+DPSRD+D  G I + +G+I    +D  +A       I DC GL+AVPG++D 
Sbjct: 8   LLAKARILDPSRDLDTTGDIFIADGVIKDVTSDLTSAGLSPDTEIVDCRGLIAVPGLVDM 67

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
           R  +     E+ + + + S+ A AGG+T+II  P      +D+   + + L   R  +++
Sbjct: 68  RAFIGEPGAEHRETLASASQAAAAGGVTTIICQP-DTDPVIDDPAIVDFILRRARDTAIV 126

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           +V+P A LT  +EG+E++E+ LL   G V+F     SI   QVL  ++ YA   +A++  
Sbjct: 127 HVHPMAALTKGLEGREMTEIGLLGAAGAVAFTDGTRSIRSAQVLRRALTYARDFDALIVH 186

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
            T D  L   GV+NEG +A+ LGL G+P  +ET+ L RDL +   TGG YHA+ ++  +S
Sbjct: 187 HTEDASLVGEGVMNEGELASRLGLAGVPKAAETIVLERDLRLVAITGGRYHAASLTCAES 246

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + +++ AK      T   SIN+L LNE DV  Y +  K+ PPLR E +R+++VEA+ +G 
Sbjct: 247 LEVLRRAKRDGLDVTASASINHLTLNERDVVGYRTFFKLAPPLRGEDDRVALVEAVAEGL 306

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID++VSDH P+ ++ K LPF+EA+FG+IGLETML+A LRL     + L  LI A+STRPA
Sbjct: 307 IDVVVSDHNPQDVEVKRLPFSEAAFGAIGLETMLAAGLRLVKDGALDLITLIGAMSTRPA 366

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           +I  LP GTL+ G  ADIALI  +  W +    + S  +NT FD+  F G+VVRT ++G+
Sbjct: 367 EILGLPAGTLRPGQPADIALIAPDEAWLLDPATLKSRCRNTPFDEARFEGRVVRTLVAGR 426

Query: 425 QVY 427
            VY
Sbjct: 427 TVY 429


>gi|85716405|ref|ZP_01047377.1| dihydroorotase [Nitrobacter sp. Nb-311A]
 gi|85696762|gb|EAQ34648.1| dihydroorotase [Nitrobacter sp. Nb-311A]
          Length = 433

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 172/424 (40%), Positives = 263/424 (62%), Gaps = 3/424 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           +L N RI+DP+RD+D  G +++ +G+I  A +       P    I +C   +  PG+ID 
Sbjct: 9   LLANARIVDPARDLDAPGDVLIADGVIRDARSGIGATGVPEGTDIINCADKIVAPGLIDI 68

Query: 65  RVTLTGSPDE-YSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           R    G P   + +   + S  A AGGIT+I+  P   S  +D  T + + L   R  ++
Sbjct: 69  RA-FVGEPGAGHRETFASASHAAAAGGITTIVCQP-DTSPVIDNSTTVDFVLRRARDTAI 126

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +N++P A LT  + GKE++E+ LL+E G V+F     S+ + QV+  ++ YA   +A++ 
Sbjct: 127 VNIHPMAALTKGLAGKEMTEIGLLKEAGAVAFTDGARSVMNAQVMRRALTYARDFDALIV 186

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L   GV+NEG +++ LGL G+P+ +E V L RD+ +   TGG YHA+ ++  +
Sbjct: 187 HHTEDIHLVGEGVMNEGELSSRLGLTGVPTAAEAVILERDMRLVGLTGGRYHAASLTCTE 246

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ ++  A+    + T   SIN+L LNEND+  Y +  K+ PPLRSE +R +M+ AL  G
Sbjct: 247 SLDILMRARDAGLQVTASASINHLTLNENDIGPYRTFLKLSPPLRSEDDRRAMIAALASG 306

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID+++SDH P+ ++TK LPFAEA  G+IGLETML+AALRL H Q++  K LIRA+STRP
Sbjct: 307 LIDVVMSDHNPQDVETKRLPFAEAVAGAIGLETMLTAALRLVHNQELDFKTLIRAMSTRP 366

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++  LPGG+L+ G  AD+ +ID +  W +   D+ S  KNT FD+  F+G+VVRT + G
Sbjct: 367 AELLGLPGGSLRPGAPADVIVIDPDVPWILDPADLKSQCKNTPFDESRFSGRVVRTIVGG 426

Query: 424 KQVY 427
           + V+
Sbjct: 427 RTVF 430


>gi|254474163|ref|ZP_05087554.1| dihydroorotase [Pseudovibrio sp. JE062]
 gi|211956693|gb|EEA91902.1| dihydroorotase [Pseudovibrio sp. JE062]
          Length = 434

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 173/420 (41%), Positives = 251/420 (59%), Gaps = 1/420 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            VL N RIIDP+  +DE GA+ V++G I+AAGADALN   P      DC G V  PG+ID
Sbjct: 8   LVLTNARIIDPANGVDEAGAVFVQDGNIVAAGADALNQGAPEGTKTIDCNGAVVAPGLID 67

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V++     E+ + + + S+ A  GG+T+I+  P      +D+   + + L   R  ++
Sbjct: 68  MGVSVGEPGAEHRETLESASRAAAIGGVTTILTSP-NTDPVIDDPALVDFMLRRARDTAI 126

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NV+P A LT  + GK++SE+ LL+E G ++F    + I ++ VL+  + YA   +A+V 
Sbjct: 127 VNVHPMAALTKGLAGKDMSEIGLLKEAGAIAFSNDRLPITNSSVLVRLLTYARDFDALVV 186

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  L   GV+N G+ A++LGL GIP  +E V + RD+ +     G YHA +IS PQ
Sbjct: 187 HQAQDKDLAGSGVMNAGLRASWLGLGGIPREAEFVAIERDMRLVAMAKGKYHARLISCPQ 246

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S   I+ AK      T GISIN+L LNEND+  Y +  K+ PPLR+E +R +MV+AL  G
Sbjct: 247 SAEAIQKAKNEGLNVTSGISINHLTLNENDIGPYRTFHKMSPPLRTEDDRQAMVKALADG 306

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDII+SDH P+ ++TK  PFAEA  G++GLETML A +RL   + ISL KL+  ++  P
Sbjct: 307 TIDIIMSDHNPQDVETKRHPFAEAEDGALGLETMLGAGMRLVLNEDISLSKLLATMTCNP 366

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A    LP G L  G  AD+ + D    W V+ + + S  KNT F+ E  TG+V+ T ++G
Sbjct: 367 ADRLGLPAGRLSKGAPADLIIFDPQKPWIVEKEKIRSRSKNTPFEDETLTGRVLTTIVAG 426


>gi|114707189|ref|ZP_01440087.1| dihydroorotase [Fulvimarina pelagi HTCC2506]
 gi|114537385|gb|EAU40511.1| dihydroorotase [Fulvimarina pelagi HTCC2506]
          Length = 449

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 172/424 (40%), Positives = 265/424 (62%), Gaps = 1/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R++DP+R++D  GA++V +G I+AAG + LN   P  A   D  GL  +PG++D
Sbjct: 17  LLIENVRVVDPARNLDTHGAVLVADGKIVAAGPEVLNQGAPDGAERIDGKGLTLIPGLVD 76

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           ARV +     E+ + I T S  A AGG+TSI+ MP      +D+    ++ +   R  ++
Sbjct: 77  ARVFIGEPGGEHLETIRTASLAAAAGGVTSIVTMP-DTHPVIDDVAIAEFVMRTARDTAV 135

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NV+P A +T  +EGKE++E+ LL++ G+V+F     +I D  +L   M YA    A+V 
Sbjct: 136 VNVFPAAAMTRGLEGKEMTEIGLLKDAGVVAFTDGRHTISDPALLRRIMTYARDHGALVM 195

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L  RGV+NEG+ A++LGL G P+ +E +PL RDL +A  T   YHA+ +S+ +
Sbjct: 196 HSTQDLQLTGRGVMNEGLFASWLGLPGAPAEAEIIPLERDLRLAGLTACRYHAAEVSLAE 255

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S  +++ AK    KA+ G+SIN+L LNEND+  Y +  ++ PPLR E +RM++VEAL+ G
Sbjct: 256 SADVVRAAKRRGVKASAGVSINHLSLNENDIGEYRTYFRLSPPLRHEDDRMAIVEALKDG 315

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDI+ S H P+  D K  PFAEA  G+IGLET+L+AALRL     + L +LI  +++ P
Sbjct: 316 TIDIVHSAHDPQDADRKRRPFAEAESGAIGLETLLAAALRLHFSNDVPLMRLIETMTSAP 375

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++  +  GTL  G  AD  L+DL+  +      + S  KNTVF+   F G+V++T+++G
Sbjct: 376 ARLLGIDRGTLIAGRPADFTLVDLDEPFLFDETMIRSKSKNTVFENARFQGRVMQTFVAG 435

Query: 424 KQVY 427
           ++VY
Sbjct: 436 RRVY 439


>gi|146341413|ref|YP_001206461.1| dihydroorotase [Bradyrhizobium sp. ORS278]
 gi|146194219|emb|CAL78241.1| dihydroorotase (DHOase) [Bradyrhizobium sp. ORS278]
          Length = 433

 Score =  335 bits (860), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 173/427 (40%), Positives = 261/427 (61%), Gaps = 7/427 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGII--LAAGADALNAKFPTSALIHDCTGLVAVPGI 61
            +L N R+IDPSRDID  G +++ +G+I  L  G  A  A  P    + +C G +  PG+
Sbjct: 8   ILLANARVIDPSRDIDGPGDVLIADGVIRDLKRGIGA--AGVPEGTDVVNCAGKIVAPGL 65

Query: 62  IDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +D      G P   + +   + S+ A  GGIT+II  P G    +D    + + L   R 
Sbjct: 66  VDM-CAFVGEPGLGHRETFASASQAAATGGITTIICQP-GTEPVIDNSATVDFVLRRARD 123

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++N+ P A LT  + G+E++E+ LL+  G V+F     S+ + QV+  ++ YA   +A
Sbjct: 124 TAIVNIQPMAALTKGLRGEEMTEIGLLRAAGAVAFSNGHSSVMNAQVMRRALTYARDFDA 183

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++   T D  L   GV+NEG  A+ LGL GIP+ +E V L RD+ +   T G YHA+ +S
Sbjct: 184 LIVHHTEDPHLVGEGVMNEGEFASRLGLSGIPAAAEAVVLERDMRLVALTKGRYHAAALS 243

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S+ ++K A+      +  +SIN++ LNEND+  Y +  K+ PPLR+E +R ++VEAL
Sbjct: 244 SVDSLDVLKRARDAGLAVSASVSINHVTLNENDIGPYRTFLKLTPPLRTEVDRRALVEAL 303

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID+I+SDH P+ ++ K LPFAEA+ G++GLETML+A+LRL H  ++S   LIRA+S
Sbjct: 304 ASGLIDVIMSDHNPQDVEVKRLPFAEAASGAVGLETMLAASLRLVHSGELSWTTLIRAMS 363

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           TRPA++  LPGGTL+ G  ADI +ID +  W +   D+ S+ KNT FD+  FTG+VVRT 
Sbjct: 364 TRPAELLGLPGGTLRAGAPADIIVIDPDVPWILDPADLKSLCKNTPFDEARFTGRVVRTI 423

Query: 421 ISGKQVY 427
           + G+ V+
Sbjct: 424 VGGRTVF 430


>gi|148256074|ref|YP_001240659.1| dihydroorotase [Bradyrhizobium sp. BTAi1]
 gi|146408247|gb|ABQ36753.1| dihydroorotase [Bradyrhizobium sp. BTAi1]
          Length = 433

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 172/427 (40%), Positives = 259/427 (60%), Gaps = 7/427 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGII--LAAGADALNAKFPTSALIHDCTGLVAVPGI 61
            +L N R+IDPSRDID  G +++ +G+I  L  G  A  A  P    + +C G +  PG+
Sbjct: 8   ILLANARVIDPSRDIDGPGDVLIADGVIRDLKRGIGA--AGVPEGTDVVNCAGKIVAPGL 65

Query: 62  IDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ID      G P   + +   + S+ A  GGIT+II  P G    +D    + + L   R 
Sbjct: 66  IDM-CAFVGEPGLGHRETFASASQAAATGGITTIICQP-GTEPVIDNSATVDFVLRRARD 123

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++N+ P A LT  + G+E++E+ LL+  G V+F     S+ + QV+  ++ YA   +A
Sbjct: 124 TAIVNIQPMAALTKGLRGEEMTEIGLLRAAGAVAFSNGHTSVMNAQVMRRALTYARDFDA 183

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++   T D  L   GV+NEG  A+ LGL GIP  +E V L RD+ +   + G YHA+ +S
Sbjct: 184 LIVHHTEDPDLVGEGVMNEGEFASRLGLSGIPPAAEAVVLERDMRLVALSKGRYHAAALS 243

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S+ +++ A+      +  +SIN+L LNEND+  Y +  K+ PPLR+E +R ++VEAL
Sbjct: 244 SVDSLDILRRAREAGLAVSASVSINHLTLNENDIGPYRTFLKLTPPLRTEVDRRALVEAL 303

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G +D+I+SDH P+ ++ K LPFAEA+ G++GLETML+A LRL H  ++S   LIRA+S
Sbjct: 304 ASGLVDVIMSDHNPQDVEVKRLPFAEAASGAVGLETMLTAGLRLVHNDELSWTTLIRAMS 363

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           TRPA++  LPGGTL+ G  ADI +ID +  W +   D+ S+ KNT FD+  FTG+VVRT 
Sbjct: 364 TRPAELLGLPGGTLRAGAPADIIVIDPDVPWILDPADLKSLCKNTPFDEARFTGRVVRTI 423

Query: 421 ISGKQVY 427
           + G+ V+
Sbjct: 424 VGGRTVF 430


>gi|75676198|ref|YP_318619.1| dihydroorotase [Nitrobacter winogradskyi Nb-255]
 gi|74421068|gb|ABA05267.1| dihydroorotase [Nitrobacter winogradskyi Nb-255]
          Length = 433

 Score =  334 bits (857), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 170/425 (40%), Positives = 261/425 (61%), Gaps = 3/425 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N RI+DP+RD+D  G +++ +G+I  A      A  P    I +C G++  PG+ID
Sbjct: 8   ILLANARIVDPARDLDGPGDVLIADGVIRDARHGIGAAGAPEGTDIINCAGMIVTPGLID 67

Query: 64  ARVTLTGSPDE-YSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
            R    G P   + +   + S  A AGGIT+I+  P   S  +D    + + L   R  +
Sbjct: 68  IRA-FVGEPGAGHRETFASASCAAAAGGITTIVCQP-DTSPVIDNSATVDFVLRRARDTA 125

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++N++P A LT  + GKE++E  LL+E G V+F     S+ + QV+  ++ YA   +A++
Sbjct: 126 IVNIHPMAALTKGLAGKEMTEFGLLKEAGAVAFTDGARSVMNAQVMRRALTYARDFDALI 185

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
              T D  L   GV+NEG +++ LGL G+P+ +E V L RD+ +   TGG YHA+ ++  
Sbjct: 186 VHHTEDAHLVGDGVMNEGELSSRLGLTGVPATAEAVMLERDMRLVGLTGGRYHAASLTCA 245

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S+ ++  A+      +   SIN+L LNEND+  Y +  K+ PPLR E +R ++V AL  
Sbjct: 246 ESLDILMRARDAGLPVSASASINHLTLNENDIGPYRTFLKLSPPLRGEDDRRALVAALAS 305

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID+++SDH P+ ++TK LPFAEA+ G+IGLETML+AALRL H  ++  K LIRA+STR
Sbjct: 306 GLIDVVMSDHNPQDVETKRLPFAEAAAGAIGLETMLTAALRLVHNAELDFKTLIRAMSTR 365

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA++  LPGG+L+ G  AD+ +ID +  W +   D+ S  KNT FD+  F+G+VVRT + 
Sbjct: 366 PAELLGLPGGSLRPGAPADVIVIDPDVPWILDPADLKSQCKNTPFDESRFSGRVVRTIVG 425

Query: 423 GKQVY 427
           G+ V+
Sbjct: 426 GRTVF 430


>gi|27380211|ref|NP_771740.1| dihydroorotase [Bradyrhizobium japonicum USDA 110]
 gi|27353365|dbj|BAC50365.1| blr5100 [Bradyrhizobium japonicum USDA 110]
          Length = 436

 Score =  334 bits (857), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 169/424 (39%), Positives = 256/424 (60%), Gaps = 3/424 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           +L N R++DPSRD D  G +++ +GII         A  P    + +C G +  PG+ID 
Sbjct: 12  LLANARVVDPSRDFDGPGDVLIADGIIRETRRGIGAAGVPEGTDVVNCAGKIVAPGLIDM 71

Query: 65  RVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           +    G P   + +   + S+ A  GGIT+II  P      +D    + + +   R  ++
Sbjct: 72  K-AFVGEPGFSHRETFASASQAAATGGITTIICQP-DTEPVIDNSATVDFVMRRARDTAI 129

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +N+ P A LT  M G+E++E  LL+  G ++F     S+ + QV+  ++ YA   +A++ 
Sbjct: 130 VNIQPMAALTKGMRGEEMTEFGLLKAAGAIAFSDGDRSVTNAQVMRRALTYARDFDALIV 189

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L   GV+NEG  A+ LGL+GIP+ +E V L RD+ +   TGG YHA+ +S   
Sbjct: 190 HHTEDPDLVGEGVMNEGEFASRLGLMGIPNAAEAVMLERDMRLVALTGGRYHAASLSCID 249

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ ++K A+      +  +SIN+L LNEND+  Y S  K+ PPLR+E +R ++V A+  G
Sbjct: 250 SLDILKRARDAGLAVSASVSINHLALNENDIGPYRSFLKLSPPLRTEDDRRALVAAVASG 309

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID+I+SDH P+ ++ K LPFAEA+ G++GLETML A LRL H  ++ LK LI+A+STRP
Sbjct: 310 LIDVIMSDHNPQDVEVKRLPFAEAAPGAVGLETMLPAGLRLMHNGELDLKTLIQAMSTRP 369

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+I  LPGGTL+ G+ AD+ +ID +  W V   ++ S  KNT FD+  FTG+VVRT + G
Sbjct: 370 AEILGLPGGTLRAGSPADVIVIDPDVPWVVDPAELKSPCKNTPFDEARFTGRVVRTIVGG 429

Query: 424 KQVY 427
           + V+
Sbjct: 430 RTVF 433


>gi|316933649|ref|YP_004108631.1| multifunctional complex dihydroorotase [Rhodopseudomonas palustris
           DX-1]
 gi|315601363|gb|ADU43898.1| dihydroorotase, multifunctional complex type [Rhodopseudomonas
           palustris DX-1]
          Length = 433

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 168/424 (39%), Positives = 261/424 (61%), Gaps = 1/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N R+IDPSRD D +G +++ +G+I  A      A  P    I +C G+V  PG+ID
Sbjct: 8   ILLANARLIDPSRDFDGIGDVLIADGVIRDARRGIGAAGVPEGTDIVNCAGMVVAPGLID 67

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
            R  +      + +   + S+ A AGGIT+I+  P   S  +D    + + +   R  ++
Sbjct: 68  MRAFVGEPGASHRETFASASQAAAAGGITTIVCQP-NTSPVIDNSATVDFVMRRARDTAI 126

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +N++P A +T  + G E++E+ LL+  G V+F    +SI + QV+  ++ YA   +A++ 
Sbjct: 127 VNIHPMAAITKGLAGAEMTEIGLLKAAGAVAFSDGDLSITNAQVMRRALTYARDFDALIV 186

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L   GV+NEG  A  LGL GIP+ +ETV L RD+ +   TGG YHA+ +S  +
Sbjct: 187 HHTEDPDLVGEGVMNEGEFATRLGLAGIPNAAETVMLERDIRLVMLTGGRYHAASLSCIE 246

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ A+      +  +SIN++ LNEND+  Y +  K+ PPLR+E +R +++ AL  G
Sbjct: 247 SLEIMQRARDLGLPVSASVSINHVALNENDIGPYRTFLKLAPPLRTEADRKALIAALASG 306

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID+++SDH P+ ++ K LPFAEA+ G+IGLETML A LRL H  ++ L  LIRA+STRP
Sbjct: 307 LIDVVMSDHNPQDVEVKRLPFAEAAAGAIGLETMLPAGLRLVHAGELDLLSLIRAMSTRP 366

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++  LPGGTL+ G+ AD+ +ID +  W V  D++ S  KNT FD+  F+G++ RT + G
Sbjct: 367 AELLGLPGGTLRAGSPADLIVIDPDVPWLVDPDELKSKCKNTPFDEARFSGRLTRTIVGG 426

Query: 424 KQVY 427
           + VY
Sbjct: 427 RTVY 430


>gi|39936181|ref|NP_948457.1| dihydroorotase [Rhodopseudomonas palustris CGA009]
 gi|39650036|emb|CAE28559.1| putative noncatalytic chain of dihydroorotase [Rhodopseudomonas
           palustris CGA009]
          Length = 436

 Score =  332 bits (850), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 164/424 (38%), Positives = 261/424 (61%), Gaps = 1/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N R+IDPSRD D +G +++ +G+I  A      A  P    I +C G+V  PG++D
Sbjct: 8   ILLANARLIDPSRDFDGIGDVLIADGVIRDARRGIGAAGVPEGTDIVNCAGMVVAPGLVD 67

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
            R  +      + +   + S+ A AGGIT+I+  P   S  +D    + + +   R  ++
Sbjct: 68  MRAFVGEPGASHRETFASASQAAAAGGITTIVCQP-NTSPVIDNSATVDFVMRRARDTAI 126

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +N++P A +T  + G E++E+ LL+  G V+F    +S+ + QV+  ++ YA   +A++ 
Sbjct: 127 VNIHPMAAITKGLAGAEMTEIGLLKAAGAVAFSDGDLSVTNAQVMRRALTYARDFDALIV 186

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L   GV+NEG  A  LGL GIP+ +ETV L RD+ +   TGG YHA+ ++  +
Sbjct: 187 HHTEDPDLVGEGVMNEGEFATRLGLAGIPNAAETVMLERDIRLVMLTGGRYHAASLTCIE 246

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ A+      +  +SIN++ LNEND+  Y +  K+ PPLR+E +R +++ A+  G
Sbjct: 247 SLEIMQRARDLGLSVSASVSINHVALNENDIGPYRTFLKLAPPLRTEADRKALIAAIASG 306

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID+++SDH P+ ++ K LPFAEA+ G+IGLETML A LRL H  ++    LIRA+STRP
Sbjct: 307 LIDVVMSDHNPQDVEVKRLPFAEAAAGAIGLETMLPAGLRLVHAGELDFLSLIRAMSTRP 366

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++  LPGGTL++G  AD+ +ID +  W V  D++ S  KNT FD+  F+G+V+RT + G
Sbjct: 367 AELLGLPGGTLRSGAPADLIVIDPDVPWLVDPDELKSKCKNTPFDEARFSGRVIRTIVGG 426

Query: 424 KQVY 427
           + VY
Sbjct: 427 RTVY 430


>gi|192291898|ref|YP_001992503.1| dihydroorotase [Rhodopseudomonas palustris TIE-1]
 gi|192285647|gb|ACF02028.1| dihydroorotase, multifunctional complex type [Rhodopseudomonas
           palustris TIE-1]
          Length = 436

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 164/424 (38%), Positives = 261/424 (61%), Gaps = 1/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N R+IDPSRD D +G +++ +G+I  A      A  P    I +C G+V  PG++D
Sbjct: 8   ILLANARLIDPSRDFDGIGDVLIADGVIRDARRGIGAAGVPEGTDIVNCAGMVVAPGLVD 67

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
            R  +      + +   + S+ A AGGIT+I+  P   S  +D    + + +   R  ++
Sbjct: 68  IRAFVGEPGASHRETFASASQAAAAGGITTIVCQP-NTSPVIDNSATVDFVMRRARDTAI 126

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +N++P A +T  + G E++E+ LL+  G V+F    +S+ + QV+  ++ YA   +A++ 
Sbjct: 127 VNIHPMAAITKGLAGAEMTEIGLLKAAGAVAFSDGDLSVTNAQVMRRALTYARDFDALIV 186

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L   GV+NEG  A  LGL GIP+ +ETV L RD+ +   TGG YHA+ ++  +
Sbjct: 187 HHTEDPDLVGEGVMNEGEFATRLGLAGIPNAAETVMLERDIRLVMLTGGRYHAASLTCIE 246

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ A+      +  +SIN++ LNEND+  Y +  K+ PPLR+E +R +++ A+  G
Sbjct: 247 SLEIMQRARDLGLSVSASVSINHVALNENDIGPYRTFLKLAPPLRTEADRKALIAAIASG 306

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID+++SDH P+ ++ K LPFAEA+ G+IGLETML A LRL H  ++    LIRA+STRP
Sbjct: 307 LIDVVMSDHNPQDVEVKRLPFAEAAAGAIGLETMLPAGLRLVHAGELDFLSLIRAMSTRP 366

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++  LPGGTL++G  AD+ +ID +  W V  D++ S  KNT FD+  F+G+V+RT + G
Sbjct: 367 AELLGLPGGTLRSGAPADLIVIDPDVPWLVDPDELKSKCKNTPFDEARFSGRVIRTIVGG 426

Query: 424 KQVY 427
           + VY
Sbjct: 427 RTVY 430


>gi|90423749|ref|YP_532119.1| dihydroorotase [Rhodopseudomonas palustris BisB18]
 gi|90105763|gb|ABD87800.1| dihydroorotase [Rhodopseudomonas palustris BisB18]
          Length = 437

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 175/425 (41%), Positives = 263/425 (61%), Gaps = 3/425 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N R+IDPSRD+D +G +++ +G I  A      A  P    I +C G +  PG+ID
Sbjct: 12  ILLANARLIDPSRDVDGIGDVLIADGTIREARRGIGAAGVPEGTDIINCAGKIVAPGLID 71

Query: 64  ARVTLTGSPDE-YSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
            R    G P   + +   + S+ A AGGIT+II  P   S  +D    + + L   R  +
Sbjct: 72  MR-AFVGEPGAGHRETFASASQAAAAGGITTIICQP-DTSPTIDNSATVDFVLRRARDTA 129

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++N++P A LT ++ G E++E+ LL+  G V+F     S+ D QV+  ++ YA   +A++
Sbjct: 130 IVNIHPMAALTKDLAGHEMTEIGLLKAAGAVAFTDGVRSVMDAQVMRRALTYARDFDALI 189

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
              T D  L   GV+NEG +A+ LGL+G+P+I+E V L RD+ +   TGG YHA+ I+  
Sbjct: 190 VHHTEDPNLVGEGVMNEGELASRLGLIGVPNIAEAVVLERDMRLVALTGGRYHAASITCV 249

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +SI +++ A+    K T   SIN+L LNEND+  Y S  K+ PPLR+E +R ++V A+  
Sbjct: 250 ESIEILRRAREAGLKVTASASINHLTLNENDIGPYRSFLKLSPPLRTEDDRQALVAAVAA 309

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID+I+SDH P+ ++ K LPFAEA+ G+IGLETML A LRL H  ++    LIRA+ST+
Sbjct: 310 GLIDVIMSDHNPQDVEVKRLPFAEAAAGAIGLETMLPAGLRLIHSGELDFLTLIRAMSTK 369

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA++  LPGGTL+ G+ AD+ +ID +  W V  +++ S  KNT FD+  F G+V RT ++
Sbjct: 370 PAELLGLPGGTLRAGSPADLIVIDADVPWVVDPNELKSKCKNTPFDEAKFAGRVARTIVA 429

Query: 423 GKQVY 427
           G+ VY
Sbjct: 430 GRTVY 434


>gi|86749543|ref|YP_486039.1| dihydroorotase [Rhodopseudomonas palustris HaA2]
 gi|86572571|gb|ABD07128.1| dihydroorotase [Rhodopseudomonas palustris HaA2]
          Length = 436

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 169/425 (39%), Positives = 264/425 (62%), Gaps = 3/425 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N R+IDP+RD D +G +++ +G+I  A      A  P    I +C G+V  PG++D
Sbjct: 8   ILLANARLIDPARDFDGLGDVLIADGVIRDARRGIGAAGVPEGTDIINCAGMVVAPGLVD 67

Query: 64  ARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
            R    G P   + +   + S+ A AGGIT+II  P   S  +D    + + +   R  +
Sbjct: 68  MR-AFVGEPGASHRETFASASQAAAAGGITTIICQP-NTSPVIDNSATVDFVMRRARDTA 125

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++N++P A LT  + G E++E+ LL+  G V+F     S+ + +V+ +++ YA   +A++
Sbjct: 126 IVNIHPMAALTKGLNGIEMTEIGLLKAAGAVAFSDGDRSVMNARVMRSALTYARDFDALI 185

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
              T D  L + GV+NE   A  LGL G+PS +E V L RD+ +A  TGG YHA+ ++  
Sbjct: 186 VHHTEDPDLVAEGVMNESEFATRLGLSGVPSAAEAVVLERDVRLAALTGGRYHAASLTCI 245

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S+ +++ A+      +  +SIN++ LNEND+  Y +  K+ PPLRSE +R +++ A+  
Sbjct: 246 ESLEILQRARDAGINVSASVSINHVTLNENDIGPYRTFLKLSPPLRSEDDRKALIAAVSS 305

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID+I+SDH P+ ++ K LPFAEA+ G+IGLETML A LRL H  ++ L  LIRA+STR
Sbjct: 306 GLIDVIMSDHNPQDVEVKRLPFAEAAAGAIGLETMLPAGLRLLHAGELDLLSLIRAMSTR 365

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA++  LPGGTL+ G+ AD+ +IDL+  W V  +++ S  KNT FD+  F+G+VVRT + 
Sbjct: 366 PAELLGLPGGTLRAGSPADLIVIDLDTPWIVDPNELKSKCKNTPFDEARFSGRVVRTIVG 425

Query: 423 GKQVY 427
           G+ VY
Sbjct: 426 GRTVY 430


>gi|91977497|ref|YP_570156.1| dihydroorotase [Rhodopseudomonas palustris BisB5]
 gi|91683953|gb|ABE40255.1| dihydroorotase [Rhodopseudomonas palustris BisB5]
          Length = 433

 Score =  327 bits (837), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 164/424 (38%), Positives = 262/424 (61%), Gaps = 1/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N R+IDP+RD D VG +++ +G+I  A      A  P    I +C G++  PG+ID
Sbjct: 8   ILLANARLIDPARDFDGVGDVLIADGVIRDARRGIGAAGVPEGTDIINCGGMIVAPGLID 67

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
            R  +      + +   + S+ A AGGIT+II  P   S  +D    + + +   R  ++
Sbjct: 68  MRAFVGEPGASHRETFASASQAAAAGGITTIICQP-NTSPVIDNSATVDFVMRRARDTAI 126

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +N++P A LT  + G E++E+ LL+  G V+F     S+ + +V+ +++ YA   +A++ 
Sbjct: 127 VNIHPMAALTKGLAGAEMTEIGLLKAAGAVAFSDGDRSVMNARVMRSALTYARDFDALIV 186

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L   GV+NEG  A  LGL G+P+ +E V L RD+ +A  TGG YHA+ ++  +
Sbjct: 187 HHTEDPDLVGEGVMNEGEFATRLGLSGMPNAAEAVVLERDVRLAALTGGRYHAASLTCIE 246

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ A+      +  +SIN++ LNEND+  Y +  K+ PPLR+E +R +++ A+  G
Sbjct: 247 SLEILQRARDTGINVSASVSINHVSLNENDIGPYRTFLKLSPPLRTENDRKALIAAVASG 306

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            +D+I+SDH P+ ++ K LPFAEA+ G+IGLETML A LRL H  ++ L  LIRA+STRP
Sbjct: 307 LVDVIMSDHNPQDVEVKRLPFAEAAAGAIGLETMLPAGLRLVHNGELDLLTLIRAMSTRP 366

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++  LPGGTL+ G+ AD+ +ID++  W V  +++ S  KNT FD+  F+G+V RT + G
Sbjct: 367 AELLGLPGGTLRAGSPADLIMIDIDTPWVVDPNELKSKCKNTPFDEARFSGRVTRTIVGG 426

Query: 424 KQVY 427
           + VY
Sbjct: 427 RTVY 430


>gi|118590186|ref|ZP_01547589.1| dihydroorotase [Stappia aggregata IAM 12614]
 gi|118437158|gb|EAV43796.1| dihydroorotase [Stappia aggregata IAM 12614]
          Length = 433

 Score =  323 bits (829), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 169/424 (39%), Positives = 257/424 (60%), Gaps = 2/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            VL+N R+IDP+R +D  G++I+ +G ILAAG +A N   P  A I DC G +A PG+ID
Sbjct: 9   LVLSNARVIDPARGLDAPGSVIIADGTILAAGPEAANQGSPYGAEIIDCKGAIACPGLID 68

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V++     E+ + + + S+ A +GG+T+I +MP      +D+   + + L   R  ++
Sbjct: 69  FCVSVGEPGAEHRETLASASQAAASGGVTTICIMP-DTDPVIDDPALVDFILRRARDTAI 127

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NV P A LT  ++G+E+SE+ LLQE G V+F     S+ + QV+   M YA   +A+V 
Sbjct: 128 VNVLPLAALTKGLKGEEMSEIGLLQEAGAVAFTNGHRSVKNAQVMRRMMTYARDFDALVI 187

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L   GV+N G+ A++ GL G+P  +E + L RDL +   + G YHA++IS   
Sbjct: 188 HHTEDPDLAG-GVMNAGLNASWKGLSGVPREAEIIMLERDLRLVAMSKGKYHANLISTSD 246

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S  +I+  KA     T G+SIN+L  NEND+  Y +  K+ PPLR E +R +M+ A+  G
Sbjct: 247 SADVIRAGKAKGLDITAGVSINHLTHNENDIGAYRTFFKMAPPLRDEDDRQAMIAAVADG 306

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDII S+H P+ ++TK  P+AEA  G+IGLET+L+AALRL+H +Q+ L  L+ A++ RP
Sbjct: 307 TIDIICSNHDPQDVETKRHPWAEAEDGAIGLETLLAAALRLYHSEQVDLVTLLGAMTCRP 366

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A    L  G L  G  AD+ + D    W ++   + S  KN+ F+   F+G+V+RT + G
Sbjct: 367 ADRLGLETGRLSKGAPADVTVFDPERPWVLEKSAIKSRSKNSPFEDARFSGRVLRTVVGG 426

Query: 424 KQVY 427
           K V+
Sbjct: 427 KTVF 430


>gi|328543468|ref|YP_004303577.1| amidohydrolase family [polymorphum gilvum SL003B-26A1]
 gi|326413212|gb|ADZ70275.1| Amidohydrolase family, putative [Polymorphum gilvum SL003B-26A1]
          Length = 432

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 171/424 (40%), Positives = 257/424 (60%), Gaps = 2/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            VL N R+IDP+R++D  G++I+ +G +LAAG +A N   P  A I DC G VA PG++D
Sbjct: 8   LVLANARVIDPARNLDAPGSVIIVDGTVLAAGPEAANQGAPYGAEIVDCRGAVACPGLVD 67

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V++     E+ + + + S+ A AGGIT+I+ +P   +  +D+   + Y L   R  ++
Sbjct: 68  MCVSVGEPGHEHRETLASASQAAAAGGITTIVTLP-ETNPVIDDPALVDYILRRARDTAI 126

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V+P A LT  M G E++E+ LL+E G V+F     S+   Q +   M YA    A++ 
Sbjct: 127 VRVHPMAALTRAMAGAEMTEIGLLKEAGAVAFTDGHRSVASAQTMRRLMTYARDFGALIV 186

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L S GV+NEG+ A++ GL GIP  +E + + RD+ +A  T   YHA++IS   
Sbjct: 187 HHTEDPTL-SGGVMNEGLNASWKGLPGIPREAEIIMVERDIRLAALTRARYHANLISCSD 245

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S  +I+ AKA     T G+SIN+L  NEND+  Y +  K+ PPLR E +R +M+ AL  G
Sbjct: 246 SAEVIRAAKARGLDVTAGVSINHLTQNENDIGPYRTFFKMSPPLRDEDDRRAMIAALADG 305

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDIIVS+H P+ ++TK  PFAEA  G+IGLET+L+AALRL+H   I L  L+  +++RP
Sbjct: 306 TIDIIVSNHDPQDVETKRHPFAEAEDGAIGLETLLAAALRLYHAGDIDLVSLLACMTSRP 365

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A    L  G L  G  AD+ + D +  W ++   + S  KN+ F+   F+G+V+RT ++G
Sbjct: 366 ADRLGLDVGHLSRGAPADVVVFDPDKPWVLEKSAIRSRSKNSPFEDARFSGRVLRTVVAG 425

Query: 424 KQVY 427
           + VY
Sbjct: 426 RTVY 429


>gi|254502986|ref|ZP_05115137.1| Amidohydrolase family, putative [Labrenzia alexandrii DFL-11]
 gi|222439057|gb|EEE45736.1| Amidohydrolase family, putative [Labrenzia alexandrii DFL-11]
          Length = 441

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 169/424 (39%), Positives = 255/424 (60%), Gaps = 2/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            VL+N R+IDP+RD+D  G+II+ +G ILAAG +A N   P  A + DC G +A PG+ID
Sbjct: 17  LVLSNARVIDPARDLDAPGSIIIADGTILAAGPEAANQGAPYGAELIDCKGAIACPGLID 76

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V++     E+ + + + S+ A AGGIT+I  MP      +D+   + +     R  + 
Sbjct: 77  MCVSVGEPGAEHRETLASASEAAAAGGITTICTMP-DTDPVIDDPALVDFIHRRARDTAS 135

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NV P A LT  + G E++E+ LL+E G V+F     S+ + Q+L   M YA   +A+V 
Sbjct: 136 VNVLPLAALTKGLAGVEMTEIGLLKEAGAVAFSNGHKSVQNPQILRRIMTYARDFDALVI 195

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L   GV+N G+ A++ GL G+P  +E + L RDL +   + G YHA++IS  +
Sbjct: 196 HHTEDPALAG-GVMNAGLNASWKGLSGVPREAEIIMLERDLRLVGMSKGKYHANLISTSE 254

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S  +I+  K      T GISIN+L  NEND+  Y +  K+ PPLR E +R +M+ A+  G
Sbjct: 255 SADIIRTGKGRGLNITAGISINHLTHNENDIGAYRTFFKMSPPLRDEDDRQAMIAAIADG 314

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDII S+H P+ ++TK  P+AEA  G+IGLET+L+A+LRL+H +Q+ LK L+ A++  P
Sbjct: 315 TIDIICSNHDPQDVETKRHPWAEAEDGAIGLETLLAASLRLYHAEQVDLKTLLAAMTYNP 374

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A    L  G L  G  AD+ + DL+  W ++   + S  KN+ F+   F+G+V+RT + G
Sbjct: 375 ADRLGLETGRLSKGAPADVTVFDLDRPWVLEKSAIRSRSKNSPFEDARFSGRVMRTVVGG 434

Query: 424 KQVY 427
           K V+
Sbjct: 435 KTVF 438


>gi|307946442|ref|ZP_07661777.1| dihydroorotase [Roseibium sp. TrichSKD4]
 gi|307770106|gb|EFO29332.1| dihydroorotase [Roseibium sp. TrichSKD4]
          Length = 433

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 172/424 (40%), Positives = 253/424 (59%), Gaps = 2/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            VL+N R+IDP+R +D  G++IV +G ILAAG +A N   P  A I DC G +A PG+ID
Sbjct: 9   LVLSNARVIDPARKLDAPGSVIVADGTILAAGPEAANQGAPYGADIIDCAGAIAAPGLID 68

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V++     E+ + + + S  A AGG+T+I  MP      +D+   + + L   R  + 
Sbjct: 69  MCVSVGEPGAEHRETLASASDAAAAGGVTTISTMPE-TDPVIDDPALVDFILRRARDTAA 127

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           INV+P A LT  ++G E++E+ LL+E G V+F     S+ + QV+   M YA   +A+V 
Sbjct: 128 INVHPLAALTKGLQGTEMTEIGLLKEAGAVAFTNGHKSVKNAQVMRRMMTYARDFDALVI 187

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  L   GV+N G+ A++ GL G+P  +E + L RDL +   +   YHA++IS   
Sbjct: 188 HHTEDPDLAG-GVMNAGLNASWKGLSGVPREAEIIMLERDLRLVGMSKSKYHANLISTSD 246

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S  +I+  K      T G+SIN+L  NEND+  Y +  K+ PPLR E +R +M+ AL  G
Sbjct: 247 SADVIRAGKKRGLNITAGVSINHLTHNENDIGAYRTFFKMSPPLRDEDDRQAMIAALADG 306

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            IDIIVS+H P+ ++TK  P+AEA  G+IGLETML+AALRL+H +QI L  L+ A++  P
Sbjct: 307 TIDIIVSNHDPQDVETKRHPWAEAEDGAIGLETMLAAALRLYHSEQIDLVTLLAAMTVNP 366

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A    L  G L  G  ADI + D +  W ++   + S  KN+ F+   F+G+V+RT + G
Sbjct: 367 ADRLGLDVGRLTQGAPADIVVFDPDKPWVLEKSAIKSRSKNSTFEDARFSGRVLRTVVGG 426

Query: 424 KQVY 427
           K V+
Sbjct: 427 KVVF 430


>gi|262277131|ref|ZP_06054924.1| dihydroorotase (DHOase) [alpha proteobacterium HIMB114]
 gi|262224234|gb|EEY74693.1| dihydroorotase (DHOase) [alpha proteobacterium HIMB114]
          Length = 427

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 166/424 (39%), Positives = 246/424 (58%), Gaps = 5/424 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIV-ENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARV 66
           N RIID   DIDE+G I++ E G + A G +           I+DC   +A+PG+ID RV
Sbjct: 7   NARIIDTKNDIDEIGGILIDEKGFVEAIGKEVTKNNV-GDVKIYDCANKIAIPGVIDGRV 65

Query: 67  TLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
              G P  EY +N  TLS+ A++GG+TS++ MP      +D+ +   +     R KSLI 
Sbjct: 66  -FAGEPGFEYKENYRTLSQAAISGGVTSVVTMP-NTDPVIDDVSTFDFIKRRARDKSLIK 123

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           ++  A LT N++G EI+E  LL+  G V F      +    V+     YA   NA++   
Sbjct: 124 IHSLASLTKNLDGNEITEFGLLKLSGAVGFTDGIKCVQCNNVMDKIFNYAKNQNALIVQM 183

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D+ L   GVINEG+IA  LGL GIP  +E V + RDL +       YH +++S  +S+
Sbjct: 184 PQDNELSKNGVINEGLIATKLGLKGIPDYAEHVLIERDLRLLSQYKSKYHIALLSSGKSL 243

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +I   K+ N   T G+SIN+L LNEND+  + +  K+ PPLR+E +R+ ++  ++ G I
Sbjct: 244 EIINEWKSKNIDFTTGVSINHLSLNENDIGEFRTFLKLSPPLRTEQDRLDLIRGVKNGTI 303

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           DIIVSDH P   ++K L F + + GS G+ET LS AL  +H   + LK +++A++  PA+
Sbjct: 304 DIIVSDHKPEDEESKRLTFQKCATGSSGIETFLSLALEQYHNGNLELKTIVKAITENPAK 363

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           IF +  G+L+ G  ADIA+IDL   W VK D M S  KNT  + +   GKV +T+++GK 
Sbjct: 364 IFGINAGSLEKGMPADIAVIDLEKPWVVKRDQMQSKSKNTAIEDKKLQGKVEKTFLNGKL 423

Query: 426 VYTL 429
           V+ +
Sbjct: 424 VFEI 427


>gi|158424474|ref|YP_001525766.1| dihydroorotase [Azorhizobium caulinodans ORS 571]
 gi|158331363|dbj|BAF88848.1| dihydroorotase multifunctional complex [Azorhizobium caulinodans
           ORS 571]
          Length = 431

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 163/424 (38%), Positives = 251/424 (59%), Gaps = 2/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N R+IDPSR  D  G +++ +G+I  A      A  P  A + DC G V  PG++D
Sbjct: 7   LLLANARVIDPSRGADFRGDVLLASGVIKDAAFGIAAAGVPDGAEVVDCKGAVVAPGLVD 66

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
            R  +     E+ + + + S  A AGG+T+I+  P      +D+   + + L   R  ++
Sbjct: 67  MRAFIGEPGAEHRETLASASHAAAAGGVTTIVCQP-DTDPVVDDPAIVDFILRRARDTAV 125

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + ++P A LT  ++G+E++E+ LLQ  G V+F     SI   Q L   + YA   +A++ 
Sbjct: 126 VRIHPMAALTKGLKGEEMTEIGLLQAAGAVAFTDGARSIASAQGLRRMLTYARDFDALIV 185

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             T D  + S G +NEG+ A+ LGL GIP  +ET+ L RDL +     G YHA+ I+  +
Sbjct: 186 HHTEDATM-SGGAMNEGLFASRLGLPGIPKAAETIVLERDLRLVDGVRGRYHAASITCRE 244

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ ++  AK      T  +SIN+L  NE DV  Y +  KV PPLR+E +R+++++AL  G
Sbjct: 245 SLEVLARAKEAGLAVTGSVSINHLSFNELDVGQYRTFFKVSPPLRAEDDRVALIQALSSG 304

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID++VSDH P+ ++ K LPF+EA  G+IGLET+LSAALRL H   + L  ++RALSTRP
Sbjct: 305 LIDVVVSDHNPQDVEMKRLPFSEAEPGAIGLETLLSAALRLVHAGDVDLVNVLRALSTRP 364

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++  L GGTL+ G+ AD+ ++D    W +   ++ S  +NT FD     G+V+RT ++G
Sbjct: 365 AELLGLKGGTLKAGSPADVIVLDPEMPWVLDPANLKSRSRNTPFDGARLQGRVLRTIVAG 424

Query: 424 KQVY 427
           + VY
Sbjct: 425 RTVY 428


>gi|154253275|ref|YP_001414099.1| multifunctional complex type dihydroorotase [Parvibaculum
           lavamentivorans DS-1]
 gi|154157225|gb|ABS64442.1| dihydroorotase, multifunctional complex type [Parvibaculum
           lavamentivorans DS-1]
          Length = 433

 Score =  312 bits (799), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 168/427 (39%), Positives = 248/427 (58%), Gaps = 6/427 (1%)

Query: 2   TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGI 61
           T+F+  N R+IDP+   D  G+++VE+G I   G    N   P  A I DC G V  PG+
Sbjct: 4   TAFI--NARLIDPASGYDSTGSLLVEDGRIADLGPQLFNDGLPEGAEIVDCNGRVLAPGL 61

Query: 62  IDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ID RV  TG P  E+ + +   S+ A AGG+T++I+MP      +D+   + +     R 
Sbjct: 62  IDCRV-FTGEPGAEHRETLALSSQAAAAGGVTTMIVMP-NTDPVIDDVALVDFIERRARA 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             ++NV+  A LT  + G++++E+ LL+  G V F     S+   Q++  ++ YA   NA
Sbjct: 120 TGVVNVHTMAALTKGLHGEQMTEIGLLRNAGAVGFTDGVKSVASAQLMRRALSYAAHFNA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     +  L + GV+NE  +A  LGL GIP+ISET+ + RDL + + TGG YH S +S
Sbjct: 180 LVVQHAEEPTLAT-GVMNESELAGRLGLAGIPAISETIVIERDLRLLETTGGRYHVSQVS 238

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S+ +I+ AK      TCG+S  +L LNENDV+ Y +  K+ PPLRSE +R ++V  L
Sbjct: 239 CEASVDIIRRAKTRGLPVTCGVSAAHLQLNENDVQSYRTFFKLSPPLRSEQDRKALVAGL 298

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID++VS H P+  + K  PFAEA+FG+IGLET+L A+L L H   + L +L+ AL+
Sbjct: 299 ADGTIDVVVSGHDPQDPEVKRRPFAEANFGAIGLETLLPASLALVHNGDLPLGRLLAALT 358

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             P+ +  L  G L TG  AD+ LID    W ++   + SI KNT F+   F G+ +RT 
Sbjct: 359 CIPSDLLGLGRGRLATGLPADLVLIDTEVPWRLEPAKLKSISKNTPFEDRLFQGRALRTM 418

Query: 421 ISGKQVY 427
           + G  VY
Sbjct: 419 VGGHTVY 425


>gi|170746906|ref|YP_001753166.1| dihydroorotase, multifunctional complex type [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653428|gb|ACB22483.1| dihydroorotase, multifunctional complex type [Methylobacterium
           radiotolerans JCM 2831]
          Length = 434

 Score =  303 bits (776), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 161/431 (37%), Positives = 258/431 (59%), Gaps = 4/431 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M+S++L N  ++DP+   +  GA++V +G I    A A       +  + DC G V  PG
Sbjct: 1   MSSYLLANANLLDPATGRETAGAVLVRDGRIADIAAGAAPGAPADAKRV-DCAGRVLTPG 59

Query: 61  IIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR 119
           +ID R    G P  E+ + + + S  A AGG+T+++ MP   +  +DE   + + L   R
Sbjct: 60  LIDMR-AFVGEPGAEHRETLASASAAAAAGGVTTLVCMP-DTNPVIDEPAIVDFVLRRAR 117

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
             + +NV P A +T  + G+E++E  LL+E G V+F     ++ + QVL  ++ YA   +
Sbjct: 118 DTASVNVLPAAAITKGLAGREMTEFGLLKEAGAVAFTDGLRAVANAQVLRRALTYARDFD 177

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
           A++     +  L + GV+NEG +A+ LGL+GIP  +ETV L RD+ + + TG  YHA++I
Sbjct: 178 ALIVQHVEESALVAEGVMNEGELASRLGLMGIPREAETVMLERDIRLVRLTGARYHAAMI 237

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           S   S+ +++ AK      TCG+S+NNL+LNEND+  Y +  ++ PPLR ET+R ++V A
Sbjct: 238 SCADSVEIVRRAKQDGLPVTCGVSVNNLVLNENDIGHYRTFCRLSPPLRHETDRQAVVGA 297

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           L +G ID++VSDH P+ ++TK LPFAEA+ G++G+ET+L AA+RL H   ++L KL+ AL
Sbjct: 298 LGEGVIDVVVSDHNPQDVETKRLPFAEAADGALGIETLLGAAMRLVHTGDLALPKLVAAL 357

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           +  PA+I     G L  G  AD+ LID +  + +    + S  KN+ FD+    G  V T
Sbjct: 358 TVNPARILGREAGRLAIGAPADLVLIDPDLPYVLDKRRLKSRSKNSPFDEARLQGAAVLT 417

Query: 420 YISGKQVYTLE 430
            + G+ V+ ++
Sbjct: 418 LVGGRIVHAVD 428


>gi|182680319|ref|YP_001834465.1| dihydroorotase, multifunctional complex type [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182636202|gb|ACB96976.1| dihydroorotase, multifunctional complex type [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 446

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 168/427 (39%), Positives = 245/427 (57%), Gaps = 7/427 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
             L N R++D +RD +  G ++V +G I A G D   A  P    + DC G V   G+ID
Sbjct: 13  LALVNARVVDGARDQEVRGGVLVLDGTIAAFGPDVTPAALPAGIPLVDCRGDVVTTGLID 72

Query: 64  ARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSF--LDEYTFIKYALEEIRV 120
            R    G P  EY + I + +  A  GG+T+++  P    +F  +DE   + + L   R 
Sbjct: 73  MR-AFVGEPGAEYRETIASATTAAAVGGVTTVLARP---DTFPPVDEAAVVDFLLRRARD 128

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
              + + PTA LT  ++G+EI+E+ LL + G ++F     S+ + QV+   + Y+   + 
Sbjct: 129 TGRVRLLPTAALTKGLKGEEIAEIGLLLQAGAIAFSNGRTSVRNAQVMRRLLAYSKDFDG 188

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++     D  L   GV+NEG  A+ LGL GIP  +E V L RD+ +   T   YHA++++
Sbjct: 189 LIIHYAEDADLVGDGVMNEGERASRLGLAGIPREAEAVMLDRDMRLVNLTRARYHAALVT 248

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S+ +I+ AKA     TC  SIN+L LNEND+  Y +  KV PPLR E ER+++VEAL
Sbjct: 249 TKLSVDIIRAAKAQGLPVTCATSINHLTLNENDIGDYRTFLKVAPPLRDEDERLALVEAL 308

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
            +G ID+IVSDH P+ ++TK LPFAEA +G++G+ETMLSA LRL     +SL +LIRALS
Sbjct: 309 AEGVIDVIVSDHDPQDVETKRLPFAEAEYGALGIETMLSAGLRLVTSGHLSLPRLIRALS 368

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           TRPA+I  L  G L+ G  AD+   D    + V    + S  +NT FD+    G+V  T 
Sbjct: 369 TRPAEILGLAQGRLEIGAPADLIRFDPEEPFIVDRKKLHSRSRNTPFDQARLEGRVKLTL 428

Query: 421 ISGKQVY 427
           + G+ VY
Sbjct: 429 VGGEIVY 435


>gi|218531568|ref|YP_002422384.1| dihydroorotase [Methylobacterium chloromethanicum CM4]
 gi|218523871|gb|ACK84456.1| dihydroorotase, multifunctional complex type [Methylobacterium
           chloromethanicum CM4]
          Length = 434

 Score =  299 bits (765), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 160/432 (37%), Positives = 252/432 (58%), Gaps = 12/432 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENG----IILAAGADALNAKFPTSALIHDCTGLV 56
           M++ VL+N  ++DP+   +  GA++V +G    I   A  DA     P  A   DC GL 
Sbjct: 1   MSALVLSNAHLLDPASGREGPGAVLVRDGRIADIAWGAAPDA-----PEGAQKIDCGGLT 55

Query: 57  AVPGIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYAL 115
             PG+ID R    G P  E+ + + + S  A AGG+T+++ MP   +  +D    + + L
Sbjct: 56  LAPGLIDLR-AFVGEPGAEHRETLASASAAAAAGGVTTLVCMP-DTNPVIDGPAIVDFVL 113

Query: 116 EEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYA 175
              R  + +NV P A +T  + G+E++E  LL E G V+F     ++ + QV+  ++ YA
Sbjct: 114 RRARDTASVNVLPAAAITKGLAGREMTEFGLLAEAGAVAFTDGLKAVTNAQVMRRALTYA 173

Query: 176 HMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYH 235
               A++     +  L   GV+NEG +A+ LGL+GIP  +ETV L RD+ + + TG  YH
Sbjct: 174 RDFGALLMQHVEEPDLVGEGVMNEGEMASRLGLIGIPREAETVMLERDIRLVRLTGARYH 233

Query: 236 ASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMS 295
           A++IS   S+ +++ AK      TCG+S+NNL+LNE D+  Y +  K+ PPLR E +R +
Sbjct: 234 AAMISCADSVEIVRRAKEAGLPVTCGVSVNNLVLNEGDIGHYRTFCKLSPPLRREDDRQA 293

Query: 296 MVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKL 355
           ++ AL +G ID+IVSDH P+ ++TK LPFAEA+ G++G+ET+L A+LRL H   ++L  L
Sbjct: 294 VIAALNEGVIDVIVSDHNPQDVETKRLPFAEAADGALGIETLLGASLRLLHTGDVTLGTL 353

Query: 356 IRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK 415
           ++ALS  PA++     G L+ G  AD+ LID +  + +    + S  KN+ FD+    G 
Sbjct: 354 LKALSANPAKLLGREAGRLEKGAPADLVLIDPDLPYLLDKRQLKSRSKNSPFDEARLQGA 413

Query: 416 VVRTYISGKQVY 427
            V T + G+ V+
Sbjct: 414 AVLTLVGGRIVH 425


>gi|23014542|ref|ZP_00054353.1| COG0044: Dihydroorotase and related cyclic amidohydrolases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 436

 Score =  297 bits (761), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 151/421 (35%), Positives = 233/421 (55%), Gaps = 1/421 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N R++DP+  +D  GA++     I   G        P+   + DC GL   PG++D RV 
Sbjct: 14  NARLLDPATGLDTRGALLTNGETIADVGPGLFQGGVPSGMEVVDCQGLCLAPGLVDMRVQ 73

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L    +E+ + + +  + AVAGG+TS++ +P   +  +DE   +++     R   L  VY
Sbjct: 74  LREPGEEHKETLKSAGEAAVAGGVTSMVCLP-NTNPVIDEVATVEFVARRARKIGLAKVY 132

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P A  T  +EGKE++EM +L E G + F     +I + QV+  ++ YA     ++     
Sbjct: 133 PYAAATKRVEGKELAEMGMLAEAGALGFTDGIRAIRNAQVMRRALTYAATFGLLIVQHPE 192

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           +  L   G++NEG +A  +GL GIP  +E + L RD+ + + TGG YHA+ I+  + + +
Sbjct: 193 EPSLAEGGMMNEGELATRMGLSGIPVAAEAIMLERDMRLVEITGGRYHAAHIATREGVEI 252

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I+ AKA     TC  +     LNE  V+ Y +  K+ PPLRSE +R+++VE L  G ID 
Sbjct: 253 IRKAKAKGLSVTCDTAPPYFALNELAVKDYRTFAKLSPPLRSEPDRLAVVEGLRDGTIDA 312

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           + SDH+P+  D+K +PFA A FG +GLET+L+  L L H   +SL + ++ ++  PA I 
Sbjct: 313 VASDHSPQDQDSKRVPFAVAEFGGVGLETLLAVTLDLAHNGHMSLIEALKLVTCAPASIL 372

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           NL  G L+ G AAD+ L D +  W V A    S  KN+ FD     G V+RT + G+ VY
Sbjct: 373 NLAAGRLKVGAAADLVLFDPDRGWKVNAKTFHSKSKNSPFDDRPVQGMVMRTIVDGRTVY 432

Query: 428 T 428
           T
Sbjct: 433 T 433


>gi|240140063|ref|YP_002964540.1| putative dihydroorotase-like protein [Methylobacterium extorquens
           AM1]
 gi|240010037|gb|ACS41263.1| putative dihydroorotase-like protein [Methylobacterium extorquens
           AM1]
          Length = 434

 Score =  297 bits (761), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 159/432 (36%), Positives = 251/432 (58%), Gaps = 12/432 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENG----IILAAGADALNAKFPTSALIHDCTGLV 56
           M++ VL+N  ++DP+   +  GA++V +G    I   A  DA     P +    DC GL 
Sbjct: 1   MSALVLSNAHLLDPAGGREGPGAVLVRDGRIADIAWGAAPDA-----PENCKTIDCVGLT 55

Query: 57  AVPGIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYAL 115
             PG+ID R    G P  E+ + + + S  A AGG+T+++ MP   +  +D    + + L
Sbjct: 56  LAPGLIDLR-AFVGEPGAEHRETLASASAAAAAGGVTTLVCMP-DTNPVIDGPAIVDFVL 113

Query: 116 EEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYA 175
              R  + +NV P A +T  + G+E++E  LL E G V+F     ++ + QV+  ++ YA
Sbjct: 114 RRARDTASVNVLPAAAITKGLAGREMTEFGLLAEAGAVAFTDGLKAVTNAQVMRRALTYA 173

Query: 176 HMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYH 235
               A++     +  L   GV+NEG +A+ LGL+GIP  +ETV L RD+ + + TG  YH
Sbjct: 174 RDFGALLMQHVEEPDLVGEGVMNEGEMASRLGLIGIPREAETVMLERDIRLVRLTGARYH 233

Query: 236 ASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMS 295
           A++IS   S+ +++ AK      TCG+S+NNL+LNE D+  Y +  K+ PPLR E +R +
Sbjct: 234 AAMISCADSVEIVRRAKEAGLPVTCGVSVNNLVLNEGDIGHYRTFCKLSPPLRREDDRQA 293

Query: 296 MVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKL 355
           ++ AL +G ID+IVSDH P+ ++TK LPFAEA+ G++G+ET+L A+LRL H   ++L  L
Sbjct: 294 VIAALNEGVIDVIVSDHNPQDVETKRLPFAEAADGALGIETLLGASLRLLHTGDVTLGTL 353

Query: 356 IRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK 415
           ++ALS  PA +     G L+ G  AD+ LID +  + +    + S  KN+ FD+    G 
Sbjct: 354 LKALSANPAALLGREAGRLEKGAPADLVLIDPDLPYLLDKRQLKSRSKNSPFDEARLQGA 413

Query: 416 VVRTYISGKQVY 427
            V T + G+ V+
Sbjct: 414 AVLTLVGGRVVH 425


>gi|254562488|ref|YP_003069583.1| dihydroorotase-like protein [Methylobacterium extorquens DM4]
 gi|254269766|emb|CAX25738.1| putative dihydroorotase-like protein [Methylobacterium extorquens
           DM4]
          Length = 434

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 159/432 (36%), Positives = 250/432 (57%), Gaps = 12/432 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENG----IILAAGADALNAKFPTSALIHDCTGLV 56
           M++ VL+N  ++DP+   +  GA++V +G    I   A  DA     P      DC GL 
Sbjct: 1   MSALVLSNAHLLDPTSGREGPGAVLVRDGRIADIAWGAAPDA-----PEDCKTIDCGGLT 55

Query: 57  AVPGIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYAL 115
             PG+ID R    G P  E+ + + + S  A AGG+T+++ MP   +  +D    + + L
Sbjct: 56  LAPGLIDLR-AFVGEPGAEHRETLASASAAAAAGGVTTLVCMP-DTNPVIDGPAIVDFVL 113

Query: 116 EEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYA 175
              R  + +NV P A +T  + G+E++E  LL E G V+F     ++ + QV+  ++ YA
Sbjct: 114 RRARDTASVNVLPAAAITKGLAGREMTEFGLLAEAGAVAFTDGLKAVTNAQVMRRALTYA 173

Query: 176 HMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYH 235
               A++     +  L   GV+NEG +A+ LGL+GIP  +ETV L RD+ + + TG  YH
Sbjct: 174 RDFGALLMQHVQEPDLVGEGVMNEGEMASRLGLIGIPREAETVMLERDIRLVRLTGARYH 233

Query: 236 ASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMS 295
           A++IS   S+ +++ AK      TCG+S+NNL+LNE D+  Y +  K+ PPLR E +R +
Sbjct: 234 AAMISCADSVEIVRRAKEAGLPVTCGVSVNNLVLNEGDIGHYRTFCKLSPPLRREDDRQA 293

Query: 296 MVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKL 355
           ++ AL +G ID+IVSDH P+ ++TK LPFAEA+ G++G+ET+L A+LRL H   ++L  L
Sbjct: 294 VIAALNEGVIDVIVSDHNPQDVETKRLPFAEAADGALGIETLLGASLRLLHTGDVTLGTL 353

Query: 356 IRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK 415
           ++ALS  PA +     G L+ G  AD+ LID +  + +    + S  KN+ FD+    G 
Sbjct: 354 LKALSANPATLLGREAGRLEKGAPADLVLIDPDLPYLLDKRQLKSRSKNSPFDEARLQGA 413

Query: 416 VVRTYISGKQVY 427
            V T + G+ V+
Sbjct: 414 AVLTLVGGRIVH 425


>gi|163852728|ref|YP_001640771.1| dihydroorotase, multifunctional complex type [Methylobacterium
           extorquens PA1]
 gi|163664333|gb|ABY31700.1| dihydroorotase, multifunctional complex type [Methylobacterium
           extorquens PA1]
          Length = 434

 Score =  296 bits (759), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 159/432 (36%), Positives = 252/432 (58%), Gaps = 12/432 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENG----IILAAGADALNAKFPTSALIHDCTGLV 56
           M++ VL+N  ++DP+   +  GA++V +G    I  +A  DA     P  A   DC GL 
Sbjct: 1   MSALVLSNAHLLDPASGREGPGAVLVRDGRIADIAWSATPDA-----PEGAQKIDCGGLT 55

Query: 57  AVPGIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYAL 115
             PG+ID R    G P  E+ + + + S  A AGG+T+++ MP   +  +D    + + L
Sbjct: 56  LAPGLIDLR-AFVGEPGAEHRETLASASAAAAAGGVTTLVCMP-DTNPVIDGPAIVDFVL 113

Query: 116 EEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYA 175
              R  + +NV P A +T  + G+E++E  LL E G V+F     ++ + QV+  ++ YA
Sbjct: 114 RRARDTASVNVLPAAAITKGLAGREMTEFGLLAEAGAVAFTDGLKAVTNAQVMRRALTYA 173

Query: 176 HMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYH 235
               A++     +  L   GV+NEG +A+ LGL+GIP  +ETV L RD+ + + TG  YH
Sbjct: 174 RDFGALLMQHVEEPDLVGEGVMNEGEMASRLGLIGIPREAETVMLERDIRLVRLTGARYH 233

Query: 236 ASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMS 295
           A++IS   S+ +++ AK      TCG+S+NNL+LNE D+  Y +  K+ PPLR E +R +
Sbjct: 234 AAMISCADSVEIVRRAKEAGLPVTCGVSVNNLVLNEGDIGHYRTFCKLSPPLRREDDRQA 293

Query: 296 MVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKL 355
           ++ AL +G ID+IVSDH P+ ++TK LPFAEA+ G++G+ET+L A+LRL H   ++L +L
Sbjct: 294 VIAALNEGVIDVIVSDHNPQDVETKRLPFAEAADGALGIETLLGASLRLLHTGDVTLGRL 353

Query: 356 IRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK 415
           ++ LS  PA +     G L+ G  AD+ LID +  + +    + S  KN+ FD+    G 
Sbjct: 354 LKVLSANPAALLGREAGRLEKGAPADLVLIDPDLPYLLDKRQLKSRSKNSPFDEARLQGA 413

Query: 416 VVRTYISGKQVY 427
            V T + G+ V+
Sbjct: 414 AVLTLVGGRIVH 425


>gi|91763195|ref|ZP_01265159.1| dihydroorotase [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717608|gb|EAS84259.1| dihydroorotase [Candidatus Pelagibacter ubique HTCC1002]
          Length = 428

 Score =  296 bits (758), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 163/424 (38%), Positives = 250/424 (58%), Gaps = 5/424 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIV-ENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARV 66
           N  IIDP   I+E G +I+ E+G I A G        P+   + D  G    PG++D RV
Sbjct: 8   NANIIDPYNSINEKGGLIIGEDGFIEAVGKKVNTNNIPSREKVIDLNGKYIFPGLVDMRV 67

Query: 67  TLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
              G P  EY +N  TLS  A+AGG+TS++ MP      +D  + + +     R KS IN
Sbjct: 68  -FAGEPGYEYKENFRTLSNAALAGGVTSVVTMP-NTDPIIDNVSIVDFLKRRGRDKSKIN 125

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V+P+A LT N+EG  ++E  LLQ +GI+ F     +I +T+++   M  A  L  ++   
Sbjct: 126 VFPSAALTKNIEGTSMTEFGLLQSRGIIGFTDGVKTIQNTRLMSRIMNSAKDLGTLIMQH 185

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D+ L   G+IN GIIA  LGL GIP+++E + + RDL + ++    YH S IS  +S+
Sbjct: 186 AEDYDLSKNGMINSGIIATKLGLSGIPAVAERIIIERDLTLLENIKCRYHISQISAAKSV 245

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +I+  K +  K T G+SINNL LNEND+  + +  K+ PPLR+E +R+++V+ L+   I
Sbjct: 246 EIIEERK-NKVKFTTGVSINNLSLNENDIGDFRTFLKLSPPLRTEEDRIALVQGLKDETI 304

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D+IVSDH P   + K L FA+AS G+ G+ET+LS +L L+H   + L+ +I+AL++ PA+
Sbjct: 305 DVIVSDHKPEDEEQKRLTFAQASTGASGIETLLSLSLELYHNGSVKLETIIKALTSNPAK 364

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I  +  G L  G  AD  ++D++  W VK D + S  KNT  + +   GKV  T++ G++
Sbjct: 365 ILKIDKGNLSVGNEADFCIVDIDKPWVVKKDKLVSKSKNTSIEDKKLQGKVTNTFVKGEE 424

Query: 426 VYTL 429
           ++ L
Sbjct: 425 LFKL 428


>gi|71083769|ref|YP_266489.1| dihydroorotase [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062882|gb|AAZ21885.1| dihydroorotase [Candidatus Pelagibacter ubique HTCC1062]
          Length = 428

 Score =  296 bits (757), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 163/424 (38%), Positives = 250/424 (58%), Gaps = 5/424 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIV-ENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARV 66
           N  IIDP   I+E G +I+ E+G I A G        P+   + D  G    PG++D RV
Sbjct: 8   NANIIDPYNSINEKGGLIIGEDGFIEAVGKKVNTNNIPSREKVIDLNGKYIFPGLVDMRV 67

Query: 67  TLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
              G P  EY +N  TLS  A+AGG+TS++ MP      +D  + + +     R KS IN
Sbjct: 68  -FAGEPGYEYKENFRTLSNAALAGGVTSVVTMP-NTDPIIDNVSIVDFLKRRGRDKSKIN 125

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V+P+A LT N+EG  ++E  LLQ +GI+ F     +I +T+++   M  A  L  ++   
Sbjct: 126 VFPSAALTKNIEGTTMTEFGLLQSRGIIGFTDGVKTIQNTRLMSRIMNSAKDLGTLIMQH 185

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D+ L   G+IN GIIA  LGL GIP+++E + + RDL + ++    YH S IS  +S+
Sbjct: 186 AEDYDLSKNGMINSGIIATKLGLSGIPAVAERIIIERDLTLLENIKCRYHISQISAAKSV 245

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +I+  K +  K T G+SINNL LNEND+  + +  K+ PPLR+E +R+++V+ L+   I
Sbjct: 246 EIIEERK-NKVKFTTGVSINNLSLNENDIGDFRTFLKLSPPLRTEEDRIALVQGLKDETI 304

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D+IVSDH P   + K L FA+AS G+ G+ET+LS +L L+H   + L+ +I+AL++ PA+
Sbjct: 305 DVIVSDHKPEDEEQKRLTFAQASTGASGIETLLSLSLELYHNGSVKLETIIKALTSNPAK 364

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I  +  G L  G  AD  ++D++  W VK D + S  KNT  + +   GKV  T++ G++
Sbjct: 365 ILKIDKGNLSVGNEADFCIVDIDKPWVVKKDKLVSKSKNTSIEDKKLQGKVTNTFVKGEE 424

Query: 426 VYTL 429
           ++ L
Sbjct: 425 LFKL 428


>gi|83312713|ref|YP_422977.1| dihydroorotase-like protein [Magnetospirillum magneticum AMB-1]
 gi|82947554|dbj|BAE52418.1| Dihydroorotase and related cyclic amidohydrolase [Magnetospirillum
           magneticum AMB-1]
          Length = 436

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 150/421 (35%), Positives = 231/421 (54%), Gaps = 1/421 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N R++DP+  +D  GA++     I   G        P+   + DC GL   PG++D RV 
Sbjct: 14  NARLLDPATGLDTRGALLTNGETIADVGPGLFQGGVPSGMEVVDCKGLCLAPGLVDMRVQ 73

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L    +E+ + + +  + AVAGG+TS++ +P   +  +DE   +++     R   L  VY
Sbjct: 74  LREPGEEHKETLKSAGEAAVAGGVTSMVCLP-NTNPVIDEVATVEFVARRARKIGLAKVY 132

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P A  T  +EGKE++EM +L E G + F     +I + QV+  ++ YA     ++     
Sbjct: 133 PYAAATKRVEGKELAEMGMLAEAGALGFTDGLKAIRNAQVMRRALTYAATFGLLIVQHPE 192

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           +  L   G++NEG +A  +GL GIP  +E + L RD+ + + T G YHA+ ++    + +
Sbjct: 193 EPSLAEGGMMNEGELATRMGLSGIPVAAEAIMLERDMRLVEITNGRYHAAHVATAAGVEI 252

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I+ AKA     TC  +     LNE  V+ Y +  K+ PPLRSET+R ++VE L+ G ID 
Sbjct: 253 IRKAKAKGLPVTCDTAPPYFALNELAVKDYRTFAKLSPPLRSETDRQAVVEGLKDGTIDA 312

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           + SDH+P+  D+K +PFA A FG +GLET+L   L L H   +SL + +R ++  P+ I 
Sbjct: 313 VASDHSPQDQDSKRVPFAVAEFGGVGLETLLPVTLDLAHNGHMSLIEALRLITCAPSAIL 372

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           NL  G L+ G AAD+ L D +  W V A    S  KN+ FD     G V+RT + G+ VY
Sbjct: 373 NLAAGRLKVGAAADLVLFDPDRGWKVNAKSFHSKSKNSPFDDRPVQGMVMRTIVDGRTVY 432

Query: 428 T 428
           T
Sbjct: 433 T 433


>gi|220923235|ref|YP_002498537.1| dihydroorotase, multifunctional complex type [Methylobacterium
           nodulans ORS 2060]
 gi|219947842|gb|ACL58234.1| dihydroorotase, multifunctional complex type [Methylobacterium
           nodulans ORS 2060]
          Length = 433

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 159/430 (36%), Positives = 253/430 (58%), Gaps = 6/430 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGII--LAAGADALNAKFPTSALIHDCTGLVAVPGI 61
            V+ N R++DP    D+VGA+++ +G I  L  GA   +   P  A I D  G V  PG+
Sbjct: 6   LVIANARLLDPVSGQDKVGALLIRDGRIADLQWGA---SPPAPEDAEIIDGGGHVLAPGL 62

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
            D R  +     E+ + + + S  A AGG+T+++ MP   +  +DE   + + L   R  
Sbjct: 63  TDLRAFVGEPGAEHRETLASASAAAAAGGVTTLVCMP-DTNPVIDEPAIVDFVLRRARDT 121

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           + ++V P A +T ++ G+E++E  LL E G V+F     ++ + QV+  ++ YA    A+
Sbjct: 122 ASVHVLPAAAITKHLAGREMTEFGLLSEAGAVAFTDGLRAVTNAQVMRRALTYARDFGAL 181

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           +     +  L   GV+NEG +A+ LGL GIP  +ET+ L RDL + + T   YHA++IS 
Sbjct: 182 LMQHVEEPDLVGDGVMNEGEMASRLGLHGIPREAETILLERDLRLVRLTRARYHAAMISC 241

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
             S+ +++ AK      TCG+SINNL+LNEND+  Y +  K+ PPLR+E +R ++V AL 
Sbjct: 242 ADSVEIVRRAKEAGLPVTCGVSINNLVLNENDIGHYRTFCKLSPPLRTEEDRKAVVAALN 301

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
           +G ID++VSDH P+ ++TK LPFAEA+ G++G+ET+L+A+LRL H   I+L +L+ ALS 
Sbjct: 302 EGVIDVVVSDHNPQDVETKRLPFAEAADGALGIETLLAASLRLVHAGDIALPRLLAALSA 361

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA++    GG L  G  AD+ L D +  + +    + S  KN+ FD+    G+ + T +
Sbjct: 362 EPARLLGREGGRLAKGAPADLVLFDPDEPYILDKRLLKSRSKNSPFDEARLQGRALLTLV 421

Query: 422 SGKQVYTLES 431
            G+  Y  E+
Sbjct: 422 GGRIAYRFEA 431


>gi|188582753|ref|YP_001926198.1| dihydroorotase, multifunctional complex type [Methylobacterium
           populi BJ001]
 gi|179346251|gb|ACB81663.1| dihydroorotase, multifunctional complex type [Methylobacterium
           populi BJ001]
          Length = 433

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 157/428 (36%), Positives = 253/428 (59%), Gaps = 8/428 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGII--LAAGADALNAKFPTSALIHDCTGLVAVPG 60
           + +L+N +++DP+   +  GA++V +G I  +A GA       P +    DC GL   PG
Sbjct: 2   NLLLSNAQLLDPATGREGPGAVLVRDGRIADVAFGA---APGAPENCERIDCGGLTLSPG 58

Query: 61  IIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR 119
           +ID R    G P  E+ + + + S  A AGG+T+++ MP   +  +D    + + L   R
Sbjct: 59  LIDLR-AFVGEPGAEHRETLASASAAAAAGGVTTLVCMP-DTNPVIDGPAIVDFVLRRAR 116

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
             + +NV P A +T  + G+E++E  LL E G V+F     ++ + QV+  ++ YA    
Sbjct: 117 DTASVNVLPAAAITKGLAGREMTEFGLLAEAGAVAFTDGLKAVTNAQVMRRALTYARDFG 176

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
           A++     +  L + GV+NEG +A+ LGL+GIP  +ET+ L RD+ + + TGG YHA++I
Sbjct: 177 ALLMQHVEEPDLVAEGVMNEGEMASRLGLIGIPREAETIMLERDIRLVRLTGGRYHAAMI 236

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           S   S+ +++ AK      TCG+S+NNL+LNE D+  Y +  K+ PPLR E +R +++ A
Sbjct: 237 STADSVEIVRRAKEAGLPVTCGVSVNNLVLNEGDIGHYRTFCKLSPPLRREDDRQAVIAA 296

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           L +G ID+IVSDH P+ ++TK LPFAEA+ G++G+ET+L A+LRL H   ++L  L++AL
Sbjct: 297 LNEGVIDVIVSDHNPQDVETKRLPFAEAADGALGIETLLGASLRLLHTGDVTLTTLLKAL 356

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           S  PA++     G L  G  AD+ LID +  + +    + S  KN+ FD+    G  V T
Sbjct: 357 SANPAKLLGREAGRLTAGAPADLVLIDPDLPYVLDKRQLKSRSKNSPFDEARLQGAAVLT 416

Query: 420 YISGKQVY 427
            + G+ V+
Sbjct: 417 LVEGRIVH 424


>gi|154247841|ref|YP_001418799.1| dihydroorotase [Xanthobacter autotrophicus Py2]
 gi|154161926|gb|ABS69142.1| dihydroorotase, multifunctional complex type [Xanthobacter
           autotrophicus Py2]
          Length = 438

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 158/425 (37%), Positives = 246/425 (57%), Gaps = 4/425 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N R+IDPSR  D  G + + +G+I  AG     +  P  A + DC G V  PG++D
Sbjct: 14  LLLANARVIDPSRGSDFHGDVYLADGVIKDAGFGIAASGVPDGAEVVDCKGAVVAPGLVD 73

Query: 64  ARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
                 G P  E+ + + + S  A AGG+T+II  P      +D+   + + L   R  +
Sbjct: 74  M-CAFVGEPGAEHRETLASASHAAAAGGVTTIICQPT-TDPVVDDPAIVDFILRRARDTA 131

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++ V+P A +T  ++G+E++E+ LLQ  G V+F     S+   QVL  ++ YA   +A++
Sbjct: 132 VVRVHPMAAITKGLKGEEMTEIGLLQAAGAVAFTDGHRSVASAQVLRRTLTYARDFDALL 191

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
              T D  + S+G +NEG  A  LGL G P  +ET+ L RD+ +     G YHA+ ++  
Sbjct: 192 VHHTEDASM-SQGAMNEGAFAARLGLSGNPKAAETIVLERDVRLVAGARGRYHAAALTCA 250

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S+A+++ AK      T   +IN+L  NE D+  Y +  ++ PPLR+E +R +++ A+  
Sbjct: 251 ESLAVLERAKEAGLPVTASATINHLSFNELDIGAYRTYFRLAPPLRAEEDRQALIRAIAS 310

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID++VSDH P+ ++ K LPF+EA  G+IGLET+LSAALRL H  Q+ L  L+ ALSTR
Sbjct: 311 GLIDVVVSDHLPQDVEGKRLPFSEAEPGAIGLETLLSAALRLVHSDQVDLVTLLAALSTR 370

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA I  L  GTL+ G  AD+ + D    + ++   + S  +NT FD+    G+V+RT ++
Sbjct: 371 PAAILGLDAGTLRPGAPADVTVFDPGMPYVLEPSMLKSRCRNTPFDEARLDGRVLRTIVA 430

Query: 423 GKQVY 427
           G  VY
Sbjct: 431 GATVY 435


>gi|254456622|ref|ZP_05070051.1| dihydroorotase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083624|gb|EDZ61050.1| dihydroorotase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 428

 Score =  292 bits (747), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 163/424 (38%), Positives = 251/424 (59%), Gaps = 5/424 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIV-ENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARV 66
           N  IIDP   I+E G +IV E+G I A G        PT     D  G   +PGI+D RV
Sbjct: 8   NGNIIDPHNSINENGGLIVSEDGKIEAVGKKVNVNNLPTREKPIDLKGKYLIPGIVDMRV 67

Query: 67  TLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
              G P  EY +N  TLS  A++GG+TS++ MP   +  +D  + + +     R KS IN
Sbjct: 68  -FVGEPGYEYKENFRTLSNAALSGGVTSVVTMP-NTNPIIDNVSIVDFLKRRGRDKSKIN 125

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           ++P A LT N+EG  ++E  LL ++GI++F     +I +T ++   M  A  L+ ++   
Sbjct: 126 IFPCASLTQNIEGTNMTEFGLLAKKGIIAFTDGVKTIQNTSLMSRIMNSAKDLDCLIMQH 185

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D+ L   G+IN GIIA  LGL GIP I+E + + RDL + +     YH S +S  +S+
Sbjct: 186 AEDYHLSKNGMINSGIIATKLGLSGIPDIAERIIIERDLTLLEKNKCRYHISQLSSAKSV 245

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +IK  K ++ K TCG+S+NNL LNEND+  + +  K+ PPLR E +R ++V+ L+   I
Sbjct: 246 EVIKERK-NDIKFTCGVSVNNLSLNENDIGDFKTFLKLSPPLRKEEDREALVQGLKDKTI 304

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D+IVSDH P   ++K L F++A+ G+ G+ET+LS +L L+H   + L+ +I+AL++ PA+
Sbjct: 305 DVIVSDHKPEDEESKRLTFSQAATGASGIETLLSLSLELYHNGSVKLETIIQALTSNPAK 364

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I  +  G L  G  AD  +IDL+  W VK +++ S  KNT  + +   GKV  T++ GK+
Sbjct: 365 ILRINKGNLTIGNDADFCIIDLDKPWIVKKENLISKSKNTSIEDKKLQGKVTNTFVKGKE 424

Query: 426 VYTL 429
           ++ +
Sbjct: 425 LFKI 428


>gi|323136480|ref|ZP_08071562.1| dihydroorotase, multifunctional complex type [Methylocystis sp.
           ATCC 49242]
 gi|322398554|gb|EFY01074.1| dihydroorotase, multifunctional complex type [Methylocystis sp.
           ATCC 49242]
          Length = 434

 Score =  285 bits (730), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 160/421 (38%), Positives = 236/421 (56%), Gaps = 4/421 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N R+IDP+   +  G ++  +G I   G        P  A + DC G V  PG+ID +  
Sbjct: 14  NARLIDPASGAETRGGLLARDGRIADLGPHLTRDTAPDGARVVDCGGEVIAPGLIDMQ-A 72

Query: 68  LTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
             G P  E+ + I + +  A AGG+T+++         +D+   + + L   R    + V
Sbjct: 73  FVGEPGAEHRETIASATMAAAAGGVTTLVATS-ATDPAVDDPAVVDFVLRRARDTGRVRV 131

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
            P A LT   EGKEI+E+ LLQ+ G V+F     S+ +  V+  +M YA   +A+V    
Sbjct: 132 LPMAALTKAREGKEIAELGLLQQAGAVAFYDGARSVKNALVMRRAMAYARDFDALVVHFA 191

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIA 246
            D  L   GV+NEG  A  LGL G+P  +E + L RDL +A  TG  YH+++++   S+ 
Sbjct: 192 QDADLAG-GVMNEGDFALRLGLSGVPREAEAIMLDRDLRLAALTGARYHSAIVTTTLSLD 250

Query: 247 LIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDID 306
            ++ AK      TCG SIN+L LNEND+  Y S  K+ PPLR E ER ++V AL +G +D
Sbjct: 251 ALRAAKDSGLTVTCGTSINHLTLNENDIGDYRSFLKLRPPLRHEEERKALVAALAEGLVD 310

Query: 307 IIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQI 366
           +IVSDH P+ ++TK LPFAEA +G+IG+ETML+A +RL H   ++L +L+ A+S+RPA+I
Sbjct: 311 VIVSDHDPQDVETKRLPFAEAEYGAIGVETMLAAGMRLVHSGDVTLPRLLAAMSSRPAEI 370

Query: 367 FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
             L  G LQ G  AD+   D +  + V    + S  +NT FD     G V  T + G+ V
Sbjct: 371 LGLEQGRLQKGAPADLIRFDPDAPFVVDPAKLHSRCRNTPFDGALLQGVVNMTVVDGEIV 430

Query: 427 Y 427
           +
Sbjct: 431 H 431


>gi|296445309|ref|ZP_06887268.1| dihydroorotase, multifunctional complex type [Methylosinus
           trichosporium OB3b]
 gi|296257264|gb|EFH04332.1| dihydroorotase, multifunctional complex type [Methylosinus
           trichosporium OB3b]
          Length = 431

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 162/425 (38%), Positives = 238/425 (56%), Gaps = 3/425 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L + R++DP+  ++  G ++V +G I   G     A  P  A I  C G V  PG++D
Sbjct: 7   LLLADARLVDPATGVESRGGVLVLDGRIADLGPSITAASAPEGAQIVACGGDVVAPGLVD 66

Query: 64  ARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
            +    G P  E+ + I + +  A AGG+T+I+  P G +  +D+   + + L   R   
Sbjct: 67  MQC-FVGEPGAEHRETIASATAAAAAGGVTTIVAAP-GTTPPVDDPAIVDFVLRRARDTG 124

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            + V P A LT   EG+EISE  LL++ G V+F     S+ + QV+  ++ YA    A+V
Sbjct: 125 RVRVLPMATLTKGREGREISEYGLLRQAGAVAFCDGKRSLRNAQVMRRALTYARDFEALV 184

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   GV+N G +A  LGL G+P  +E + + RDL +   TG  YHAS+++  
Sbjct: 185 IHFPEDRDLAGEGVMNAGELATRLGLSGVPREAEAIVVDRDLRLVALTGARYHASIVTAA 244

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S+  I  AK      TCG SIN+L LNEND+  Y +  K+ PPLR E ER ++V AL  
Sbjct: 245 LSLDAIAAAKERGLPVTCGTSINHLTLNENDIGDYRTFLKLRPPLRHEDERGALVAALAA 304

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G +D+IVSDH P+ ++TK LPFAEA  G++G+ETML+A LRL H   + L  L+RA+STR
Sbjct: 305 GLVDVIVSDHDPQDVETKRLPFAEAEAGAVGVETMLAAGLRLVHSGDVPLAGLLRAMSTR 364

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+I  L  G L  G  AD+   D +  + V   ++ S  KNT F      G+V  T ++
Sbjct: 365 PAEILGLEQGRLAKGAPADLIRFDPDEPFVVDPAELRSRCKNTPFATARLQGRVKLTIVA 424

Query: 423 GKQVY 427
           G+ V+
Sbjct: 425 GQAVF 429


>gi|170742469|ref|YP_001771124.1| dihydroorotase, multifunctional complex type [Methylobacterium sp.
           4-46]
 gi|168196743|gb|ACA18690.1| dihydroorotase, multifunctional complex type [Methylobacterium sp.
           4-46]
          Length = 430

 Score =  284 bits (726), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 158/422 (37%), Positives = 251/422 (59%), Gaps = 4/422 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + V+ N R++DP    +E GA+++ +G I      A+ A  P  A + D  G V  PG+ 
Sbjct: 2   TLVITNARLLDPVAGREEPGAVLIRDGRIADVQRGAVPAA-PEGAEVIDGGGHVLAPGLT 60

Query: 63  DARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           D R    G P  E+ + + + S  A AGG+T+++ MP   +  +DE   + + L   R  
Sbjct: 61  DLR-AFVGEPGAEHRETLASASAAAAAGGVTTLVCMP-DTNPVIDEPAIVDFVLRRARDT 118

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           + +NV P A +T ++ G+E++E  LL E G V+F     ++ + QV+  ++ YA    A+
Sbjct: 119 ASVNVLPAAAITKHLAGREMTEFGLLGEAGAVAFTDGLRAVTNAQVMRRALTYARDFGAL 178

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           +     +  L   GV+NEG +A+ LGL GIP  +ET+ L RDL + + T   YHA++IS 
Sbjct: 179 LMQHVEEPDLVGDGVMNEGEMASRLGLHGIPREAETILLERDLRLVRLTRARYHAAMISC 238

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
             S+ +++ AK      TCG+SINNL+LNEND+  Y +  K+ PPLR+E +R ++VEAL 
Sbjct: 239 ADSVEIVRRAKEAGLPVTCGVSINNLVLNENDIGHYRTFCKLSPPLRTEEDRRAVVEALN 298

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
           +G ID+IVSDH P+ ++TK LPFAEA+ G++G+ET+L+AALRL H   ++L +L+ AL+ 
Sbjct: 299 EGVIDVIVSDHNPQDVETKRLPFAEAADGALGIETLLAAALRLVHAGDVALPRLLAALAR 358

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA++    GG+L  G  AD+ L D +  + +    + S  KN+ FD+    G+ + T +
Sbjct: 359 EPARVLGRDGGSLAKGAPADLVLFDPDEPYRLDKRQLKSRSKNSPFDEARLQGRALLTLV 418

Query: 422 SG 423
            G
Sbjct: 419 GG 420


>gi|304391706|ref|ZP_07373648.1| dihydroorotase [Ahrensia sp. R2A130]
 gi|303295935|gb|EFL90293.1| dihydroorotase [Ahrensia sp. R2A130]
          Length = 434

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 150/423 (35%), Positives = 242/423 (57%), Gaps = 2/423 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N RI+DP   +D  G ++ E G I A G      +F     I DC G V  PG++DARV 
Sbjct: 13  NARIMDPETGLDIHGDVLAEKGKITAIGKGLSRDEFADGKGIVDCQGAVLAPGLVDARVF 72

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           +     E+ + I T  + A AGG+T++++MP      +D+ + + +       KS + + 
Sbjct: 73  IGEPGGEHRETIKTAGRAAAAGGVTTMVMMP-DTDPVIDDVSLVDFVRATASAKSPVRIL 131

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P A L+    G+ ++EM LL++ G V+F     +I ++Q++  ++ Y+  + A+V     
Sbjct: 132 PAAALSKGQNGEMMTEMGLLKDAGAVAFTDGRKTIANSQMMRRALTYSADIGALVMASHR 191

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  LGS GV+N GI A  +GL GIP  +E +PL RD+ +   TG  YHAS +S  +S+ +
Sbjct: 192 DPHLGS-GVMNAGINATRMGLSGIPREAEIIPLERDMRLVAMTGAKYHASCLSTAESVEV 250

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           +  AK      T G+++ NL L+E D+  Y +  KV PPLRS  +R++MVE +  G +D+
Sbjct: 251 LARAKDAGRDVTGGVAVANLCLSELDIGPYRTFFKVSPPLRSVDDRLAMVEGIRSGALDM 310

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           IVS+H P+ +DTK LPF+EA+ G++GLE++L+AALRL H   I L ++++ LS  PA+  
Sbjct: 311 IVSNHDPQDVDTKRLPFSEAADGAVGLESLLAAALRLHHSDDIPLMRVLKCLSLAPARRL 370

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
               G +  G  AD  + D +  W +    + S  +NT F      G+V++T ++G+ V+
Sbjct: 371 GRKCGRITKGARADFVIFDPDAPWKLDDTKLRSRSRNTPFQDALLQGRVLKTVVAGRTVF 430

Query: 428 TLE 430
           + E
Sbjct: 431 SQE 433


>gi|254699837|ref|ZP_05161665.1| dihydroorotase [Brucella suis bv. 5 str. 513]
          Length = 285

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 132/283 (46%), Positives = 193/283 (68%)

Query: 146 LLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANY 205
           LL+  G V+F +   +I +TQ++  ++ YA   NA++A +T D FLG+ GV+NEG+ A++
Sbjct: 2   LLRAAGAVAFTEGRNTIANTQIMRRALTYARDFNAVIACETRDPFLGANGVMNEGLFASW 61

Query: 206 LGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISIN 265
           LGL G P  +E +PL RDL +A  T   YHA+ +S   S   ++ AK   T  T G+SIN
Sbjct: 62  LGLSGTPREAEVIPLERDLRLAALTRSRYHAAQLSCAMSADAMRRAKDLGTNVTAGVSIN 121

Query: 266 NLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFA 325
           +L LNEND+  + +  ++ PPLR E +R++MVEA++ G IDI+VS H P+ +DTK LPF+
Sbjct: 122 HLSLNENDIGEFRTFFRLSPPLRGEEDRLAMVEAVKNGTIDIVVSAHDPQDVDTKRLPFS 181

Query: 326 EASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALI 385
           +A  G+IGLET+L+AALRL+H   I L +L+  LST PA+IF L  GTL+ G +ADIA++
Sbjct: 182 DAEAGAIGLETLLAAALRLYHNDNIPLLRLVEVLSTAPAKIFGLNAGTLKPGASADIAIV 241

Query: 386 DLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYT 428
           DL   W V+ +D+ S  KN+ F+   F G+VVRT ++GK VY+
Sbjct: 242 DLEEPWVVREEDLHSRSKNSCFESARFQGRVVRTIVAGKTVYS 284


>gi|144898212|emb|CAM75076.1| Dihydroorotase multifunctional complex type [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 434

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 148/420 (35%), Positives = 223/420 (53%), Gaps = 1/420 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N R++DP+  +D  GA++++   I   G        P+   + DC GL   PG++D RV 
Sbjct: 14  NARLLDPATGLDAKGALLIQGETIADVGPGLFQGGVPSGIEVVDCQGLCLAPGLVDMRVQ 73

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           +    +E+ + + +  + AVAGG+TS++ +P      +DE   +++     R   L  +Y
Sbjct: 74  VREPGEEHKETLKSAGEAAVAGGVTSMVCLP-NTDPIMDEVATVEFVARRARKNGLAKIY 132

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P A  T  +EGKE+SEM  L+E G ++F     +I D Q +  ++ YA   +A++     
Sbjct: 133 PYAAATKKLEGKELSEMGFLKEAGALAFTDGIKAIADAQTMRRALSYAATFDALIVQHPE 192

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   GV+N G  A  +GL GIP  +E + L RD+ +   TGG YHA+ +S  + I +
Sbjct: 193 DPSLAGSGVMNAGERATRMGLSGIPVEAEIIMLERDMRLVAMTGGRYHAAHVSTAEGIDV 252

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I+ AKA     TC  +     LNE +V  Y +  K+ PPLRSE +R +++  L  G ID 
Sbjct: 253 IRRAKAKGLPVTCDTAPPYFALNELEVHNYRTFAKLSPPLRSEADRQAVIAGLADGTIDA 312

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I SDH P+  D K   FA A FG IGLET+L+A + L     ++L   +  L+  PA I 
Sbjct: 313 IASDHAPQDEDAKRQTFAAAEFGGIGLETLLAATIGLVQTGALALLPALGLLTCGPADIL 372

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L+ G AAD+ L D +  W V      S  KN+ FD     G V+RT + G+ V+
Sbjct: 373 ALPAGRLKMGAAADLVLFDPDRGWQVDPVKFKSKSKNSPFDGRPMQGVVLRTVVDGRTVH 432


>gi|330814162|ref|YP_004358401.1| dihydroorotase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487257|gb|AEA81662.1| dihydroorotase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 428

 Score =  280 bits (715), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 153/422 (36%), Positives = 247/422 (58%), Gaps = 3/422 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           NTRI+DP  +IDE+G I++ +   + A    +  +  ++A I+DC   V++PGIID RV 
Sbjct: 8   NTRILDPRNNIDEIGGILINDSGKIEAIGKKVTKENVSNAEIYDCKNKVSIPGIIDMRV- 66

Query: 68  LTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
             G P  EY +N  TLS+ AV+GG+T +  MP  +   +D  + + +     R KS+I +
Sbjct: 67  FVGEPGFEYKENFRTLSQAAVSGGVTGVATMPNTLP-LIDNVSTLDFVKRRSRDKSIIKI 125

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
           +P A LT   +G +++E  LL+ +G   F     SI   +V+     Y    + ++    
Sbjct: 126 FPMATLTKGAKGLDMTEFGLLKLRGAWGFTDGTQSIQSNKVMDQIFNYGKNTDILIIQFA 185

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIA 246
            D+ L   G+IN+ + A  LGL  IP  +E + + RDL + ++    YH ++IS  +S+ 
Sbjct: 186 QDNELSENGMINDSLQATKLGLKSIPESAEQLIIERDLRLLENYNTKYHIALISSKKSLE 245

Query: 247 LIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDID 306
           +IK+AK    K T G+SINNL LNEND+  + +  K+ PPLRSE +R+++++ +++G I+
Sbjct: 246 IIKNAKDRGLKFTVGVSINNLSLNENDIGDFKTFLKLSPPLRSEEDRLALIDGVKQGLIN 305

Query: 307 IIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQI 366
           +IVSDH P   ++K L F +A+ G+ G+E++LS  L L H     L  LI+ L++ PA+I
Sbjct: 306 VIVSDHKPEDEESKRLTFQQATTGASGIESLLSLGLELVHNGSCDLNTLIKNLTSNPAKI 365

Query: 367 FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
             +  GTL  G+ ADIA+ DLN  W  K +++ S  KNT  +     GKV +T+I+G   
Sbjct: 366 LGIRNGTLSVGSEADIAVFDLNKPWVFKKENIKSKSKNTAIEDRKLQGKVEKTFINGDLA 425

Query: 427 YT 428
           ++
Sbjct: 426 FS 427


>gi|217979946|ref|YP_002364093.1| dihydroorotase, multifunctional complex type [Methylocella
           silvestris BL2]
 gi|217505322|gb|ACK52731.1| dihydroorotase, multifunctional complex type [Methylocella
           silvestris BL2]
          Length = 439

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 161/428 (37%), Positives = 237/428 (55%), Gaps = 3/428 (0%)

Query: 4   FVLNNTRIIDPSRDIDEV-GAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
             L N R++D  +  D V G I++ +G IL  G +      P  + + DC G    PG+I
Sbjct: 14  LALVNGRLVD-GQTYDCVRGGILILDGKILDLGPEVAPKNLPVHSRVIDCGGDFIAPGLI 72

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D R    G P    +     +  A A G  + IL     +  +DE   + + L   R   
Sbjct: 73  DMR-AFVGEPGGEHRETIATATAAAAAGGVTTILARPDTNPPVDEPAVVDFLLRRARDTG 131

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            + + P A +T  + G+EI+E+ LLQ+ G ++F     SI +++VL   + YA   +A++
Sbjct: 132 RVRLIPCAAMTQGLRGEEIAEIGLLQQAGALAFSDGAHSIANSRVLRRVLSYARDFDALI 191

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L + GV+NEG  A  LGL GIP  +E + L RD+ +   TG  YHA++++  
Sbjct: 192 IHYAEDRDLAAEGVMNEGEFATRLGLSGIPREAEAIALDRDIRLVNLTGARYHAALVTTT 251

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S+ +I+ AKA     T G SIN+L LNE+D+  Y +  K+ PPLR E ER ++VEAL  
Sbjct: 252 LSLDIIERAKAAGLPVTAGTSINHLTLNESDIGDYRTFLKLAPPLRREDERRALVEALSS 311

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID+IVSDH P+ ++TK LPFAEA  G+IGLETML+A LRL    ++SL++LI A++ R
Sbjct: 312 GLIDVIVSDHNPQDVETKRLPFAEAENGAIGLETMLAAGLRLVASGEVSLQRLIGAMTLR 371

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+I  LP G L+ G  AD+   D    + V    + S  KNT FD+    G+V  T + 
Sbjct: 372 PAEILGLPQGRLRVGAPADVIRFDAEAAYVVDPSKLRSRSKNTPFDEATMEGRVKLTLVE 431

Query: 423 GKQVYTLE 430
           G+ V+  E
Sbjct: 432 GRIVFEEE 439


>gi|73667255|ref|YP_303271.1| dihydroorotase [Ehrlichia canis str. Jake]
 gi|123614808|sp|Q3YRI2|PYRC_EHRCJ RecName: Full=Dihydroorotase; Short=DHOase
 gi|72394396|gb|AAZ68673.1| dihydroorotase [Ehrlichia canis str. Jake]
          Length = 447

 Score =  272 bits (695), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 156/426 (36%), Positives = 240/426 (56%), Gaps = 11/426 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTS-ALIHDCTGLVAVPGIIDARV 66
           N RIIDP   +D +G+++ +   I+  G D  N   P++   + DC   + +PG+ID  V
Sbjct: 23  NARIIDPESKLDIIGSLLTKGDKIVDFGQDLFNNGIPSTIDEVVDCNNNILMPGLIDIHV 82

Query: 67  TLTGSPDEYSKNITTLSKEAVAGGITSIILMP---LGMSSFLDEYTFIKYALEEIRVKSL 123
                  E+ + I T SK A AGG+T+++  P     +SS +        ALE     + 
Sbjct: 83  HFREPGQEHKETIHTGSKSAAAGGVTTVVCQPNTIPTISSIITAKYIKMRALES----AY 138

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +N+   A +T       +S+M LL+E G V F    M + ++  +  ++ Y+ ML+ +VA
Sbjct: 139 VNIEFYASITK--PDNSLSDMALLKEAGAVGFTDDGMPVMNSLTMRQALSYSSMLDTVVA 196

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIP 242
               D  L + G INEG ++  LGL GIP ISE++ + RD+ + ++    HYH   +S  
Sbjct: 197 QHAEDLNLSNNGHINEGTVSYELGLKGIPDISESIIVNRDIALMKNIKNVHYHILHVSSQ 256

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S+ +IK AK    K TC ++ ++L L E DV  + +L K+ PPLR+E +R+SMVE L+ 
Sbjct: 257 DSLNIIKQAKNQGLKVTCEVTPHHLTLTEQDVITHGTLAKINPPLRTENDRLSMVEGLKN 316

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID I +DH P  ++TK LP   A+FG +GLETML  +L L+H   ISL  L+  L+ +
Sbjct: 317 GIIDCIATDHAPHEVNTKELPLDTAAFGIVGLETMLPISLELYHNGTISLIDLLATLTYK 376

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA I  +P G ++ G  AD+ ++DLN++WT+     +S  KN+ F      GKV+RT +S
Sbjct: 377 PANIIKVPRGRIKKGFVADLIILDLNHEWTIDILKFASKSKNSPFHNRKVKGKVLRTIVS 436

Query: 423 GKQVYT 428
           GK  YT
Sbjct: 437 GKTTYT 442


>gi|225677044|ref|ZP_03788053.1| dihydroorotase [Wolbachia endosymbiont of Muscidifurax uniraptor]
 gi|225590920|gb|EEH12138.1| dihydroorotase [Wolbachia endosymbiont of Muscidifurax uniraptor]
          Length = 441

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 159/427 (37%), Positives = 244/427 (57%), Gaps = 10/427 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH--DCTGLVAVPGIIDAR 65
           N RIIDP   +D  G+++ E   I+  G     + F TS +    DC GLV +PG+ID  
Sbjct: 22  NARIIDPETKLDIKGSLLTEGDKIVDFG----ESLFSTSGVDETIDCKGLVLMPGLIDIH 77

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V       E+ + I T SK A AGG+T+++  P  + + +D     KY        S +N
Sbjct: 78  VHFREPGQEHKETIYTGSKSAAAGGVTTVVCQPNTVPA-IDSVILAKYLKYRALETSHVN 136

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V   A +T++ E  +++EM LL+E G V F    M + +  ++  ++ Y+ MLN  +A  
Sbjct: 137 VEFYAKITTSEE--KLTEMALLKEAGAVGFTDDGMPVMNPMIMRQALLYSSMLNVPIAQH 194

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIPQS 244
             D  L + G INEG I+  LG+ GI S SE+V + RD+L+ +     HYH   +S   S
Sbjct: 195 AEDLNLSAGGAINEGKISEELGVKGILSASESVMVNRDILLMKDMENVHYHILHVSSKDS 254

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           +  IK AK      TC ++ ++  L E+ V+ + ++ K+ PPLR+E +R++MVE L+ G 
Sbjct: 255 LDAIKRAKDLGLNVTCEVTPHHFTLTEDIVKQHGAIAKMNPPLRTEEDRLAMVEGLKTGV 314

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I +DH P    +K LP   A+FG +GLETML  +L L+H  Q+SL  ++  L+ +PA
Sbjct: 315 IDCIATDHAPHDRSSKDLPLENAAFGIVGLETMLPLSLELYHSGQMSLLDVLAKLTYKPA 374

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            I ++P G +Q   AAD+ L+DLN++W +K D+ +S  KN+ FD     G VVRT +SGK
Sbjct: 375 DITHIPRGRIQKNLAADLILVDLNHEWEIKTDNFASKSKNSPFDGRKVKGHVVRTVVSGK 434

Query: 425 QVYTLES 431
            +Y+ +S
Sbjct: 435 TIYSQKS 441


>gi|83594521|ref|YP_428273.1| dihydroorotase [Rhodospirillum rubrum ATCC 11170]
 gi|83577435|gb|ABC23986.1| dihydroorotase [Rhodospirillum rubrum ATCC 11170]
          Length = 432

 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 147/420 (35%), Positives = 235/420 (55%), Gaps = 4/420 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N R++DP+  +D+ GA++ +   I+     A  A  P  A I DC G    PG++D RV 
Sbjct: 13  NARLLDPASGLDQTGALLADGEHIVEVHPGAFTA--PEDAEIIDCQGACLAPGLVDMRVQ 70

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L    +E+ +++ +  + AVAGGITS++ +P       DE T +++     R+  L  VY
Sbjct: 71  LREPGEEHKESMRSAGQAAVAGGITSMVCLPNTNPPMDDEAT-LEFVARRARLAGLAKVY 129

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
                T  + G++++E+ ++ E G ++F     +I + Q++   + YA   + +V     
Sbjct: 130 CYGACTKGLRGEDLAELGIMAEAGALAFTDGVKAIANAQMMRRVLAYAATFDLLVMQHPE 189

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           +  L   GV+N G +A  +GL GIP  +E + L RDL +   TGG YHA+ IS  +S+AL
Sbjct: 190 EPTLAG-GVMNAGDLATRMGLSGIPREAEIILLERDLRLVAMTGGRYHAAHISTGESVAL 248

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I+ AK    + +C  +     LNE  V  Y +  K+ PPLR E++R +++E L+ G ID 
Sbjct: 249 IRRAKDQGLRVSCDTAPFYFALNELAVGDYRTFAKLSPPLRGESDRRAIIEGLKDGVIDA 308

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I SDH+P+  DTK LPFA+A+FG++GLET+LS +L L H   +SL ++++ L+  PA + 
Sbjct: 309 IASDHSPQDQDTKRLPFAQAAFGAVGLETLLSISLELHHNGHLSLLEVLKRLTVAPAGLL 368

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            L  G L+ G  AD+ + D      V A    S  KN+ FD     G+V+RT + G+ V+
Sbjct: 369 GLDAGRLRPGGKADLLVFDPYRAGKVDATRFLSKSKNSPFDDRPVQGRVLRTVVDGRTVF 428


>gi|42520125|ref|NP_966040.1| dihydroorotase [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|42409862|gb|AAS13974.1| dihydroorotase [Wolbachia endosymbiont of Drosophila melanogaster]
          Length = 459

 Score =  269 bits (688), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 158/427 (37%), Positives = 242/427 (56%), Gaps = 10/427 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH--DCTGLVAVPGIIDAR 65
           N RIIDP   +D  G+++ E   I+  G     + F TS +    DC GLV +PG+ID  
Sbjct: 40  NARIIDPETKLDIKGSLLTEGDKIVDFG----ESLFSTSGVDETIDCKGLVLMPGLIDIH 95

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V       E+ + I T SK A AGG+T+++  P  + + +D     KY        S +N
Sbjct: 96  VHFREPGQEHKETIYTGSKSAAAGGVTTVVCQPNTVPA-IDSVILAKYLKYRALETSHVN 154

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V   A +T++ E   ++EM LL+E G V F    M + +  ++  ++ Y+ MLN  +A  
Sbjct: 155 VEFYAKITTSEE--HLTEMALLKEAGAVGFTDDGMPVMNPMIMRQALLYSSMLNVPIAQH 212

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIPQS 244
             D  L + G INEG I+  LG+ GI S SE+V + RD+L+ +     HYH   +S   S
Sbjct: 213 AEDLNLSAGGAINEGKISEELGVKGILSASESVMVNRDILLMKDMENVHYHILHVSSKDS 272

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           +  IK AK      TC ++ ++  L E+ V+ + ++ K+ PPLR+E +R++MVE L+ G 
Sbjct: 273 LDAIKRAKDLGLNVTCEVTPHHFTLTEDIVKQHGAIAKMNPPLRTEEDRLAMVEGLKTGV 332

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I +DH P    +K LP   A+FG +GLETML  +L L+H  Q+ L  ++  L+ +PA
Sbjct: 333 IDCIATDHAPHDRSSKDLPLENAAFGIVGLETMLPLSLELYHSGQMGLLDVLAKLTYKPA 392

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            I ++P G +Q   AAD+ L+DLN++W +K D+ +S  KN+ FD     G VVRT +SGK
Sbjct: 393 DIIHIPRGRIQKNLAADLILVDLNHEWEIKTDNFASKSKNSPFDGRKVKGHVVRTVVSGK 452

Query: 425 QVYTLES 431
            +Y+ +S
Sbjct: 453 TIYSQKS 459


>gi|99034628|ref|ZP_01314581.1| hypothetical protein Wendoof_01000603 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 458

 Score =  269 bits (687), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 158/427 (37%), Positives = 242/427 (56%), Gaps = 10/427 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH--DCTGLVAVPGIIDAR 65
           N RIIDP   +D  G+++ E   I+  G     + F TS +    DC GLV +PG+ID  
Sbjct: 39  NARIIDPETKLDIKGSLLTEGDKIVDFG----ESLFSTSGVDETIDCKGLVLMPGLIDIH 94

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V       E+ + I T SK A AGG+T+++  P  + + +D     KY        S +N
Sbjct: 95  VHFREPGQEHKETIYTGSKSAAAGGVTTVVCQPNTVPA-IDSVILAKYLKYRALETSHVN 153

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V   A +T++ E   ++EM LL+E G V F    M + +  ++  ++ Y+ MLN  +A  
Sbjct: 154 VEFYAKITTSEE--HLTEMALLKEAGAVGFTDDGMPVMNPMIMRQALLYSSMLNVPIAQH 211

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIPQS 244
             D  L + G INEG I+  LG+ GI S SE+V + RD+L+ +     HYH   +S   S
Sbjct: 212 AEDLNLSAGGAINEGKISEELGVKGILSASESVMVNRDILLMKDMENVHYHILHVSSKDS 271

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           +  IK AK      TC ++ ++  L E+ V+ + ++ K+ PPLR+E +R++MVE L+ G 
Sbjct: 272 LDAIKRAKDLGLNVTCEVTPHHFTLTEDIVKQHGAIAKMNPPLRTEEDRLAMVEGLKTGV 331

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I +DH P    +K LP   A+FG +GLETML  +L L+H  Q+ L  ++  L+ +PA
Sbjct: 332 IDCIATDHAPHDRSSKDLPLENAAFGIVGLETMLPLSLELYHSGQMGLLDVLAKLTYKPA 391

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            I ++P G +Q   AAD+ L+DLN++W +K D+ +S  KN+ FD     G VVRT +SGK
Sbjct: 392 DIIHIPRGRIQKNLAADLILVDLNHEWEIKTDNFASKSKNSPFDGRKVKGHVVRTVVSGK 451

Query: 425 QVYTLES 431
            +Y+ +S
Sbjct: 452 TIYSQKS 458


>gi|95929149|ref|ZP_01311893.1| dihydroorotase, multifunctional complex type [Desulfuromonas
           acetoxidans DSM 684]
 gi|95134647|gb|EAT16302.1| dihydroorotase, multifunctional complex type [Desulfuromonas
           acetoxidans DSM 684]
          Length = 426

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 153/427 (35%), Positives = 228/427 (53%), Gaps = 4/427 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V+ N  +IDPS+D+D    +IVE+G I+  G    N     +  + D  GL+  PG+ID 
Sbjct: 4   VIKNGHVIDPSQDLDGRFDLIVEDGCIVELGE---NLPAEDADEVIDADGLLVTPGLIDI 60

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V L     EY ++I + ++ A AGG TS+  MP       D      Y + + +++   
Sbjct: 61  HVHLRDPGFEYKEDIVSGTRSAAAGGFTSVACMP-NTKPVNDNKATTLYMINKAQLEGFA 119

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           NV+P   +T   +G  + EM  L++ G V F    +++    VL  +M+YA   +  +  
Sbjct: 120 NVFPICTITKGQKGTALVEMGDLKQAGCVGFSDDGLNVESGDVLRRAMEYASGFDMPIIA 179

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D  +   GV+NEG +A  LGL G P ++E   +ARDL++A+ TG   H   IS  ++
Sbjct: 180 HAEDEGIKCGGVMNEGRVATELGLAGNPWVAEASTVARDLMLAELTGARLHVCHISTRRT 239

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + LI+ AKA   K TC ++ ++  L E  V  Y+   K+ PPLR+  +  +M E L  G 
Sbjct: 240 VELIREAKARGVKVTCEVTPHHFTLTEEAVRGYDVNAKMGPPLRTADDVKAMKEGLADGT 299

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I +DH P H+D K + F  A+ G +GLET L  AL L     ++L + I  L+TRPA
Sbjct: 300 IDAIATDHAPHHVDDKNVEFNVAANGLVGLETALPLALNLVKEGVLTLNQAICCLTTRPA 359

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            +  +P GTL  GTAADI LID +YQWT+ A  M +  +NT FD    TG  + T  +GK
Sbjct: 360 SVMRIPRGTLAKGTAADITLIDPDYQWTLDATQMKTKARNTPFDGWELTGAAMMTMCAGK 419

Query: 425 QVYTLES 431
             +   S
Sbjct: 420 ITFQRNS 426


>gi|225630050|ref|YP_002726841.1| dihydroorotase [Wolbachia sp. wRi]
 gi|254788868|sp|C0R5K8|PYRC_WOLWR RecName: Full=Dihydroorotase; Short=DHOase
 gi|225592031|gb|ACN95050.1| dihydroorotase [Wolbachia sp. wRi]
          Length = 441

 Score =  266 bits (680), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 157/427 (36%), Positives = 241/427 (56%), Gaps = 10/427 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH--DCTGLVAVPGIIDAR 65
           N RIIDP   +D  G+++ E   I+  G     + F TS +    DC GLV +PG+ID  
Sbjct: 22  NARIIDPETKLDIKGSLLTEGDKIVDFG----ESLFSTSGVDETIDCKGLVLMPGLIDIH 77

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V       E+ + I T SK A AGG+T+++  P  + + +D     KY        S +N
Sbjct: 78  VHFREPGQEHKETIYTGSKSAAAGGVTTVVCQPNTIPA-IDSVVLAKYLKYRALETSHVN 136

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V   A +T+  E  +++EM LL+E G V F    M + +  ++  ++ Y+ ML   +A  
Sbjct: 137 VEFYAKITTLEE--KLTEMALLKEAGAVGFTDDGMPVMNPMIMRQALLYSSMLGVPIAQH 194

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIPQS 244
             D  L + G INEG I+  LG+ GI S SE+V + RD+L+ +     HYH   +S   S
Sbjct: 195 AEDLNLSAGGAINEGKISEELGVKGILSASESVMVNRDILLMKDMENVHYHILHVSSKDS 254

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           +  IK AK      TC ++ ++  L E+ V+ + ++ K+ PPLR+E +R++MVE L+ G 
Sbjct: 255 LDAIKRAKDLGLNVTCEVTPHHFTLTEDIVKQHGAIAKMNPPLRTEEDRLAMVEGLKTGV 314

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I +DH P    +K LP   A+FG +GLETML  +L L+H  Q+ L  ++  L+ +PA
Sbjct: 315 IDCIATDHAPHDRSSKDLPLENAAFGIVGLETMLPLSLELYHSGQMGLLDVLAKLTYKPA 374

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            I ++P G +Q   AAD+ L+DLN++W +K D+ +S  KN+ FD     G VVRT +SGK
Sbjct: 375 DIIHIPRGRIQKNLAADLILVDLNHEWEIKTDNFASKSKNSPFDGRKVKGHVVRTVVSGK 434

Query: 425 QVYTLES 431
            +Y+ +S
Sbjct: 435 TIYSQKS 441


>gi|58696674|ref|ZP_00372226.1| dihydroorotase [Wolbachia endosymbiont of Drosophila simulans]
 gi|58698216|ref|ZP_00373136.1| dihydroorotase [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58535243|gb|EAL59322.1| dihydroorotase [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58537156|gb|EAL60262.1| dihydroorotase [Wolbachia endosymbiont of Drosophila simulans]
          Length = 459

 Score =  266 bits (680), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 157/427 (36%), Positives = 241/427 (56%), Gaps = 10/427 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH--DCTGLVAVPGIIDAR 65
           N RIIDP   +D  G+++ E   I+  G     + F TS +    DC GLV +PG+ID  
Sbjct: 40  NARIIDPETKLDIKGSLLTEGDKIVDFG----ESLFSTSGVDETIDCKGLVLMPGLIDIH 95

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V       E+ + I T SK A AGG+T+++  P  + + +D     KY        S +N
Sbjct: 96  VHFREPGQEHKETIYTGSKSAAAGGVTTVVCQPNTIPA-IDSVVLAKYLKYRALETSHVN 154

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V   A +T+  E  +++EM LL+E G V F    M + +  ++  ++ Y+ ML   +A  
Sbjct: 155 VEFYAKITTLEE--KLTEMALLKEAGAVGFTDDGMPVMNPMIMRQALLYSSMLGVPIAQH 212

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIPQS 244
             D  L + G INEG I+  LG+ GI S SE+V + RD+L+ +     HYH   +S   S
Sbjct: 213 AEDLNLSAGGAINEGKISEELGVKGILSASESVMVNRDILLMKDMENVHYHILHVSSKDS 272

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           +  IK AK      TC ++ ++  L E+ V+ + ++ K+ PPLR+E +R++MVE L+ G 
Sbjct: 273 LDAIKRAKDLGLNVTCEVTPHHFTLTEDIVKQHGAIAKMNPPLRTEEDRLAMVEGLKTGV 332

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I +DH P    +K LP   A+FG +GLETML  +L L+H  Q+ L  ++  L+ +PA
Sbjct: 333 IDCIATDHAPHDRSSKDLPLENAAFGIVGLETMLPLSLELYHSGQMGLLDVLAKLTYKPA 392

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            I ++P G +Q   AAD+ L+DLN++W +K D+ +S  KN+ FD     G VVRT +SGK
Sbjct: 393 DIIHIPRGRIQKNLAADLILVDLNHEWEIKTDNFASKSKNSPFDGRKVKGHVVRTVVSGK 452

Query: 425 QVYTLES 431
            +Y+ +S
Sbjct: 453 TIYSQKS 459


>gi|294675954|ref|YP_003576569.1| dihydroorotase [Rhodobacter capsulatus SB 1003]
 gi|294474774|gb|ADE84162.1| dihydroorotase-1 [Rhodobacter capsulatus SB 1003]
          Length = 423

 Score =  265 bits (678), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 154/432 (35%), Positives = 234/432 (54%), Gaps = 17/432 (3%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT F   N R+IDP    + VG ++V+ GII A G      + P  A + DC G    PG
Sbjct: 1   MTVF-FENARLIDPEAGTETVGNLVVDGGIIAAIG----QMQAPADARVIDCGGKCLAPG 55

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLD-----EYTFIKYAL 115
           I+D  V +    + + ++  T    A  GG+T+II  P   S  +D     E+   + A 
Sbjct: 56  IVDIGVKIGEPGERHKESFRTAGLAAARGGVTTIIARP-DTSPAIDTPETLEFVTRRAAE 114

Query: 116 EEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYA 175
             +R++ +      A LT    G+E++E+  L + G ++F  +     DT+VL  +  YA
Sbjct: 115 APVRIRHM------AALTKGRAGREMTEIGFLMDAGAIAFTDADHVCADTKVLSRAFTYA 168

Query: 176 HMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYH 235
             L A+V     D  L     +  G  A+  GL  +  ++E + L RDL + + TG  YH
Sbjct: 169 RSLGALVLCHPQDPGLSKGAAVTSGKFASLRGLPAVSPMAERMGLDRDLALVEMTGVRYH 228

Query: 236 ASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMS 295
           A  I+  +++  +  AKA     T G+S+++L LNE DV  Y +  K+ PPLRSE +R++
Sbjct: 229 ADQITTARALPALSRAKAAGLPVTAGVSVHHLTLNEFDVGNYRTFFKLTPPLRSEDDRLA 288

Query: 296 MVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKL 355
           MV+AL +G IDI+ S HTP   ++K LP+ EA+ G++GLET+L AALRL+H   + L  L
Sbjct: 289 MVQALAEGVIDILCSMHTPADEESKRLPYEEAAAGAVGLETLLPAALRLYHAGSLDLPGL 348

Query: 356 IRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK 415
            RAL+  PA++  LP G L  G+ AD+ L D    + +    ++S  KNT FD    TGK
Sbjct: 349 FRALALNPARLMGLPQGRLCEGSPADLVLFDPEAPFVLDRFTLASKSKNTPFDGARLTGK 408

Query: 416 VVRTYISGKQVY 427
           V+ T++ G QV+
Sbjct: 409 VLATFVGGVQVH 420


>gi|222825103|dbj|BAH22260.1| dihydroorotase [Wolbachia endosymbiont of Cadra cautella]
          Length = 444

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 154/426 (36%), Positives = 239/426 (56%), Gaps = 5/426 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSA-LIHDCTGLVAVPGIIDARV 66
           N RIIDP   +D  G+++ E   I+  G    +   P       DC GLV +PG+ID  V
Sbjct: 22  NVRIIDPEAKLDIKGSLLTEGDKIVDFGESLFSNGVPNGVDETIDCKGLVLMPGLIDIHV 81

Query: 67  TLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
                  E+ +NI T SK A AGG+T+++  P  + + +D     KY        S +NV
Sbjct: 82  HFREPGQEHKENIHTGSKSAAAGGVTTVVCQPNTVPA-IDSVVLAKYLKYRAFETSHVNV 140

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
              A +T++ E  +++EM LL+E G V F    M + +  ++  ++ Y+ ML   +A   
Sbjct: 141 EFYAKITTSEE--KLTEMALLKEAGAVGFTDDGMPVMNPMIMRQALLYSSMLGVPIAQHA 198

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIPQSI 245
            D  L + G INEG I+  LG+ GI S SE+V + RD+L+ ++    HYH   +S   S+
Sbjct: 199 EDLNLSAGGAINEGKISEELGVKGILSASESVMVTRDILLMKNIENVHYHILHVSSKDSL 258

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
             IK AK      TC ++ ++  L E+ V+ + ++ K+ PPLR+E +R++M+E L+ G I
Sbjct: 259 DAIKRAKDLGLNVTCEVTPHHFTLTEDIVKQHGAIAKMNPPLRTEEDRLAMIEGLKTGVI 318

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I +DH P  + +K LP   A+FG IGLETML  +L L+H  Q+ L  ++  L+ +PA 
Sbjct: 319 DCIATDHAPHDLSSKDLPLENAAFGIIGLETMLPLSLELYHSGQMGLLDVLAKLTYKPAD 378

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I ++P G +Q    AD+ L+DL+++W +K D+ +S  KN+ F      G VVRT +SGK 
Sbjct: 379 IIHMPRGRIQKNLVADLILVDLDHEWEIKVDNFASKSKNSPFGGRKVKGHVVRTVVSGKT 438

Query: 426 VYTLES 431
           VY  +S
Sbjct: 439 VYLQKS 444


>gi|261750310|ref|ZP_05994019.1| dihydroorotase [Brucella suis bv. 5 str. 513]
 gi|261740063|gb|EEY27989.1| dihydroorotase [Brucella suis bv. 5 str. 513]
          Length = 262

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 124/261 (47%), Positives = 179/261 (68%)

Query: 168 LLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIA 227
           +  ++ YA   NA++A +T D FLG+ GV+NEG+ A++LGL G P  +E +PL RDL +A
Sbjct: 1   MRRALTYARDFNAVIACETRDPFLGANGVMNEGLFASWLGLSGTPREAEVIPLERDLRLA 60

Query: 228 QHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPL 287
             T   YHA+ +S   S   ++ AK   T  T G+SIN+L LNEND+  + +  ++ PPL
Sbjct: 61  ALTRSRYHAAQLSCAMSADAMRRAKDLGTNVTAGVSINHLSLNENDIGEFRTFFRLSPPL 120

Query: 288 RSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHG 347
           R E +R++MVEA++ G IDI+VS H P+ +DTK LPF++A  G+IGLET+L+AALRL+H 
Sbjct: 121 RGEEDRLAMVEAVKNGTIDIVVSAHDPQDVDTKRLPFSDAEAGAIGLETLLAAALRLYHN 180

Query: 348 QQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVF 407
             I L +L+  LST PA+IF L  GTL+ G +ADIA++DL   W V+ +D+ S  KN+ F
Sbjct: 181 DNIPLLRLVEVLSTAPAKIFGLNAGTLKPGASADIAIVDLEEPWVVREEDLHSRSKNSCF 240

Query: 408 DKEFFTGKVVRTYISGKQVYT 428
           +   F G+VVRT ++GK VY+
Sbjct: 241 ESARFQGRVVRTIVAGKTVYS 261


>gi|213019163|ref|ZP_03334970.1| dihydroorotase [Wolbachia endosymbiont of Culex quinquefasciatus
           JHB]
 gi|212995272|gb|EEB55913.1| dihydroorotase [Wolbachia endosymbiont of Culex quinquefasciatus
           JHB]
          Length = 439

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 154/423 (36%), Positives = 241/423 (56%), Gaps = 10/423 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSAL--IHDCTGLVAVPGIIDAR 65
           N RIIDP   +D  G+++ E G I+  G     + F TS +  I DC GLV +PG+ID  
Sbjct: 20  NARIIDPETKLDIKGSLLTEGGKIVDFG----ESLFSTSGVDEIIDCKGLVLMPGLIDIH 75

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V       E+ + I T SK A AGG T+++  P  + + +D     +Y        S +N
Sbjct: 76  VHFREPGQEHKETIHTGSKSAAAGGATTVVCQPNTVPA-IDSVVLAQYLKYRAFETSHVN 134

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V   A +T++ E  +++EM LL+E G V F    M + +  ++  ++ Y+ ML   +A  
Sbjct: 135 VEFYAKITTSEE--KLTEMALLKEAGAVGFTDDGMPVMNPMIMRQALLYSSMLGVPIAQH 192

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIPQS 244
             D  L + G IN G I+  LG+ GI S SE+V + RD+L+ +     HYH   +S   S
Sbjct: 193 AEDLNLSAGGAINAGKISEELGIKGILSASESVMVNRDILLMKDIENVHYHILHVSSKDS 252

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           +  IK AK      TC ++ ++  L E+ V+ + ++ K+ PPLR+E +R++M+E L+ G 
Sbjct: 253 LDAIKRAKDLGLNVTCEVTPHHFTLTEDIVKQHGAIAKMNPPLRTEEDRLAMIEGLKTGV 312

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I +DH P  + +K LP   A+FG +GLETML  +L L+H  Q+ L  ++  L+ +PA
Sbjct: 313 IDCIATDHAPHDLSSKDLPLENAAFGIVGLETMLPISLELYHSGQMGLLDVLAKLTYKPA 372

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            I ++P G +Q   AAD+ L+DL+++W +K D+ +S  KN+ FD     G+V+RT +SGK
Sbjct: 373 DIIHVPRGRIQKNLAADLILVDLDHEWKIKVDNFASKSKNSPFDGRKVKGRVIRTVVSGK 432

Query: 425 QVY 427
            VY
Sbjct: 433 TVY 435


>gi|190570588|ref|YP_001974946.1| dihydroorotase [Wolbachia endosymbiont of Culex quinquefasciatus
           Pel]
 gi|190356860|emb|CAQ54231.1| dihydroorotase [Wolbachia endosymbiont of Culex quinquefasciatus
           Pel]
          Length = 456

 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 154/423 (36%), Positives = 241/423 (56%), Gaps = 10/423 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSAL--IHDCTGLVAVPGIIDAR 65
           N RIIDP   +D  G+++ E G I+  G     + F TS +  I DC GLV +PG+ID  
Sbjct: 37  NARIIDPETKLDIKGSLLTEGGKIVDFG----ESLFSTSGVDEIIDCKGLVLMPGLIDIH 92

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V       E+ + I T SK A AGG T+++  P  + + +D     +Y        S +N
Sbjct: 93  VHFREPGQEHKETIHTGSKSAAAGGATTVVCQPNTVPA-IDSVVLAQYLKYRAFETSHVN 151

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V   A +T++ E  +++EM LL+E G V F    M + +  ++  ++ Y+ ML   +A  
Sbjct: 152 VEFYAKITTSEE--KLTEMALLKEAGAVGFTDDGMPVMNPMIMRQALLYSSMLGVPIAQH 209

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIPQS 244
             D  L + G IN G I+  LG+ GI S SE+V + RD+L+ +     HYH   +S   S
Sbjct: 210 AEDLNLSAGGAINAGKISEELGIKGILSASESVMVNRDILLMKDIENVHYHILHVSSKDS 269

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           +  IK AK      TC ++ ++  L E+ V+ + ++ K+ PPLR+E +R++M+E L+ G 
Sbjct: 270 LDAIKRAKDLGLNVTCEVTPHHFTLTEDIVKQHGAIAKMNPPLRTEEDRLAMIEGLKTGV 329

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I +DH P  + +K LP   A+FG +GLETML  +L L+H  Q+ L  ++  L+ +PA
Sbjct: 330 IDCIATDHAPHDLSSKDLPLENAAFGIVGLETMLPISLELYHSGQMGLLDVLAKLTYKPA 389

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            I ++P G +Q   AAD+ L+DL+++W +K D+ +S  KN+ FD     G+V+RT +SGK
Sbjct: 390 DIIHVPRGRIQKNLAADLILVDLDHEWKIKVDNFASKSKNSPFDGRKVKGRVIRTVVSGK 449

Query: 425 QVY 427
            VY
Sbjct: 450 TVY 452


>gi|58584703|ref|YP_198276.1| dihydroorotase, PyrC [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
 gi|75497844|sp|Q5GSJ0|PYRC_WOLTR RecName: Full=Dihydroorotase; Short=DHOase
 gi|58419019|gb|AAW71034.1| Dihydroorotase, PyrC [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 443

 Score =  263 bits (671), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 151/423 (35%), Positives = 237/423 (56%), Gaps = 5/423 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSA-LIHDCTGLVAVPGIIDARV 66
           N RIIDP   +D  G+++ E   I+  G    +   P+      +C GLV +PG++D  V
Sbjct: 22  NARIIDPETKLDIEGSLLTEGSKIIDFGESLFSNGVPSGVDETINCEGLVLMPGLVDIHV 81

Query: 67  TLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
                  E+ + I T SK A AGG+T+++  P   +  +D     KY        S +N+
Sbjct: 82  HFREPGQEHKETIYTGSKSAAAGGVTTVVCQP-NTTPAIDSVILAKYLKYRALETSHVNI 140

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
              A +T++ E  +++E+ LL+E G V F    + + +  ++  ++ Y+ MLN  +A   
Sbjct: 141 EFYAKITTSEE--KLTEVALLKEAGAVGFTDDGIPVMNPMIMRQALLYSSMLNVPIAQHA 198

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIPQSI 245
            D  L + G INEG I+  LG+ GI S SE+V ++RD+L+ +     HYH   IS   S+
Sbjct: 199 EDLNLSAGGAINEGKISEALGVKGILSASESVMVSRDILLMKDIENVHYHILHISSKDSL 258

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
             +K AK      TC ++ ++  L E+ V+ + ++ K+ PPLR+E +R++MVE L+ G I
Sbjct: 259 DAVKRAKDLGLNVTCEVTPHHFTLTEDIVKQHGAIAKMNPPLRTEEDRLAMVEGLKTGVI 318

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I +DH P    +K LP   A+FG +GLETML  +L L+H  QI L  ++  L+ +PA 
Sbjct: 319 DCIATDHAPHDRSSKDLPLESAAFGIVGLETMLPLSLELYHSGQIDLFDILAKLTYKPAD 378

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I ++P G +Q    AD+ L+DLNY+W +K D  +S  KN+ F      G+VVRT +SGK 
Sbjct: 379 IIHVPRGRVQKNFVADLTLVDLNYEWEIKIDSFASKSKNSPFGGRKVKGRVVRTIVSGKT 438

Query: 426 VYT 428
           VY+
Sbjct: 439 VYS 441


>gi|84515825|ref|ZP_01003186.1| dihydroorotase, multifunctional complex type [Loktanella
           vestfoldensis SKA53]
 gi|84510267|gb|EAQ06723.1| dihydroorotase, multifunctional complex type [Loktanella
           vestfoldensis SKA53]
          Length = 427

 Score =  262 bits (669), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 145/427 (33%), Positives = 244/427 (57%), Gaps = 3/427 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT+    N RIIDP    D  G ++V +G+I       ++A  P  A I DC G+   PG
Sbjct: 1   MTATFFANARIIDPVALTDAPGCVLVVDGLI--HDVTGIDATPPVGAKIVDCGGMCLAPG 58

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           IID  V ++   + + ++  +  + A AGG+T+++  P      +D    +++     ++
Sbjct: 59  IIDIGVKVSEPGERHKESFRSAGRAAAAGGVTTMVTRP-DTDPAIDTPEKLEFVARRAQL 117

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            + ++V P A LT   +G+E++E+ LL + G V+F      +  T+VL  ++ YA  L+A
Sbjct: 118 DAPVHVLPMAALTKGRDGQEMTEIGLLSDAGAVAFTDCDHVVTKTKVLARALSYARSLDA 177

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V   T D  L    V+  G  A+  GL G+ +++E + L RD+ + + TG  YH   I+
Sbjct: 178 LVIGHTQDPGLSEGAVVTTGKFASLRGLPGVSAMAERMALDRDISLLEMTGARYHIDQIT 237

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++  ++ AK +  + T G+SI++L LN+ D+  Y +  K+ PPLRSE +R ++V+A+
Sbjct: 238 TARALPALERAKRNGLRITAGVSIHHLTLNDMDIADYRTFFKLTPPLRSEDDRAAVVQAV 297

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
            +G ID+I S HTP+  ++K LPF EA+ G++GLET+L AA+RL+H  QI L +L RAL+
Sbjct: 298 AEGLIDVICSMHTPQDEESKRLPFEEAASGAVGLETLLPAAMRLYHAGQIDLPRLFRALA 357

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+I  L  G +  G  AD+ L D +  + +    + S  KNT FD     G+V+ T+
Sbjct: 358 LNPARILGLAAGRMLAGAPADLVLFDPDAPFQLDRTTLQSKSKNTPFDGARLQGRVIGTW 417

Query: 421 ISGKQVY 427
           + G +++
Sbjct: 418 VDGTRIW 424


>gi|255262089|ref|ZP_05341431.1| dihydroorotase [Thalassiobium sp. R2A62]
 gi|255104424|gb|EET47098.1| dihydroorotase [Thalassiobium sp. R2A62]
          Length = 430

 Score =  262 bits (669), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 144/429 (33%), Positives = 235/429 (54%), Gaps = 7/429 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFP--TSALIHDCTGLVAV 58
           MT  +L N R+IDP    D +GAI++ +G+I A      +   P  +   + DC G    
Sbjct: 5   MTKKLLTNARLIDPENGTDSLGAILIADGMIEAV----YDVAVPDVSGPEVVDCRGKCLA 60

Query: 59  PGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           PGI+D  V ++   + + ++  +    A  GG+T+I+  P  + + +D    +++     
Sbjct: 61  PGIVDIGVKVSEPGERHKESFKSAGLAAATGGVTTIVTRPDTLPA-IDTPEVLEFVRRRA 119

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
              + + + P A LT   +G E++E+  LQ+ G ++F      + +T+V   ++ YA  L
Sbjct: 120 NEATDVRIIPMAALTKGRDGGEMTEIGFLQDAGAIAFTDCDRVVENTKVFSRALTYARSL 179

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
           +A+V     +  L     +  G  A+  GL  + S++E + L RD+ + + TG  YH   
Sbjct: 180 DALVIGHVQEPILSKDAAVTSGKFASLRGLPSVSSMAERIGLDRDIALVEMTGAKYHVDQ 239

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           I+  +++  +K AKA+    T GISI++L LNE DV  Y +  KV PPLRSE +R++MVE
Sbjct: 240 ITTARALPALKRAKANGLDITAGISIHHLTLNELDVADYRTFFKVKPPLRSEDDRIAMVE 299

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
           A+  G +DII S HTP+  ++K LPF +A+ G++ LET+L AALRL H +Q+ L  L RA
Sbjct: 300 AIADGTLDIISSMHTPQDEESKRLPFEQAASGAVALETLLPAALRLVHSEQVDLPTLFRA 359

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           LS  P++   L  G L     AD+ L D    + +    + S  KNT FD +   GKV+ 
Sbjct: 360 LSLNPSKRLGLDTGRLTADAPADLILFDDGAPFVMDRTTLKSKSKNTPFDGQRMQGKVLG 419

Query: 419 TYISGKQVY 427
           T+++G ++Y
Sbjct: 420 TWVAGTRIY 428


>gi|209543805|ref|YP_002276034.1| dihydroorotase, multifunctional complex type [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531482|gb|ACI51419.1| dihydroorotase, multifunctional complex type [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 430

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 148/429 (34%), Positives = 233/429 (54%), Gaps = 6/429 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAK-FPTSALIHDCTGLVAVP 59
           MT+ +  N R+IDP+R +D  G ++V +G+I  AG D   A+  P  A I D  G +  P
Sbjct: 1   MTATLFENVRLIDPARGLDRPGRLLVRDGVI--AGTDLPGAEGAPEGAGIVDGGGSILCP 58

Query: 60  GIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           G++D RV + G P  EY + + + ++ A AGGIT++ ++P    +  D+   +++     
Sbjct: 59  GLVDMRVAI-GEPGFEYRETVASAARAAAAGGITTMAVLPNSQPA-TDDPALVRHLRARG 116

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
               ++++ P   LT   EG E++E+ LL E G V+F   P ++ D +++  ++ YA   
Sbjct: 117 EETGMVSILPYGALTRRCEGGELAEIGLLNEAGAVAFTDGPRALADARMMRLALTYARGF 176

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
           +A+V     D  L   G   +G +A  LGL GIP+ +E + +ARDL + + T G  H S 
Sbjct: 177 DALVVQHPEDPSLARGGCATDGELATRLGLPGIPAAAEAIMIARDLRLLELTRGRLHFSH 236

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           +S  + +ALI+ AKA + + TC  +     LNE  +  + +  K+ PPLR E +R ++  
Sbjct: 237 VSTAEGLALIRAAKARDLRVTCDTAPPYFDLNETAIGDFRTYAKLSPPLRGEADRQAVCT 296

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
           AL  G ID I SDH P   D K  PFA AS G  GL T+L+  L   HG  + L + +  
Sbjct: 297 ALADGTIDAIASDHAPCDADDKRQPFAVASAGGTGLATLLAVTLAQVHGGSLPLVEALGL 356

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           L+ RPA +     GTL  G  AD+ L + +  W V+AD M    +NT FD     G+V+ 
Sbjct: 357 LTHRPAALLRSRAGTLADGAVADLCLFNPDRAWKVEADQMPGKAQNTPFDGRALEGRVLG 416

Query: 419 TYISGKQVY 427
           T+ +G+ V+
Sbjct: 417 TWKAGRMVF 425


>gi|84684262|ref|ZP_01012164.1| Dihydroorotase and related cyclic amidohydrolase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84668015|gb|EAQ14483.1| Dihydroorotase and related cyclic amidohydrolase [Rhodobacterales
           bacterium HTCC2654]
          Length = 420

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 152/427 (35%), Positives = 233/427 (54%), Gaps = 8/427 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT     N R+IDP    D +G++ +E+G I+A          P   +I DC G    PG
Sbjct: 1   MTIRTFINARLIDPEAGTDAMGSLTIEDGAIIARDGR------PAGEVI-DCNGKCLAPG 53

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           IID  V +    + + +   T  + A AGG+T+++  P   +  +D    + +     R 
Sbjct: 54  IIDIGVKIGEPGERHKEGFRTAGRAAAAGGVTTMVTRP-DTTPAIDTPETLDFVKRRARE 112

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           ++ + V+P A LT   EG+E+ EM  L + G V+F      I D +V   +M YA  + A
Sbjct: 113 RAPVRVHPMAALTKGREGREMVEMGFLMDAGAVAFTDCDHVIGDNKVFSRAMTYARSVGA 172

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++     D  L S   +  G  A+  GL  +  ++E + L RD+ + + TG  YHA  +S
Sbjct: 173 LIMAHPQDPSLTSGSAVTSGKFASLRGLPAVSPMAERLGLERDMALVEMTGVRYHADNLS 232

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              ++  ++ AKA     T G++I++L LNE DV  Y +  K+ PPLRSE +R +MVEA+
Sbjct: 233 TAAALPALERAKAAGLDVTAGVNIHHLTLNELDVGDYRTFFKLKPPLRSEDDRKAMVEAV 292

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G IDI+ S HTP+  ++K LPF EA+ G++GL+T+L AA+RL H   + L  L RALS
Sbjct: 293 ASGLIDIVCSMHTPQDEESKRLPFEEAASGAVGLQTILPAAMRLIHDGSMDLPTLWRALS 352

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T PA+ F LPGGTL  G  AD+ L D +  + +    + S  KNT FD+    G V+ T+
Sbjct: 353 TNPAKRFGLPGGTLAEGRRADLVLFDPDAPFVLNRFTLESKSKNTPFDEARMQGNVLGTW 412

Query: 421 ISGKQVY 427
           + G++V+
Sbjct: 413 VGGQRVF 419


>gi|57239363|ref|YP_180499.1| dihydroorotase [Ehrlichia ruminantium str. Welgevonden]
 gi|57161442|emb|CAH58367.1| dihydroorotase [Ehrlichia ruminantium str. Welgevonden]
          Length = 449

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 149/426 (34%), Positives = 235/426 (55%), Gaps = 5/426 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSAL-IHDCTGLVAVPGIIDARV 66
           N RIIDP   +D  G+++ +   I+  G +      PT    + DC   + +PG+ID  V
Sbjct: 23  NARIIDPESRLDIKGSLLTKGDKIVDFGPNLFADGIPTGICEVVDCKHKILMPGLIDIHV 82

Query: 67  TLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
                  E+ + I T SK A AGGIT+++  P  + + +      KY        + +N+
Sbjct: 83  HFREPGQEHKETIETGSKSAAAGGITTVVCQPNTIPT-ISSVIIAKYIKMRALETAYVNI 141

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
              A +T       +S+M LL+E G V F    M + ++ ++  ++ Y+ ML+ ++A   
Sbjct: 142 EFYASITK--PDNSLSDMALLKEAGAVGFTDDGMPVMNSLIMRQALSYSSMLDTVIAQHA 199

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIPQSI 245
            D  L + G INEG ++  LGL G+P ISE++ + RD+ I       HYH   IS   S+
Sbjct: 200 EDLNLSNNGCINEGKVSYELGLKGMPDISESIIVNRDIAILNTLKNVHYHVLHISSKSSL 259

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +IK AK    K TC ++ ++L L E DV  +++  K+ PPLR+E++R+SM+E L+ G I
Sbjct: 260 DIIKQAKNQGLKVTCEVTPHHLTLTEQDVIQHSTFAKMNPPLRTESDRISMIEGLKNGII 319

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I +DH P  + +K LP   A+FG +GLETML  +L L+H   + L  L+  L+ +PA 
Sbjct: 320 DCIATDHAPHDLGSKELPLDTAAFGIVGLETMLPISLELYHNGTMPLIDLLATLTYKPAD 379

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I  +P G ++ G  AD+ L+DL+++WT+     +S  KN+ F      GKV+RT +SGK 
Sbjct: 380 IIRVPRGRIKKGFTADLILLDLDHEWTIDISKFASKSKNSPFHNRKVKGKVLRTVVSGKT 439

Query: 426 VYTLES 431
            Y LE+
Sbjct: 440 TYRLEN 445


>gi|330994163|ref|ZP_08318091.1| Dihydroorotase [Gluconacetobacter sp. SXCC-1]
 gi|329758630|gb|EGG75146.1| Dihydroorotase [Gluconacetobacter sp. SXCC-1]
          Length = 431

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 149/434 (34%), Positives = 228/434 (52%), Gaps = 7/434 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAK-FPTSALIHDCTG-LVAV 58
           M   +  N+R+IDP+  +D  G ++V+ G+I  AG D   A+  P  A + D  G LV  
Sbjct: 1   MKPVLFENSRLIDPASGLDRPGRLLVQGGVI--AGTDLPQAEGAPEGAEVIDGGGQLVLC 58

Query: 59  PGIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEE 117
           PG++D RVT+ G P  EY + + + +K AVAGGIT+I ++P   S  +D     +     
Sbjct: 59  PGLVDMRVTI-GEPGFEYRETVLSAAKAAVAGGITTIAVLP-NTSPTIDNPALARLLRAR 116

Query: 118 IRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHM 177
                LI++ P   LT    G E++E+ LL E G ++F   P +I D++ +   + YA  
Sbjct: 117 GEETGLIDILPYGALTRGCAGTEMAEIGLLAEAGAIAFTDGPHAIADSRTMRQMLTYAKG 176

Query: 178 LNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS 237
             A++     D  L   G   +G +A  LGL GIP+ +E + +ARDL +A+ TGG  H  
Sbjct: 177 FGALIVQHPEDPSLARGGCATDGELATRLGLPGIPAAAEAILIARDLRLARMTGGRLHFG 236

Query: 238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMV 297
            +S  + + LI+ AKA   + TC  +     LNE  +  + +  K+ PPLR+E +R ++ 
Sbjct: 237 HVSTAEGLDLIRRAKADGLRVTCDTAPPYFDLNETVIGDFRTYAKLSPPLRAEADRRAVC 296

Query: 298 EALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIR 357
             L  G ID I SDH P   D K  PFA A+ G  GL T+L+  L   H   + +   I 
Sbjct: 297 AGLADGTIDAIASDHMPCDADDKRQPFAVAAAGGTGLCTLLAVTLAQVHAGNLDMGAAIA 356

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            L+ RPA +     GTL  G  AD+ L + +  W V+A D+    +NT FD     G+VV
Sbjct: 357 LLTHRPASVLGSSAGTLAVGAPADLCLFNPDTGWIVRAGDLPGKAQNTPFDGRALEGRVV 416

Query: 418 RTYISGKQVYTLES 431
            T+  G++V+  ++
Sbjct: 417 GTWKKGRRVFGAQA 430


>gi|58579330|ref|YP_197542.1| dihydroorotase [Ehrlichia ruminantium str. Welgevonden]
 gi|58417956|emb|CAI27160.1| Dihydroorotase [Ehrlichia ruminantium str. Welgevonden]
          Length = 449

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 149/426 (34%), Positives = 234/426 (54%), Gaps = 5/426 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSAL-IHDCTGLVAVPGIIDARV 66
           N RIIDP   +D  G+++ +   I+  G +      PT    + DC   + +PG+ID  V
Sbjct: 23  NARIIDPESRLDIKGSLLTKGDKIVDFGPNLFADGIPTGICEVVDCKHKILMPGLIDIHV 82

Query: 67  TLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
                  E+ + I T SK A AGGIT+++  P  + + +      KY        + +N+
Sbjct: 83  HFREPGQEHKETIETGSKSAAAGGITTVVCQPNTIPT-ISSVIIAKYIKMRALETAYVNI 141

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
              A +T       +S+M LL+E G V F    M + ++ ++  ++ Y+ ML+ ++A   
Sbjct: 142 EFYASITK--PDNSLSDMALLKEAGAVGFTDDGMPVMNSLIMRQALSYSSMLDTVIAQHA 199

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIPQSI 245
            D  L + G INEG ++  LGL G+P ISE++ + RD+ I       HYH   IS   S+
Sbjct: 200 EDLNLSNNGCINEGKVSYELGLKGMPDISESIIVNRDIAILNTLKNVHYHVLHISSKSSL 259

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +IK AK    K TC ++ ++L L E DV  + +  K+ PPLR+E++R+SM+E L+ G I
Sbjct: 260 DIIKQAKNQGLKVTCEVTPHHLTLTEQDVIQHGTFAKMNPPLRTESDRISMIEGLKNGII 319

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I +DH P  + +K LP   A+FG +GLETML  +L L+H   + L  L+  L+ +PA 
Sbjct: 320 DCIATDHAPHDLGSKELPLDTAAFGIVGLETMLPISLELYHNGTMPLIDLLATLTYKPAD 379

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I  +P G ++ G  AD+ L+DL+++WT+     +S  KN+ F      GKV+RT +SGK 
Sbjct: 380 IIRVPRGRIKKGFTADLILLDLDHEWTIDISKFASKSKNSPFHNRKVKGKVLRTVVSGKT 439

Query: 426 VYTLES 431
            Y LE+
Sbjct: 440 TYRLEN 445


>gi|162145887|ref|YP_001600345.1| dihydro-orotase protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|161784461|emb|CAP53991.1| putative dihydro-orotase protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 430

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 148/429 (34%), Positives = 233/429 (54%), Gaps = 6/429 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAK-FPTSALIHDCTGLVAVP 59
           MT+ +  N R+IDP+R +D  G ++V +G+I  AG D   A+  P  A I D  G +  P
Sbjct: 1   MTATLFENVRLIDPARGLDRPGRLLVRDGVI--AGTDLPGAEGAPEGAGIVDGGGSILCP 58

Query: 60  GIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           G++D RV + G P  EY + + + ++ A AGGIT++ ++P    +  D+   +++     
Sbjct: 59  GLVDMRVAI-GEPGFEYRETVASAARAAAAGGITTMAVLPNSQPA-TDDPALVRHLRARG 116

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
               ++++ P   LT   EG E++E+ LL E G V+F   P ++ D +++  ++ YA   
Sbjct: 117 EETGMVSILPYGALTRRCEGGELAEIGLLNEAGAVAFTDGPRALADARMMRLALTYARGF 176

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
           +A+V     D  L   G   +G +A  LGL GIP+ +E + +ARDL + + T G  H S 
Sbjct: 177 DALVVQHPEDPSLARGGCATDGELATRLGLPGIPAAAEAIMIARDLRLLELTRGRLHFSH 236

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           +S  + +ALI+ AKA + + TC  +     LNE  +  + +  K+ PPLR E +R ++  
Sbjct: 237 VSTAEGLALIRAAKARDLRVTCDTAPPYFDLNETAIGDFRTYAKLSPPLRGEADRQAVCT 296

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
           AL  G ID I SDH P   D K  PFA AS G  GL T+L+  L   HG  + L + +  
Sbjct: 297 ALADGTIDAIASDHAPCDADDKRQPFAVASAGGTGLATLLAVTLAQVHGGCLPLVEALGL 356

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           L+ RPA +     GTL  G  AD+ L + +  W V+AD M    +NT FD     G+V+ 
Sbjct: 357 LTHRPAALLRSRAGTLADGAVADLCLFNPDRAWKVEADQMPGKAQNTPFDGRALEGRVLG 416

Query: 419 TYISGKQVY 427
           T+ +G+ V+
Sbjct: 417 TWKAGRMVF 425


>gi|58617384|ref|YP_196583.1| dihydroorotase [Ehrlichia ruminantium str. Gardel]
 gi|58416996|emb|CAI28109.1| Dihydroorotase [Ehrlichia ruminantium str. Gardel]
          Length = 449

 Score =  260 bits (665), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 149/426 (34%), Positives = 233/426 (54%), Gaps = 5/426 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSAL-IHDCTGLVAVPGIIDARV 66
           N RIIDP   +D  G+++ +   I+  G        PT    + DC   + +PG+ID  V
Sbjct: 23  NARIIDPESRLDIKGSLLTKGDKIVDFGPSLFADGIPTGICEVVDCKHKILMPGLIDIHV 82

Query: 67  TLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
                  E+ + I T SK A AGGIT+++  P  + + +      KY        + +N+
Sbjct: 83  HFREPGQEHKETIETGSKSAAAGGITTVVCQPNTIPT-ISSVIIAKYIKMRALETAYVNI 141

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
              A +T       +S+M LL+E G V F    M + ++ ++  ++ Y+ ML+ ++A   
Sbjct: 142 EFYASITK--PDNSLSDMALLKEAGAVGFTDDGMPVMNSLIMRQALSYSSMLDTVIAQHA 199

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIPQSI 245
            D  L + G INEG ++  LGL G+P ISE++ + RD+ I       HYH   IS   S+
Sbjct: 200 EDLNLSNNGCINEGKVSYELGLKGMPDISESIIVNRDIAILNTLKNVHYHVLHISSKSSL 259

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +IK AK    K TC ++ ++L L E DV  + +  K+ PPLR+E++R+SM+E L+ G I
Sbjct: 260 DIIKQAKNQGLKVTCEVTPHHLTLTEQDVIQHGTFAKMNPPLRTESDRISMIEGLKNGII 319

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I +DH P  + +K LP   A+FG +GLETML  +L L+H   + L  L+  L+ +PA 
Sbjct: 320 DCIATDHAPHDLGSKELPLDTAAFGIVGLETMLPISLELYHNGTMPLIDLLATLTYKPAD 379

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I  +P G ++ G  AD+ L+DL+++WT+     +S  KN+ F      GKV+RT +SGK 
Sbjct: 380 IIRVPRGRIKKGFTADLILLDLDHEWTIDISKFASKSKNSPFHNRKVKGKVLRTIVSGKT 439

Query: 426 VYTLES 431
            Y LE+
Sbjct: 440 TYRLEN 445


>gi|68171217|ref|ZP_00544622.1| Dihydroorotase multifunctional complex type [Ehrlichia chaffeensis
           str. Sapulpa]
 gi|88658539|ref|YP_507193.1| dihydroorotase, multifunctional complex type [Ehrlichia chaffeensis
           str. Arkansas]
 gi|123493585|sp|Q2GH90|PYRC_EHRCR RecName: Full=Dihydroorotase; Short=DHOase
 gi|67999372|gb|EAM86016.1| Dihydroorotase multifunctional complex type [Ehrlichia chaffeensis
           str. Sapulpa]
 gi|88599996|gb|ABD45465.1| dihydroorotase, multifunctional complex type [Ehrlichia chaffeensis
           str. Arkansas]
          Length = 447

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 151/428 (35%), Positives = 236/428 (55%), Gaps = 11/428 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTS-ALIHDCTGLVAVPGIIDARV 66
           N RIIDP   +D  G+++ +   I+  G D      P++   + DC   + +PG+ID  V
Sbjct: 23  NARIIDPESKLDIRGSLLTKGDKIIDFGPDLFANGIPSTIDEVIDCNNNILLPGLIDIHV 82

Query: 67  TLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYT--FIKY-ALEEIRVKSL 123
                  E+ + I T SK A AGGIT+++  P  + +     T  +IK  ALE   V   
Sbjct: 83  HFREPGQEHKETINTGSKSAAAGGITTVVCQPNTIPTISSVITAKYIKMRALESAYVN-- 140

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           I  Y +   + N     +S+M LL+E G V F    M + +   +  ++ Y+ ML+ ++A
Sbjct: 141 IEFYASITKSDN----SLSDMALLKEVGAVGFTDDGMPVMNALTMRQALSYSSMLDTVIA 196

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGG-HYHASVISIP 242
               D  + + G INEGII+  LGL GIP ISE++ + RD+ + ++    HYH   +S  
Sbjct: 197 QHAEDLNISNNGCINEGIISYELGLKGIPDISESIIVNRDIALMKNIKNVHYHILHVSSQ 256

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S+ +IK AK+   K TC ++ ++  L E D+  + SL K+ PPLR+E +R+SM+E L+ 
Sbjct: 257 ESLHIIKQAKSQGLKVTCEVTPHHFTLTERDIMTHGSLAKMNPPLRTENDRLSMIEGLKS 316

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID I +DH P  ++ K LP   A+FG +GLETML  +L L+H   + L  L+  L+ +
Sbjct: 317 GIIDCIATDHAPHDINAKELPLDTAAFGIVGLETMLPISLELYHNGTMPLIDLLATLTYK 376

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA I  +P G ++    AD+ ++DL+++W V     +S  KN+ F      GKV+RT +S
Sbjct: 377 PADIIKVPRGRIKKDYVADLIILDLDHEWVVDISKFASKSKNSPFHNRKVKGKVLRTIVS 436

Query: 423 GKQVYTLE 430
           GK  Y  E
Sbjct: 437 GKTTYKAE 444


>gi|329114373|ref|ZP_08243135.1| Dihydroorotase [Acetobacter pomorum DM001]
 gi|326696449|gb|EGE48128.1| Dihydroorotase [Acetobacter pomorum DM001]
          Length = 430

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 143/428 (33%), Positives = 227/428 (53%), Gaps = 4/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAK-FPTSALIHDCTGLVAVP 59
           M + +  N R+IDP+  +D+ G ++V +G+I+  G D   A+  P  A + D    V  P
Sbjct: 1   MNTLLFENVRLIDPASGLDQPGRLLVRDGVIV--GTDKAGAEGAPEEATVIDGKNAVLCP 58

Query: 60  GIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR 119
           G++D RV +     EY + +++ ++ A AGGIT++ ++P      +D    ++       
Sbjct: 59  GLVDMRVEIGEPGYEYRETVSSAARAASAGGITTLAVLPT-CKPAIDNPALVRMLRTRGE 117

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
               I + P   LT   EGKE++E+ LL E G V+F     ++   +++  ++ YA    
Sbjct: 118 ETGAITILPYGALTKGCEGKELAEIGLLHEAGAVAFTDGARALDPARLMRLALSYASGFG 177

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
           A++     +  L   G    G +A  LGL GIP+ +E + +ARD+ +A+ TGG  H + +
Sbjct: 178 AMIVQHPEEPSLAGSGCATAGALATRLGLPGIPAAAEAIMIARDMRLAELTGGRLHFAHV 237

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           S  + +ALI+ AK      TC  +     LNEN +  + +  K  PPLRSE +R+++  A
Sbjct: 238 STGEGVALIRQAKERGLNVTCDTAPPYFDLNENTIGDFRTYAKFSPPLRSEEDRLAICAA 297

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           L  G ID I SDH PR  D K LPFA+A+ G  GL T+L   L   H   ++L + +  L
Sbjct: 298 LADGTIDAIGSDHLPRDADDKRLPFAQAATGGTGLVTLLGVTLARVHDGTLTLPQALSLL 357

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           + RPAQ+     GTL  G AAD+ L D    W V+A  +    +NT FD     G+V+ T
Sbjct: 358 THRPAQLLGAECGTLAVGAAADLCLFDPEQSWLVEAGKLPGRAQNTPFDGRPLEGRVLGT 417

Query: 420 YISGKQVY 427
           + +G++VY
Sbjct: 418 WKAGRRVY 425


>gi|258541855|ref|YP_003187288.1| dihydroorotase [Acetobacter pasteurianus IFO 3283-01]
 gi|256632933|dbj|BAH98908.1| dihydroorotase [Acetobacter pasteurianus IFO 3283-01]
 gi|256635990|dbj|BAI01959.1| dihydroorotase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639045|dbj|BAI05007.1| dihydroorotase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642099|dbj|BAI08054.1| dihydroorotase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645154|dbj|BAI11102.1| dihydroorotase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648209|dbj|BAI14150.1| dihydroorotase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651262|dbj|BAI17196.1| dihydroorotase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654253|dbj|BAI20180.1| dihydroorotase [Acetobacter pasteurianus IFO 3283-12]
          Length = 430

 Score =  258 bits (660), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 144/428 (33%), Positives = 227/428 (53%), Gaps = 4/428 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGAD-ALNAKFPTSALIHDCTGLVAVP 59
           M + +  N R+IDP+  +D+ G ++V +G+I  AG D A     P +A + D    V  P
Sbjct: 1   MNTLLFENVRLIDPASGLDQPGRLLVRDGVI--AGTDKAGTEGTPENATVIDGKNAVLCP 58

Query: 60  GIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR 119
           G++D RV +     EY + +++ ++ A AGGIT++ ++P      +D    ++       
Sbjct: 59  GLVDMRVEIGEPGYEYRETVSSAARAASAGGITTLAVLPT-CKPAIDNPALVRMLRTRGE 117

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
               I + P   LT   EGKE++E+ LL E G V+F     ++   +++  ++ YA    
Sbjct: 118 ETGAITILPYGALTKGCEGKELAEIGLLHEAGAVAFTDGARALDPARLMRLALSYASGFG 177

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
           A++     +  L   G    G +A  LGL GIP+ +E + +ARD+ +A+ TGG  H + +
Sbjct: 178 AMIVQHPEEPSLAGSGCATAGALATRLGLPGIPAAAEAIMIARDIRLAELTGGRLHFAHV 237

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           S  + +ALI+ AK      TC  +     LNEN +  + +  K  PPLRSE +R+++  A
Sbjct: 238 STGEGVALIRQAKERGLNVTCDTAPPYFDLNENTIGDFRTYAKFSPPLRSEDDRLAICAA 297

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           L  G ID I SDH PR  D K LPFA+A+ G  GL T+L   L   H   ++L + +  L
Sbjct: 298 LADGTIDAIGSDHLPRDADDKRLPFAQAATGGAGLVTLLGVTLARVHDGTLTLPQALSLL 357

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           + RPAQ+     GTL  G AAD+ L D    W V+A  +    +NT FD     G+V+ T
Sbjct: 358 THRPAQLLGAECGTLAVGAAADLCLFDPEQSWLVEAGKLPGRAQNTPFDGRPLEGRVLGT 417

Query: 420 YISGKQVY 427
           + +G++VY
Sbjct: 418 WKAGRRVY 425


>gi|163792867|ref|ZP_02186843.1| Dihydroorotase and related cyclic amidohydrolase [alpha
           proteobacterium BAL199]
 gi|159181513|gb|EDP66025.1| Dihydroorotase and related cyclic amidohydrolase [alpha
           proteobacterium BAL199]
          Length = 444

 Score =  258 bits (660), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 144/431 (33%), Positives = 225/431 (52%), Gaps = 1/431 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M + +  N R++DP+  +D  GA++V +G I   G +         A + DC G    PG
Sbjct: 1   MRATLYKNARLLDPASRLDAKGAVLVRDGKIAEVGPNVFVDAIQADAEVVDCGGRCLAPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D RV      +E+ + + +L   AVAGG+T++  +P   +  +D+ + +++     + 
Sbjct: 61  LVDMRVQTREPGEEHMETLASLQHAAVAGGVTTLATLP-NTNPIIDDVSLLEFVERLAQE 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             L+NV+P A  T  M G+E++E+ LL   G V F     +I D  V+   + YA M   
Sbjct: 120 VGLVNVHPYAAATKGMRGEEMTEIGLLSASGAVGFTDGTKAIADPVVMRRLLSYATMFGR 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V     +  L   G   EG  A  LGL GIPS +E + + RDL + + TGG YHA+ +S
Sbjct: 180 PVIQHPEEPTLAREGCATEGETATRLGLPGIPSCAEVMMIERDLQLVRLTGGRYHAAHVS 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              +I  I+ AKA     TC  + +   LNE  +  Y +  ++ PPLRSE +R ++V  +
Sbjct: 240 TGAAIEAIRRAKAEGLAVTCDTAPHYFALNELAIVDYRTFARMSPPLRSEADRRAVVAGV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID I SDH P   D+K +PFA+A  G++GLET+L  +L L H   + L  +I  L+
Sbjct: 300 ADGTIDAIASDHNPEDQDSKRVPFAQAVPGAVGLETLLPISLGLHHDGAMPLLDIIDRLT 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
            RPA I  L  G L  G  AD+ + + +    + A    S  KN+ FD +   G+V RT 
Sbjct: 360 ARPAAILGLEVGRLSVGAWADLVVFEPDRAVRIDASKFRSKSKNSPFDGKPAQGRVWRTV 419

Query: 421 ISGKQVYTLES 431
             G+ V+ L++
Sbjct: 420 YRGRTVFDLDT 430


>gi|332800375|ref|YP_004461874.1| dihydroorotase, multifunctional complex type [Tepidanaerobacter sp.
           Re1]
 gi|332698110|gb|AEE92567.1| dihydroorotase, multifunctional complex type [Tepidanaerobacter sp.
           Re1]
          Length = 431

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 148/425 (34%), Positives = 232/425 (54%), Gaps = 6/425 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           +L   R+IDPS++ D    +++ +G I AA  D +     + A + D +G++  PG+ID 
Sbjct: 4   LLKGARVIDPSQNTDTTSDVLIVDGRI-AAVKDEIEI---SDAKVIDLSGMIVTPGLIDI 59

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V       EY ++I + S  A  GG T+   MP      +D    ++Y   +      I
Sbjct: 60  HVHFRDPGYEYKEDIESGSMSAAVGGFTAAACMP-NTKPPIDNAALVQYVKSKASKAGKI 118

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
            + P  C++   EGKEI+EM  + + G V+F      I D+ ++  +M YA M + ++  
Sbjct: 119 KLLPIGCVSKGQEGKEIAEMGDMAQAGAVAFSDDGKPIADSALMRKAMVYASMFDKVIID 178

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D FL   G INEG I+  LGL GIP+ +E + +AR++LIA+  G   H + +S   S
Sbjct: 179 HCEDPFLFEGGQINEGYISTLLGLAGIPAAAEEIMVARNILIAREMGTRVHIAHVSTEGS 238

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + LI+ AK+   K +C ++ ++L L E  V  Y++  KV PPLR++++  +++E L+ G 
Sbjct: 239 LRLIRQAKSEGVKVSCEVTPHHLTLTEKAVMGYDTNAKVNPPLRTQSDIDALLEGLKDGT 298

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRP 363
           ID I +DH P HMD K + F +A+FG +GLET L   L  +     +SL   I  +++ P
Sbjct: 299 IDAIATDHAPHHMDEKDMEFDKAAFGMVGLETALGVILTHIVKEGVLSLNAAIEKMTSGP 358

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++  L  GTL+ G  ADI +ID N  WTV  +   S  +NT FD    TGK V T + G
Sbjct: 359 AKVLGLDMGTLKIGAPADITVIDPNRVWTVDKNKFFSKGRNTPFDGWRLTGKAVLTMVDG 418

Query: 424 KQVYT 428
           + VY+
Sbjct: 419 RIVYS 423


>gi|302382944|ref|YP_003818767.1| dihydroorotase [Brevundimonas subvibrioides ATCC 15264]
 gi|302193572|gb|ADL01144.1| dihydroorotase, multifunctional complex type [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 425

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 150/431 (34%), Positives = 230/431 (53%), Gaps = 10/431 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGII--LAAGADALNAKFPTSALIHDCTGLVAV 58
           MTS  + N R++DP+ D D  GA+++E+G+I  +  GA AL A       + D  GL   
Sbjct: 1   MTSLAIVNARLLDPASDYDGPGAVLIEDGVITRVEHGAAALTANR-----VIDAAGLCLS 55

Query: 59  PGIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEE 117
           PG+ID RV  TG P  E  + + + S  A AGG+T+I++ P      +D+   + +    
Sbjct: 56  PGLIDIRVR-TGEPGAEPKETLKSASLSAAAGGVTTIVIQP-DTDPAVDDPAMVDFIQRR 113

Query: 118 IRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHM 177
               +L+NV      T   +GK ++E+ L+ E G + F      I D++VL   M YA  
Sbjct: 114 GAALNLVNVRAAGAATRGRDGKRMAEIGLMHEAGALYFTDGDHVIADSRVLSRIMSYASA 173

Query: 178 LNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS 237
            NA++A    D +L    V   G +A  LGL G P+I+E + L RDL + + TG  +   
Sbjct: 174 FNALIACRPADPWLSEGAVATSGELATRLGLSGAPAIAERIQLERDLALVEQTGARFLVD 233

Query: 238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMV 297
            IS   ++ ++  A+A   +    +SIN+L  NE D+  Y +  ++ PPLR E++R +++
Sbjct: 234 QISTEAALEVLARARARGLEVAASVSINHLCFNEIDIGDYRTFFRLDPPLRPESDRRALI 293

Query: 298 EALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIR 357
           EA+  G I+ I S HTP   + K  PFAEA+ G++GLET+L AAL L H + + L  ++R
Sbjct: 294 EAVRDGLIEAITSAHTPAPAEDKRRPFAEAAPGAVGLETLLPAALGLHHEEGLDLLDVLR 353

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            L+  PA +  L  G L  G  AD+ L D      V A  + S  KN+ FD     G+V 
Sbjct: 354 PLTHGPATLLGLDAGALTAGAPADLILFDPGAPVVVDAATLRSKSKNSPFDGRRLQGRVE 413

Query: 418 RTYISGKQVYT 428
            T + G+ VY+
Sbjct: 414 MTVVGGRTVYS 424


>gi|114798896|ref|YP_760998.1| putative dihydroorotase [Hyphomonas neptunium ATCC 15444]
 gi|114739070|gb|ABI77195.1| putative dihydroorotase [Hyphomonas neptunium ATCC 15444]
          Length = 426

 Score =  256 bits (653), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 146/428 (34%), Positives = 226/428 (52%), Gaps = 8/428 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGII--LAAGADALNAKFPTSALIHDCTGLVAVPG 60
           S  + N R++DP+ ++D  GAI++E+G I  +  G     A F  +A   D  GL   PG
Sbjct: 2   SLQIINARLLDPATELDAPGAILIEDGKISDIRTGE---GATFSDAATTIDAAGLCLAPG 58

Query: 61  IIDARVTLTGSP-DEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR 119
           +ID RV  TG P DE  + + T S+ A++GGITS ++MP      +D+   +++  E  R
Sbjct: 59  LIDLRVK-TGEPGDEQKETLQTASRAALSGGITSFVVMP-DTRPVIDDMALVQFIAERAR 116

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
             S   +YP   LT  + G  ++E+ L+ + G + F      + D QV+  +M YA    
Sbjct: 117 ETSKARIYPAGALTVGLAGLAMAEIGLMADAGAILFTNGDCPVADAQVMKRAMAYAASRG 176

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
           A V     +  L   GV+N G  A   GL GIP  +E +   RD+ +A+ TG       +
Sbjct: 177 ATVMSRPDERALTGSGVMNAGAFAARAGLSGIPPEAEWIGAMRDVTLAEQTGCRLILDQV 236

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           S  +++ +   A+    K     + ++L  NE DV  Y +  KV PP R E  R  +++A
Sbjct: 237 STARTLEIATAARKRGAKVFTTAAAHSLFFNERDVGDYLTYCKVNPPFRDEATRQGLIQA 296

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           L+ G+ID +VS H P+  + K LPF EA+FG+ GLET+LSA L L H   ++L + +  +
Sbjct: 297 LKDGEIDAVVSAHDPQPPEEKRLPFGEAAFGAAGLETVLSALLNLHHDGPLTLLEALAPV 356

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           +  PA I  LP G L     ADI L +    W  + +D+ S  KN+ FD     G+V+RT
Sbjct: 357 TIGPASILGLPQGRLAKDAPADIILFNAGKPWLCEREDLLSRSKNSPFDGRRLQGRVMRT 416

Query: 420 YISGKQVY 427
           ++ G+ V+
Sbjct: 417 FVGGESVF 424


>gi|88607405|ref|YP_504862.1| dihydroorotase, multifunctional complex type [Anaplasma
           phagocytophilum HZ]
 gi|123495632|sp|Q2GL89|PYRC_ANAPZ RecName: Full=Dihydroorotase; Short=DHOase
 gi|88598468|gb|ABD43938.1| dihydroorotase, multifunctional complex type [Anaplasma
           phagocytophilum HZ]
          Length = 447

 Score =  255 bits (652), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 145/427 (33%), Positives = 232/427 (54%), Gaps = 8/427 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGA---DALNAKFPTSALIHDCTGLVAVPGIIDA 64
           N RIIDP+   D  G ++     IL  G    D   A F  S ++ DC G V +PGI+D 
Sbjct: 25  NARIIDPASGTDYKGYLLTRGKEILDFGPGFFDPNGAAFAASEVV-DCNGHVLMPGIVDL 83

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V L     E+ + + T S+ A AGG+T+++  P  +   L+     KY        S +
Sbjct: 84  HVHLREPGGEHKETVDTGSRAAAAGGVTTVVCQPNTIPR-LENVLVAKYLKMRALESSCV 142

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           N+     +T +    E+ +M  L++ G + F    + + +   +  + +YA  L+ +VA 
Sbjct: 143 NIEFYGAVTKS--DGELCDMASLKDAGALGFTDDGLPVMNALYMKRAFEYAQDLDVVVAQ 200

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDL-LIAQHTGGHYHASVISIPQ 243
              D  L   G INEG+++  LGL GIP ISE++ ++RD+ L+ +  G HYH   IS  +
Sbjct: 201 HAEDCNLSDGGCINEGLVSRELGLKGIPDISESIMVSRDIQLLREVPGAHYHVLHISTKK 260

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           ++ +++ AK    + TC ++ ++ +LNE+ V  + ++ K+ PPLR+E +R+SM+  LE G
Sbjct: 261 ALDIVRAAKREGLRVTCEVTPHHFLLNESAVLEHGTMAKMNPPLRTEEDRLSMISGLEDG 320

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID I +DH P     K  P +  +FG +GLET+L  +L L+H   +SL  ++  L+++P
Sbjct: 321 TIDCIATDHAPHAAQEKTRPISCCAFGIVGLETLLPLSLELYHNAGMSLMDVLSKLTSKP 380

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+I  LP G +  G  AD+ + DL + WT+     SS  KN+ F      GKV+RT +SG
Sbjct: 381 AEIVRLPRGKIAKGLVADLVIFDLEHVWTIDTAKFSSKSKNSPFQGRKVKGKVLRTVVSG 440

Query: 424 KQVYTLE 430
           K VY  E
Sbjct: 441 KTVYRAE 447


>gi|296117480|ref|ZP_06836067.1| dihydroorotase, multifunctional complex type [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976001|gb|EFG82792.1| dihydroorotase, multifunctional complex type [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 431

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 151/434 (34%), Positives = 233/434 (53%), Gaps = 7/434 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAK-FPTSALIHDCTG-LVAV 58
           M++ V  N R+IDP+  +D  G ++V +G+I  AG D   A+  P  A I    G +V  
Sbjct: 1   MSATVFENVRLIDPASGLDRPGRLLVRDGLI--AGVDLPQAEGTPEGAAIVRGDGRMVLC 58

Query: 59  PGIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEE 117
           PG++D RVT+ G P  EY + + + ++ AVAGGIT+I ++P  + + +D+   ++     
Sbjct: 59  PGLVDMRVTI-GEPGFEYRETVASAARAAVAGGITTIAVLPNCLPT-IDDPALVRLLRTR 116

Query: 118 IRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHM 177
                +I + P   LT    G E++E+ LL E G V+F     +I DT+++   + Y+  
Sbjct: 117 GEETGMIGILPYGALTRGCAGSEMAEIGLLNEAGAVAFTDGIRAIGDTRLMRQLLTYSRA 176

Query: 178 LNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS 237
             A+V     D  L   G   +G +A  LGL GIP  +E + +ARDL +A+ TGG  H  
Sbjct: 177 FGAMVVQHPEDPSLARGGCATDGELATRLGLPGIPPAAEAILIARDLRLARMTGGRLHFG 236

Query: 238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMV 297
            +S  + + LI+ AKA   + TC  +     LNE  +  + +  K+ PPLR+E +R ++ 
Sbjct: 237 HVSTAEGLDLIRQAKADGLRVTCDTAPPYFDLNETVIGDFRTYAKLSPPLRAEADRRAVC 296

Query: 298 EALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIR 357
            AL  G ID I SDH P   D K  PFA A+ G  GL T+LS  L   H   ++L   + 
Sbjct: 297 AALADGTIDAIASDHAPCDADDKRQPFAVAAAGGTGLATLLSVTLAQVHAGNLTLSDALG 356

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            L+ RPA +     GTL TG  AD+ L D    W V+A ++    +NT FD     G+V+
Sbjct: 357 LLTHRPAALLRSKAGTLATGAPADLCLFDAERAWKVEAGELPGKAQNTPFDGRALEGRVL 416

Query: 418 RTYISGKQVYTLES 431
            T+ +G+QV+ L++
Sbjct: 417 ATWKAGRQVFGLDA 430


>gi|119385281|ref|YP_916337.1| dihydroorotase, multifunctional complex type [Paracoccus
           denitrificans PD1222]
 gi|119375048|gb|ABL70641.1| dihydroorotase [Paracoccus denitrificans PD1222]
          Length = 423

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 149/422 (35%), Positives = 230/422 (54%), Gaps = 7/422 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
             N R+IDP     E   + V +G I   GADA     P  A + DC G    PG+ID  
Sbjct: 5   FQNARLIDPETQSVEDATLTVRDGRIETVGADA-----PQGAELIDCGGRCLAPGLIDWG 59

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V +    + + ++  +    A AGG+T++I  P  M   +D    +++A       + +N
Sbjct: 60  VKIGEPGERHKESFRSAGLAAAAGGVTTVIARPDTMPP-IDAPESLEFATRRA-ADAPVN 117

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           +   A LT   +G+E+ EM  LQ+ G V+F      + DT++L   M YA  L A++   
Sbjct: 118 IRHMAALTRARQGREMVEMGFLQDAGAVAFTDGVRVVSDTRLLSRCMTYARGLGALIVGH 177

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             +  L        G  A+  GL  +  ++E + L RDL +   TG  YHA  I++  S+
Sbjct: 178 PQEPGLSKGTAATGGKFASLYGLPAVSPMAEVMGLDRDLALVAMTGARYHADQITVTASL 237

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
             ++ A+      T GISI++L LNE DV  Y +  +  PPLRSE +R++MVEA+ +G I
Sbjct: 238 PALRRAREAGLDVTAGISIHHLTLNEYDVGGYRTFFRFTPPLRSEEDRLAMVEAVAEGLI 297

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D+I S HTP+  ++K LPFAEA+ G++GL+T+L AA+RL+H   +SL +L RA+S  PA+
Sbjct: 298 DVIASFHTPQDEESKRLPFAEAAPGAVGLQTLLPAAMRLYHQGGLSLPQLWRAMSLNPAR 357

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
              LPGG L  G  AD+ L D +  + +    + S  KNT FD     G+V+ T+++G++
Sbjct: 358 RLGLPGGRLSAGAPADLVLFDPDAPFVLDRFTLLSKSKNTPFDGARMEGRVLGTWVAGRR 417

Query: 426 VY 427
           V+
Sbjct: 418 VF 419


>gi|332559476|ref|ZP_08413798.1| Dihydroorotase [Rhodobacter sphaeroides WS8N]
 gi|332277188|gb|EGJ22503.1| Dihydroorotase [Rhodobacter sphaeroides WS8N]
          Length = 425

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 147/425 (34%), Positives = 233/425 (54%), Gaps = 5/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S +L N R+IDP    +  GA+++E G+I A GA     + P  A + DC G    PGI+
Sbjct: 2   SLLLTNARLIDPEAGTETEGALLIEGGLIAAVGA----LEPPPGAEVIDCGGKCLAPGIV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V +    + + ++  +    A AGG+T+II  P  M + +D    +++        S
Sbjct: 58  DLGVKVGEPGERHRESFRSAGLAAAAGGVTTIIARPDTMPA-IDTPEVLEFVTRRAAEAS 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            + +   A LT   EG+E+ E+  L + G V+F      I  T+V    M YA  L A+V
Sbjct: 117 PVRIRHMAALTKGREGREMVELGFLLDTGAVAFSDCDHVIETTKVAARCMTYARSLGALV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L +      G  A+  G+  +  ++E +   RD+ + + +G  YHA  ++  
Sbjct: 177 IGHPQDPGLSAGASATNGKFASLRGIPAVHPMAERMGFDRDMALVEMSGVRYHADQVTTA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +++  ++ AKA+    T G+ I++L LNE DV  Y +  K+ PPLRSE +R++MVEA+  
Sbjct: 237 RTLPALERAKANGLDVTAGVGIHHLTLNEFDVGDYRTFFKLKPPLRSEEDRLAMVEAVGS 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G IDII S HTP+  ++K LPF EA++G++ LET L AALRL+H  +++L +L RA++  
Sbjct: 297 GLIDIISSMHTPQDEESKRLPFEEAAWGAVALETFLPAALRLYHAGRLTLPQLFRAMALN 356

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+   LP G L  G  AD+ L D +  + +    + S  KNT FD +   G+V+ TY+ 
Sbjct: 357 PAKRLGLPQGRLSEGAPADLVLFDPDAPFVLDRFTLRSKSKNTPFDGQRMEGRVLATYVG 416

Query: 423 GKQVY 427
           G++VY
Sbjct: 417 GRRVY 421


>gi|297184213|gb|ADI20331.1| dihydroorotase and related cyclic amidohydrolases [uncultured alpha
           proteobacterium EB080_L27A02]
          Length = 425

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 141/424 (33%), Positives = 229/424 (54%), Gaps = 2/424 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           + +N RII+P    D +G++++EN  I     +  +       +I DC      PGI+D 
Sbjct: 4   LFSNARIINPEAQTDSLGSVLIENDKITGIYNNNSSLDLKIDKII-DCEQNCLAPGIVDI 62

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V +    + + ++  +    A  GGIT++++ P   +  +D    +++        S++
Sbjct: 63  GVKVGEPGERHKESFKSAGVAAANGGITTMVIRP-DTNPTVDSPEILEFIYRRAVSDSIV 121

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
            V P A LT    GKE++E+  L++ G V+F      I D +VLL  + YA  LNA++  
Sbjct: 122 KVLPMAALTKGRNGKEMAEIGFLKDAGAVAFTDCDQVISDNKVLLRCLTYAKGLNALIIT 181

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              +  L        G +A  LGL  + + +E + L RD+ + + T    H   ++  +S
Sbjct: 182 HPQEPILSKDACATSGALATKLGLPSVSTFAELIQLQRDISLIEMTNSKVHFDQVTCTES 241

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
            A +K  K      + GISI++L LNE D+E Y +  KV PPLR+ET+RM+ +EA+  G 
Sbjct: 242 FAALKQGKKKGLSISAGISIHHLTLNEQDIEGYPTFFKVKPPLRNETDRMAAIEAVSSGL 301

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID+I S HTP+  ++K LPF  A+ G++GLET+L AAL+L HG  + L  L RALS  PA
Sbjct: 302 IDVISSMHTPQDEESKRLPFEAAASGAVGLETLLPAALQLVHGGHMDLPTLWRALSYNPA 361

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++  L  G ++ G  AD+ L D +  + +    + S  KNT +D     GKV++T ++GK
Sbjct: 362 KLLGLNTGQMKVGYPADLVLFDPDKPFILDRSKLHSKSKNTPYDGRTMQGKVIQTIVAGK 421

Query: 425 QVYT 428
           +VY+
Sbjct: 422 EVYS 425


>gi|118580940|ref|YP_902190.1| dihydroorotase, multifunctional complex type [Pelobacter
           propionicus DSM 2379]
 gi|166234176|sp|A1AS12|PYRC_PELPD RecName: Full=Dihydroorotase; Short=DHOase
 gi|118503650|gb|ABL00133.1| dihydroorotase [Pelobacter propionicus DSM 2379]
          Length = 424

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 144/425 (33%), Positives = 229/425 (53%), Gaps = 4/425 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++ N R+IDPS+ +DE   ++VENG++   G   L A  P    I D  G   VPG++
Sbjct: 2   NLLIQNGRVIDPSQGLDEELDLLVENGLVREMG-RGLTA--PAGVEIVDAAGCCVVPGLV 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     EY ++I + S+ AVAGG TSI  MP      +D     +Y +   R   
Sbjct: 59  DMHVHLREPGLEYKEDIESGSRAAVAGGFTSIACMP-NTKPVIDNKALARYVIARGREAG 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L NV+P  CLT+  +G+ ++EM  L+E G V+       + + +++  +++YA  +   V
Sbjct: 118 LCNVFPVGCLTAGSKGERLAEMGELKEAGCVAVSDDGRPVVNAELMRRALEYARGMQIPV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   GV+NEG  +  LGL GIP ++E + +ARD+++A++T    H + +S  
Sbjct: 178 ISHAEDLSLVGEGVMNEGFTSTELGLKGIPRVAEDIAIARDVMLAEYTNSPIHIAHVSTS 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++ +I++AK    + TC  + +   L ++ V  YN+  K+ PPLR   +  ++   L  
Sbjct: 238 GAVRIIRNAKLRGVRVTCETAPHYFTLTDDAVRGYNTNAKMNPPLREADDVAAIRAGLSD 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID+I +DH P H+D K + F  A+ G IGLET L  +L L     +++ +L+  +S  
Sbjct: 298 GTIDVIATDHAPHHLDEKDVEFNVAANGIIGLETSLPLSLALVEQGVLTMSQLVERMSCC 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           P+ I  L  GTL  G  ADI LID    W V+AD ++S   NT +  +   G  V T ++
Sbjct: 358 PSLILGLERGTLAKGAVADITLIDPTLPWVVEADKLASKSTNTPWMGQEMKGAAVATIVA 417

Query: 423 GKQVY 427
           G+ VY
Sbjct: 418 GRVVY 422


>gi|89056396|ref|YP_511847.1| dihydroorotase [Jannaschia sp. CCS1]
 gi|88865945|gb|ABD56822.1| dihydroorotase [Jannaschia sp. CCS1]
          Length = 422

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 152/427 (35%), Positives = 232/427 (54%), Gaps = 9/427 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT+ +L+N R+IDP    + +G + +E G+I   G        P +  + DC GL   PG
Sbjct: 1   MTNALLHNARLIDPEAGTETLGWVRIEAGLIAEVG------DGPRAGGL-DCGGLCLAPG 53

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           I+D  V +    + + ++  T  + A AGG+T+++  P   ++ +D    + +     R 
Sbjct: 54  IVDVGVKVGEPGERHKESFRTAGRAAAAGGVTTMVTRP-DTTTPIDTPEVLDFVTRRGRD 112

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            S + V P A LT   EG+E+ E+  L++ G V+F      + +T+VL   M YA  L A
Sbjct: 113 HSAVRVAPMAALTRAREGREMVEIGFLRDAGAVAFSDGDQVVTNTKVLSRCMTYARSLGA 172

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++     +  L     +  G  A+  GL     ++E + L RDL + + TG  YHA  IS
Sbjct: 173 LIVGHPQEPILSDGAAVTSGKFASLRGLPAASPMAERMGLERDLALVEMTGVAYHADQIS 232

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              ++  +  AKA     T G+SI++L LNE DV  Y +  K+ PPLRSE +R +MVEA+
Sbjct: 233 TTNALPALARAKA-ALDVTAGVSIHHLTLNEFDVADYRTFFKLKPPLRSEDDRSAMVEAV 291

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G IDII S HTP+  ++K LPF  A+ G++GLET+L AA+RL H  Q++L +L RALS
Sbjct: 292 RDGTIDIICSMHTPQDEESKRLPFEVAASGAVGLETLLPAAMRLVHSGQLTLPELFRALS 351

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+ F  P G L  G  AD+ L D +  + +    + S  KNT FD     G+V+RT+
Sbjct: 352 LNPARRFGQPSGRLSAGAPADLILFDPDKPFQLDRATLRSKSKNTPFDGARMQGRVMRTW 411

Query: 421 ISGKQVY 427
           + G  V+
Sbjct: 412 VGGNTVF 418


>gi|297183990|gb|ADI20110.1| dihydroorotase and related cyclic amidohydrolases [uncultured alpha
           proteobacterium EB080_L06A09]
          Length = 426

 Score =  254 bits (648), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 141/424 (33%), Positives = 230/424 (54%), Gaps = 2/424 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           + +N RII+P    D +G++++EN  I     +  +  F    +I DC      PGI+D 
Sbjct: 4   LFSNARIINPETLSDTLGSVLIENETIAGVYNNNPSFDFKIDKVI-DCEQNCLAPGIVDI 62

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V +    + + ++  +    A  GGIT++++ P      +D    +++        S++
Sbjct: 63  GVKIGEPGERHKESFKSAGLAAANGGITTMVIRP-DTDLTVDSPEILEFIYRRAVSDSIV 121

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
            V P A LT    G E++E+  L++ G V+F      I D +VLL  + YA  LNA++  
Sbjct: 122 KVLPMAALTKGRNGAEMAEIGFLKDAGAVAFTDCDQVITDNKVLLRCLTYAKGLNALIIT 181

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              +  L        G +A  LGL  + + +E + L RD+ + + T    H   ++   S
Sbjct: 182 HPQEPILSQDACATSGALATKLGLPSVSTFAELIQLQRDMSLIEMTNSKVHFDQVTCSDS 241

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           IA +K  K      + G+SI++L LNE D+E Y +  KV PPLR+ET+R++ +EA+  G 
Sbjct: 242 IAALKQGKDKGLSISAGVSIHHLTLNEQDIEGYPTFFKVKPPLRNETDRIAAIEAVSSGT 301

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           IDII S HTP+  ++K LPF  ++ G++GLET+L AAL+L HG  + L  L RALS  PA
Sbjct: 302 IDIISSMHTPQDEESKRLPFEASASGAVGLETLLPAALQLVHGDYMDLPTLWRALSLNPA 361

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++  L  G ++ G  AD+ L DLN  + +    ++S  KNT FD     G+V++T +SG+
Sbjct: 362 KLLGLSTGRIKVGCPADLVLFDLNKPFILDRTKLNSKSKNTPFDGRTMQGRVIKTIVSGQ 421

Query: 425 QVYT 428
           +V++
Sbjct: 422 EVHS 425


>gi|304570571|ref|YP_384726.2| dihydroorotase [Geobacter metallireducens GS-15]
 gi|172046637|sp|Q39US3|PYRC_GEOMG RecName: Full=Dihydroorotase; Short=DHOase
          Length = 424

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 147/425 (34%), Positives = 230/425 (54%), Gaps = 4/425 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++   R+IDPS+ IDEV  I+VENG +   G      K P+     D +GL+  PG+I
Sbjct: 2   NLLIQGGRVIDPSQGIDEVLDILVENGAVKELGK---GVKAPSGTETIDASGLIVTPGLI 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     EY ++I + +K A AGG TS+  MP       D      Y + + + + 
Sbjct: 59  DMHVHLRDPGHEYKEDIVSGTKAAAAGGFTSVACMP-NTKPVNDNKAVTSYIIAKAKAEG 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            +NV+P   +T   +G+ +SEM  L+E G V+       + +++++  +++YA  +  +V
Sbjct: 118 SVNVFPVGSITQGSKGELLSEMGELKESGCVAVSDDGHPVTNSELMRRALEYAKGMGIMV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   GV+NEG ++  LGL GIP  +E    ARD+ +A+ T    H + +S  
Sbjct: 178 ISHAEDLSLVGAGVMNEGFVSTELGLKGIPWAAEDAATARDVYLAEFTDSPLHIAHVSTK 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S+ +I++AKA   K TC  + +   L ++ V  Y++  K+ PPLR+  +  ++ EAL+ 
Sbjct: 238 GSLRIIRNAKARGVKVTCETAPHYFSLTDDAVRGYDTNAKMNPPLRTADDVTAVKEALKD 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID I +DH P H+D K L F EA  G +GLET L+ +LRL     ++L  L+  ++  
Sbjct: 298 GTIDAIATDHAPHHIDEKDLEFNEALNGIVGLETSLTLSLRLVEEGVLTLPVLVDKMACN 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+I  +  GTL+ G+ ADI +ID    WTV AD ++S  KN+ F      G    T + 
Sbjct: 358 PAKILGIDRGTLKPGSVADITVIDPKATWTVDADKLASKSKNSPFLGWEVKGAAAFTIVG 417

Query: 423 GKQVY 427
           GK VY
Sbjct: 418 GKVVY 422


>gi|114771333|ref|ZP_01448753.1| dihydroorotase, multifunctional complex type [alpha proteobacterium
           HTCC2255]
 gi|114548258|gb|EAU51145.1| dihydroorotase, multifunctional complex type [alpha proteobacterium
           HTCC2255]
          Length = 425

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 141/424 (33%), Positives = 229/424 (54%), Gaps = 2/424 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           + +N RII+P    D +G++++EN  I     +  +       +I DC      PGI+D 
Sbjct: 4   LFSNARIINPEAQTDSLGSVLIENDKITGIYNNNSSLDLKIDKII-DCEQNCLAPGIVDI 62

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V +    + + ++  +    A  GGIT++++ P   +  +D    +++        S++
Sbjct: 63  GVKVGEPGERHKESFKSAGVAAANGGITTMVIRP-DTNPTVDSPEILEFIYRRAVSDSIV 121

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
            V P A LT    GKE++E+  L++ G V+F      I D +VLL  + YA  LNA++  
Sbjct: 122 KVLPMAALTKGRNGKEMAEIGFLKDAGAVAFTDCDQVITDNKVLLRCLTYAKGLNALIIT 181

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              +  L        G +A  LGL  + + +E + L RD+ + + T    H   ++  +S
Sbjct: 182 HPQEPILSKDACATSGALATKLGLPSVSTFAELIQLQRDISLIEMTNSKVHFDQVTCTES 241

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
            A +K  K      + GISI++L LNE D+E Y +  KV PPLR+ET+RM+ +EA+  G 
Sbjct: 242 FAALKQGKKKGLSISAGISIHHLTLNEQDIEGYPTFFKVKPPLRNETDRMAAIEAVSSGL 301

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID+I S HTP+  ++K LPF  A+ G++GLET+L AAL+L HG  + L  L RALS  PA
Sbjct: 302 IDVISSMHTPQDEESKRLPFEAAASGAVGLETLLPAALQLVHGGYMDLPTLWRALSYNPA 361

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++  L  G ++ G  AD+ L D +  + +    + S  KNT +D     GKV++T ++GK
Sbjct: 362 KLLGLNTGQMKVGYQADLVLFDPDKPFILDRSKLHSKSKNTPYDGRTMQGKVIQTIVAGK 421

Query: 425 QVYT 428
           +VY+
Sbjct: 422 EVYS 425


>gi|78194234|gb|ABB32001.1| dihydroorotase [Geobacter metallireducens GS-15]
          Length = 422

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 147/424 (34%), Positives = 229/424 (54%), Gaps = 4/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++   R+IDPS+ IDEV  I+VENG +   G      K P+     D +GL+  PG+ID
Sbjct: 1   MLIQGGRVIDPSQGIDEVLDILVENGAVKELGK---GVKAPSGTETIDASGLIVTPGLID 57

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     EY ++I + +K A AGG TS+  MP       D      Y + + + +  
Sbjct: 58  MHVHLRDPGHEYKEDIVSGTKAAAAGGFTSVACMP-NTKPVNDNKAVTSYIIAKAKAEGS 116

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NV+P   +T   +G+ +SEM  L+E G V+       + +++++  +++YA  +  +V 
Sbjct: 117 VNVFPVGSITQGSKGELLSEMGELKESGCVAVSDDGHPVTNSELMRRALEYAKGMGIMVI 176

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  L   GV+NEG ++  LGL GIP  +E    ARD+ +A+ T    H + +S   
Sbjct: 177 SHAEDLSLVGAGVMNEGFVSTELGLKGIPWAAEDAATARDVYLAEFTDSPLHIAHVSTKG 236

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +I++AKA   K TC  + +   L ++ V  Y++  K+ PPLR+  +  ++ EAL+ G
Sbjct: 237 SLRIIRNAKARGVKVTCETAPHYFSLTDDAVRGYDTNAKMNPPLRTADDVTAVKEALKDG 296

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID I +DH P H+D K L F EA  G +GLET L+ +LRL     ++L  L+  ++  P
Sbjct: 297 TIDAIATDHAPHHIDEKDLEFNEALNGIVGLETSLTLSLRLVEEGVLTLPVLVDKMACNP 356

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+I  +  GTL+ G+ ADI +ID    WTV AD ++S  KN+ F      G    T + G
Sbjct: 357 AKILGIDRGTLKPGSVADITVIDPKATWTVDADKLASKSKNSPFLGWEVKGAAAFTIVGG 416

Query: 424 KQVY 427
           K VY
Sbjct: 417 KVVY 420


>gi|260575957|ref|ZP_05843952.1| dihydroorotase, multifunctional complex type [Rhodobacter sp. SW2]
 gi|259021883|gb|EEW25184.1| dihydroorotase, multifunctional complex type [Rhodobacter sp. SW2]
          Length = 424

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 148/422 (35%), Positives = 228/422 (54%), Gaps = 6/422 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
             N R+I+P    D +G++ V  G+I A     L+   P  A I DC G    PGI+D  
Sbjct: 5   FTNARLINPETGSDALGSLTVAGGLITA-----LDGPAPEGARIIDCGGKCLAPGIVDLG 59

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V +    + + ++  +    A AGG+T+II  P   +  +D    +++     R  S + 
Sbjct: 60  VKIGEPGERHRESFRSAGLAAAAGGVTTIIARP-DTAPAIDTPETLEFVTRRARDASPVR 118

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           ++  A LT    G+E++E+  L + G ++F        D++VL  +  YA  L A+V   
Sbjct: 119 IHHMAALTKGRAGREMTEIGFLLDAGALAFTDCDHVTTDSKVLSRAFTYARSLGALVIGH 178

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D  L +   +  G  A+  GL G+  ++E + L RDL + + TG  YHA  I+  QS+
Sbjct: 179 PQDPGLSAGAAVTSGKFASLRGLPGVHPLAERLGLERDLALVEMTGVRYHADQITCAQSL 238

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
             +  AK      T GISI++L LN+ DV  Y +  K+ PPLR+E +R++MV+A+  G I
Sbjct: 239 PALARAKDAGLDVTAGISIHHLTLNDLDVGDYRTFFKLTPPLRAEADRLAMVQAVADGLI 298

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D+I S HTP+  ++K LPF EA+ G++GL+T+L AA+RL+H   I L  L RAL+  PA+
Sbjct: 299 DVICSMHTPQDEESKRLPFEEAASGAVGLQTLLPAAMRLYHAGAIDLPGLFRALALNPAR 358

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
              LP G L TG  AD+ L D +  + +    + S  +NT FD E   GKV+ TY+ G  
Sbjct: 359 RLGLPQGRLATGAPADLVLFDPDTPFVLDRATLLSKSRNTPFDGERLEGKVLATYLGGAS 418

Query: 426 VY 427
           V+
Sbjct: 419 VF 420


>gi|126463423|ref|YP_001044537.1| dihydroorotase, multifunctional complex type [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126105087|gb|ABN77765.1| dihydroorotase [Rhodobacter sphaeroides ATCC 17029]
          Length = 425

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 146/425 (34%), Positives = 233/425 (54%), Gaps = 5/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S +L N R+IDP    +  G +++E+G+I A GA     + P  A + DC G    PGI+
Sbjct: 2   SLLLTNARLIDPQAGTETEGDLLIESGLIAAVGA----LETPAGAEVIDCGGKCLAPGIV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V +    + + ++  +    A AGG+T+II  P  M + +D    +++        S
Sbjct: 58  DLGVKVGEPGERHRESFRSAGLAAAAGGVTTIIARPDTMPA-IDTPEVLEFVTRRAAEAS 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            + +   A LT   EG+E+ E+  L + G V+F      I  T+V    M YA  L A+V
Sbjct: 117 PVRIRHMAALTRGREGREMVELGFLLDTGAVAFSDCDHVIETTKVAARCMTYARSLGALV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L +      G  A+  G+  +  ++E +   RD+ + + +G  YHA  ++  
Sbjct: 177 IGHPQDPGLSAGASATNGKFASLRGIPAVHPMAERMGFDRDMALVEMSGVRYHADQVTTA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +++  ++ AKA+    T G+ I++L LNE DV  Y +  K+ PPLRSE +R++MVEA+  
Sbjct: 237 RTLPALERAKANGLDVTAGVGIHHLTLNEFDVGDYRTFFKLKPPLRSEEDRLAMVEAVGS 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G IDII S HTP+  ++K LPF EA++G++ LET L AALRL+H  +++L +L RA++  
Sbjct: 297 GLIDIISSMHTPQDEESKRLPFEEAAWGAVALETFLPAALRLYHAGRLTLPQLFRAMALN 356

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+   LP G L  G  AD+ L D +  + +    + S  KNT FD +   G+V+ TY+ 
Sbjct: 357 PAKRLGLPQGRLSEGAPADLVLFDPDAPFVLDRFTLRSKSKNTPFDGQRMEGRVLATYVG 416

Query: 423 GKQVY 427
           G++VY
Sbjct: 417 GRRVY 421


>gi|114778473|ref|ZP_01453317.1| dihydroorotase, multifunctional complex type [Mariprofundus
           ferrooxydans PV-1]
 gi|114551198|gb|EAU53757.1| dihydroorotase, multifunctional complex type [Mariprofundus
           ferrooxydans PV-1]
          Length = 430

 Score =  253 bits (646), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 139/426 (32%), Positives = 229/426 (53%), Gaps = 5/426 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++ N  IIDP+  ID V  + + +G I  AG  +   + P   +  D TG V  PG+I
Sbjct: 4   TLLIKNGHIIDPANGIDTVADLWINDGRI--AGIGSFEGEQPDQLV--DATGKVVCPGLI 59

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     E+ ++I + S+ AVAGG+TS+  MP      +D        +   R  +
Sbjct: 60  DMHVHLREPGQEWKEDIESGSRAAVAGGVTSMCCMP-NTGPHIDHAGIALQIVARARQVN 118

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L NV+P   +T N++GKE++EMR L   G V+F    + I    V+  +++Y+     +V
Sbjct: 119 LCNVHPIGAVTKNLDGKELTEMRELSRAGCVAFSDDGLPIWHAGVMRKALEYSASFGFMV 178

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                +  L   G +NEG I+  LG+ G+P+  E   +ARD+++ +     YH + IS  
Sbjct: 179 IQHAEEKALTKGGAVNEGWISTQLGVEGMPAAGEDSMIARDIMLTKLADARYHVAHISTA 238

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++ L++ A+    K T   + ++  L E++V  YNS  K+ PPLR+E +R+++VE L  
Sbjct: 239 GAVELVRQARKQGLKVTTEAAPHHFALTEDEVLGYNSDAKMSPPLRTEADRLAVVEGLRD 298

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G I++I +DH P H D K    + A+FG +GLETML  +L L     +S+  +I  ++  
Sbjct: 299 GTIEVIATDHAPHHEDDKRCGLSCAAFGIVGLETMLPVSLELVRDGVLSMSDMIAKMTCN 358

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA++  L  GTL TG  AD+ + D +  W +  + + S  KNT +  +  TG+V  T  +
Sbjct: 359 PARLLGLDSGTLSTGADADVTIFDADATWMLDRNKLVSKGKNTPWHGKQMTGRVTHTIKA 418

Query: 423 GKQVYT 428
           G+ V++
Sbjct: 419 GRVVFS 424


>gi|206889471|ref|YP_002249056.1| dihydroorotase [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741409|gb|ACI20466.1| dihydroorotase [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 435

 Score =  252 bits (644), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 149/428 (34%), Positives = 231/428 (53%), Gaps = 8/428 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGAD------ALNAKFPTSALIHDCTGLVAVPGI 61
           N  IIDP  + + +  I +++GII            AL+ +   S L  D +GL   PG+
Sbjct: 7   NAYIIDPFTNKEGIADIFIDDGIISKVKFKRKITPIALSLQPSVSILEIDASGLYVFPGL 66

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           ID    L     EY + I T +  AV GG TS+  M    +   D      Y L + + +
Sbjct: 67  IDMHTHLREPGYEYKETIRTGTLAAVRGGFTSVCCMA-NTNPVNDNPEVTYYILAKAKEE 125

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
              +VYP   +T  ++G+E+SEM +L+E G V+F    M + ++ ++  +++Y+  + A 
Sbjct: 126 GSCDVYPIGAITKGLKGEELSEMAMLREAGCVAFSDDGMPVMNSLIMRRALEYSKAVGAP 185

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           +     D  L   GV+NEG ++ YLGL GIP  SE V ++RD+++++H     H + +S 
Sbjct: 186 IISHCEDLSLSEDGVMNEGKLSFYLGLKGIPKASEEVMVSRDVILSKHFKTSVHIAHVST 245

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
             S+ +IK AK      T     +   L E  V  YN+  KV PPLRSE +R ++  AL 
Sbjct: 246 KGSVEIIKKAKEEGVSVTAETCPHYFTLTEEAVSGYNTNAKVNPPLRSEEDREAIKNALS 305

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID+I +DH P H+D K +PF EA  G  GLET  + +L+L H + ++L+KLI  L+ 
Sbjct: 306 DGIIDVIATDHAPHHIDEKKVPFQEALNGISGLETAFAISLKLVHDKILNLRKLIEKLTL 365

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            P++I NL    ++ G   D+ L+D+N  WTVK D   S+ KNT FD     GKV+ T +
Sbjct: 366 NPSKILNLKKEGIKEGAQGDLILVDINKNWTVKKDKFVSLGKNTPFDGWKLKGKVLFT-V 424

Query: 422 SGKQVYTL 429
            GK+++ +
Sbjct: 425 KGKKIFDM 432


>gi|322419238|ref|YP_004198461.1| dihydroorotase, multifunctional complex type [Geobacter sp. M18]
 gi|320125625|gb|ADW13185.1| dihydroorotase, multifunctional complex type [Geobacter sp. M18]
          Length = 424

 Score =  252 bits (644), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 145/425 (34%), Positives = 227/425 (53%), Gaps = 4/425 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++   R+IDPS+ IDE   I++ +G++L  G   L A  P      D +GL+  PG+I
Sbjct: 2   NLLIKGGRLIDPSQGIDETMDILIADGVVLELG-QGLAA--PEGTQTIDASGLLVTPGLI 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     EY ++I T S+ A AGG TS+  MP   S  +D      Y + + + ++
Sbjct: 59  DMHVHLRDPGLEYKEDIATGSRAAAAGGFTSVACMP-NTSPVIDSKAIASYIVNKAKSEA 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+NV+P  C+T   +G+ ++EM  L+E G V        + +++++  +++YA  +   V
Sbjct: 118 LVNVFPIGCITKGGKGESLAEMGELKEAGCVGVSDDGKPVCNSELMRRALEYAKGIGITV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
              + D  L   GV+NEG ++  LGL GIP  +E + +AR++ +A+  G   H + IS  
Sbjct: 178 ISHSEDLGLVGEGVMNEGFVSTELGLKGIPWAAEDIAVAREVYLAEFAGAPVHIAHISTA 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S  +I++AKA   K TC  + +   L +  V  YN+  K+ PPLR E +  +M  AL  
Sbjct: 238 GSARVIRNAKARGVKVTCETAPHYFTLTDEAVRGYNTNAKMNPPLRGEADVAAMKAALAD 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID I +DH P H D K + F  A  G +GLET L  +L+L     + L  L+  +S  
Sbjct: 298 GTIDAIATDHAPHHPDEKDVEFNVALNGIVGLETSLPLSLKLVEEGVLDLNGLVSVMSCN 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+I  +  GTL+ G   D+ +ID   +W V+A  + S  KN+ F      GK V T + 
Sbjct: 358 PAKILGIDRGTLRVGAVGDVTVIDPTKKWQVEAAKLESKSKNSPFIGWKLKGKAVYTVVK 417

Query: 423 GKQVY 427
           G+ VY
Sbjct: 418 GQVVY 422


>gi|77464583|ref|YP_354087.1| dihydroorotase [Rhodobacter sphaeroides 2.4.1]
 gi|77389001|gb|ABA80186.1| dihydroorotase [Rhodobacter sphaeroides 2.4.1]
          Length = 425

 Score =  252 bits (644), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 146/425 (34%), Positives = 232/425 (54%), Gaps = 5/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S +L N R+IDP    +  G +++E G+I A GA     + P  A + DC G    PGI+
Sbjct: 2   SLLLTNARLIDPEGGTETEGDLLIEGGLIAAVGA----LEPPPGAEVIDCGGKCLAPGIV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V +    + + ++  +    A AGG+T+II  P  M + +D    +++        S
Sbjct: 58  DLGVKVGEPGERHRESFRSAGLAAAAGGVTTIIARPDTMPA-IDTPEVLEFVTRRAAEAS 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            + +   A LT   EG+E+ E+  L + G V+F      I  T+V    M YA  L A+V
Sbjct: 117 PVRIRHMAALTRGREGREMVELGFLLDTGAVAFSDCDHVIETTKVAARCMTYARSLGALV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L +      G  A+  G+  +  ++E +   RD+ + + +G  YHA  ++  
Sbjct: 177 IGHPQDPGLSAGASATNGKFASLRGIPAVHPMAERMGFDRDMALVEMSGVRYHADQVTTA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +++  ++ AKA+    T G+ I++L LNE DV  Y +  K+ PPLRSE +R++MVEA+  
Sbjct: 237 RTLPALERAKANGLDVTAGVGIHHLTLNEFDVGDYRTFFKLKPPLRSEEDRLAMVEAVGS 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G IDII S HTP+  ++K LPF EA++G++ LET L AALRL+H  +++L +L RA++  
Sbjct: 297 GLIDIISSMHTPQDEESKRLPFEEAAWGAVALETFLPAALRLYHAGRLTLPQLFRAMAIN 356

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+   LP G L  G  AD+ L D +  + +    + S  KNT FD +   G+V+ TY+ 
Sbjct: 357 PAKRLGLPQGRLSDGAPADLVLFDPDAPFVLDRFTLRSKSKNTPFDGQRMEGRVLATYVG 416

Query: 423 GKQVY 427
           G++VY
Sbjct: 417 GRRVY 421


>gi|226226922|ref|YP_002761028.1| dihydroorotase [Gemmatimonas aurantiaca T-27]
 gi|226090113|dbj|BAH38558.1| dihydroorotase [Gemmatimonas aurantiaca T-27]
          Length = 431

 Score =  252 bits (643), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 139/427 (32%), Positives = 224/427 (52%), Gaps = 5/427 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L   RI+DPS+ +D VG ++V NG+I  AG+       P  A + D +GLV  PG+ID
Sbjct: 8   LLLRGGRIVDPSQSLDVVGDVLVRNGVIEHAGS---TIGTPDGAEVVDVSGLVVAPGLID 64

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             + L     E  + + T +  AVAGG T +  MP       D    + +   +      
Sbjct: 65  VHIHLREPGREDVETVATGAHSAVAGGFTGVCAMP-NTKPVTDNQATVGFVKRQGEAAGF 123

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             VYP   ++   +G+ ++E   + + G V+F      +    ++  +++YA   N  VA
Sbjct: 124 ARVYPYGAISLGQKGETLAEFGEMVQAGAVAFSDDGRPVESAHLMRTALEYARAFNVPVA 183

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  L   G +NEG+++  LGL GIP+ +E + + RD+L+A+ TGGH H   +S   
Sbjct: 184 EHCEDMTLARGGSMNEGLMSAKLGLKGIPAEAEEIYVIRDILLAKRTGGHIHMCHLSTKG 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ L++  K      T  +  +++ L E  V+ YN+  K+ PPLR++ +  ++   L  G
Sbjct: 244 SVELVRWGKERGINVTAEVCSHHISLTEAAVDGYNTNAKMNPPLRTQEDIDALQAGLADG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSA-ALRLFHGQQISLKKLIRALSTR 362
            ID++V+DH P H D K   FA+A  G +GLET L      L H   ++L ++I A+S +
Sbjct: 304 TIDLLVTDHAPHHYDEKEREFADAPNGIVGLETALGVNCTYLLHPGVMTLSQMIDAMSCK 363

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA++F+LPGGTL  G   D+++ D N +WTV      S  +NT +     TG+ + T + 
Sbjct: 364 PAKVFHLPGGTLTRGAVGDVSVFDPNKKWTVDPKQFKSKGRNTPYGGHELTGQALLTVVG 423

Query: 423 GKQVYTL 429
           G+ VY L
Sbjct: 424 GRVVYRL 430


>gi|288958405|ref|YP_003448746.1| dihydroorotase [Azospirillum sp. B510]
 gi|288910713|dbj|BAI72202.1| dihydroorotase [Azospirillum sp. B510]
          Length = 431

 Score =  252 bits (643), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 148/427 (34%), Positives = 224/427 (52%), Gaps = 3/427 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V  + R++DP+  +D+ G ++++   I   G    N   P  A + D  GL   PG++D 
Sbjct: 6   VYRDARLLDPATGLDQRGDLLIDGETIADFGPGLFNDSTPDGAEVIDLAGLCLAPGLVDM 65

Query: 65  RVTLTGSPDEYSKN-ITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           RV L G P E  K+ I + S+ A AGGIT++ L+P      LDE   +++     R   L
Sbjct: 66  RV-LIGEPGEEEKDTIKSASRAAAAGGITAMALLP-NTDPVLDEVAGLEFIARRAREVKL 123

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V+     T   EG EI+EM LL + G V+F     +I   + +  ++ YA     ++ 
Sbjct: 124 VKVFAYGSATRGTEGNEITEMGLLGQAGAVAFTDGTKAIASAKTMRRALSYAKTFGKLIV 183

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               +  L + G++N G IA  LGLVGIP  +E + + RDL +A+ TGG  H + ++  +
Sbjct: 184 QHPEEPSLAAGGMMNSGEIATRLGLVGIPREAEIIMIERDLRLAELTGGRLHFAHVTTGE 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ LI+ AKA     TC  + +   L E DV  Y +  KV PPLR E +R ++VE L  G
Sbjct: 244 SVDLIRRAKARGLTVTCDTAPHYFALTETDVGDYRTYAKVSPPLRGEMDRRAIVEGLADG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID I SDH P+  D K LPFA+A+ G IGLET+    L L H  ++ L K +  ++  P
Sbjct: 304 TIDAIASDHVPQDQDQKRLPFAQAAPGVIGLETLFPLTLELVHKGRMPLLKALACVTANP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A I +L  G +  G  AD+ + D +  W V      S  KN+ F+     G+ +RT + G
Sbjct: 364 AAILDLAVGRIVKGGPADLVVFDADVPWQVDVSRFKSKSKNSPFENRPVQGRPLRTIVDG 423

Query: 424 KQVYTLE 430
           + V+  E
Sbjct: 424 RTVWQAE 430


>gi|163738864|ref|ZP_02146277.1| dihydroorotase, multifunctional complex type [Phaeobacter
           gallaeciensis BS107]
 gi|161387669|gb|EDQ12025.1| dihydroorotase [Phaeobacter gallaeciensis BS107]
          Length = 436

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 148/432 (34%), Positives = 234/432 (54%), Gaps = 11/432 (2%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILA-----AGADAL----NAKFPTSALIHDCTGL 55
           +  N R+IDP    D +GA++V+NG I A      G+D L    N       LI DC G 
Sbjct: 4   LFTNARLIDPEAGTDSIGAVLVQNGRIAAVDKNGTGSDQLFRTRNIGAEDVTLI-DCRGK 62

Query: 56  VAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYAL 115
              PGI+D  V +    + + ++  +    A AGG+T+++  P    S +D    +++  
Sbjct: 63  CLAPGIVDIGVKVCEPGERHKESYKSAGLAAAAGGVTTMVTRPDTTPS-IDSPETLEFVT 121

Query: 116 EEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYA 175
              +  + +NV P A LT    G+E++E+  L + G V+F      + DT+V   ++ YA
Sbjct: 122 RRAQADAPVNVLPMAALTKGRAGREMTEIGFLMDAGAVAFSDCDHVVADTKVFSRALSYA 181

Query: 176 HMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYH 235
               A+V     +  L        G  A   GL  + +++E + L RD+ + + TG  YH
Sbjct: 182 RSCGALVIAHPQEPGLSKGAAATSGKFATLRGLPAVTAMAERMGLDRDIALLEMTGARYH 241

Query: 236 ASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMS 295
           A  I+  +++  ++ AKA+    T G SI++L LNE DV  Y +  KV PPLRSE +R++
Sbjct: 242 ADQITTARALPALQRAKANGLDITAGTSIHHLTLNELDVADYRTFFKVKPPLRSEEDRLA 301

Query: 296 MVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKL 355
           ++EAL +G ID I S HTP+  ++K LPF EA+ G++ LET+L AALRL+H +Q+ L  L
Sbjct: 302 LIEALREGLIDTISSMHTPQDEESKRLPFEEAAAGAVALETLLPAALRLYHAEQLDLPTL 361

Query: 356 IRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK 415
            RA++  PA+   L  G L  G  AD+ L D +  + +    + S  +NT FD +   G+
Sbjct: 362 FRAMALNPAKRLGLDCGRLSEGAPADLVLFDADQPFVMDRFALHSKSQNTPFDGQRMQGR 421

Query: 416 VVRTYISGKQVY 427
           V+ TY++G+ VY
Sbjct: 422 VLATYVAGEPVY 433


>gi|126734669|ref|ZP_01750415.1| dihydroorotase, multifunctional complex type [Roseobacter sp. CCS2]
 gi|126715224|gb|EBA12089.1| dihydroorotase, multifunctional complex type [Roseobacter sp. CCS2]
          Length = 449

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 144/427 (33%), Positives = 240/427 (56%), Gaps = 3/427 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT+    N R+IDP    D  GAI++E G+I         A  P SA + DC G    PG
Sbjct: 23  MTATFFANARLIDPVALTDGPGAILIEGGVIKEVFD--TGATPPKSANVVDCNGQCLAPG 80

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           IID  V ++   + + ++  +  + A AGG+T+I+  P  + + +D    +++     + 
Sbjct: 81  IIDIGVKVSEPGERHKESFRSAGRAAAAGGVTTIVTRPDTLPA-IDTPETLEFVERRAQE 139

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            + ++V P A LT   +G+E++E+  LQ+ G V+F      + +T+V   ++ YA  L A
Sbjct: 140 DAPVHVLPMAALTKGRDGREMTEIGFLQDAGAVAFTDCDRVVTNTKVFSRALTYARSLGA 199

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     +  L     +  G  A+  GL  +  ++E + L RD+ + + TG  YH   I+
Sbjct: 200 LVIGHVQEPGLSDGAAVTSGKFASLRGLPSVSPMAERMALDRDISLLEMTGARYHVDQIT 259

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++  ++ AK +  + T GI +++L LNE DV  Y +  K+ PPLRSE +R+++V+A+
Sbjct: 260 TARALPALERAKRNGLQITAGIGVHHLTLNELDVADYRTFFKLKPPLRSEDDRVAVVQAV 319

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
            +G IDII S HTP+  ++K LP+ EA+ G++GLET+L AALRL+H + I L +L RA+S
Sbjct: 320 AEGLIDIISSMHTPQDEESKRLPYEEAASGAVGLETLLPAALRLYHAEMIDLPRLFRAMS 379

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA +  L  G LQ    AD+ L D +  + +    + S  KNT FD     G+V+ T+
Sbjct: 380 LNPAHLLGLKAGRLQADAPADLTLFDPDAPFQLDRAALLSKSKNTPFDGARMQGRVLGTW 439

Query: 421 ISGKQVY 427
           +SG++++
Sbjct: 440 VSGERIW 446


>gi|163741889|ref|ZP_02149279.1| dihydroorotase, multifunctional complex type [Phaeobacter
           gallaeciensis 2.10]
 gi|161385062|gb|EDQ09441.1| dihydroorotase, multifunctional complex type [Phaeobacter
           gallaeciensis 2.10]
          Length = 436

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 148/434 (34%), Positives = 234/434 (53%), Gaps = 11/434 (2%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILA-----AGADAL----NAKFPTSALIHDCT 53
           + +  N R+IDP    D +GA++V+NG I A      G+D L    N       LI DC 
Sbjct: 2   TLLFTNARLIDPEAGTDSIGAVLVQNGRIAAVDKNGTGSDQLFRTRNIGAEDVTLI-DCR 60

Query: 54  GLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKY 113
           G    PGI+D  V +    + + ++  +    A AGG+T+++  P    S +D    +++
Sbjct: 61  GKCLAPGIVDIGVKVCEPGERHKESYKSAGLAAAAGGVTTMVTRPDTTPS-IDSPETLEF 119

Query: 114 ALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMK 173
                +  + +NV P A LT    G+E++E+  L + G V+F      + DT+V   ++ 
Sbjct: 120 VTRRAQADAPVNVLPMAALTKGRAGREMTEIGFLMDAGAVAFSDCDHVVADTKVFSRALS 179

Query: 174 YAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGH 233
           YA    A+V     +  L        G  A   GL  +  ++E + L RD+ + + TG  
Sbjct: 180 YARSCGALVIAHPQEPGLSKGAAATSGKFATLRGLPAVTPMAERMGLDRDIALLEMTGAR 239

Query: 234 YHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETER 293
           YHA  I+  +++  ++ AKA+    T G SI++L LNE DV  Y +  KV PPLRSE +R
Sbjct: 240 YHADQITTARALPALQRAKANGLDITAGTSIHHLTLNELDVADYRTFFKVKPPLRSEEDR 299

Query: 294 MSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLK 353
           ++++EAL +G ID I S HTP+  ++K LPF EA+ G++ LET+L AALRL+H +Q+ L 
Sbjct: 300 LALIEALREGLIDTISSMHTPQDEESKRLPFEEAAAGAVALETLLPAALRLYHAEQLDLP 359

Query: 354 KLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFT 413
            L RA++  PA+   L  G L  G  AD+ L D +  + +    + S  +NT FD +   
Sbjct: 360 TLFRAMALNPAKRLGLDCGRLSEGAPADLVLFDADQPFVMDRFALHSKSQNTPFDGQRMQ 419

Query: 414 GKVVRTYISGKQVY 427
           G+V+ TY++G+ VY
Sbjct: 420 GRVLATYVAGEPVY 433


>gi|313200412|ref|YP_004039070.1| dihydroorotase, multifunctional complex type [Methylovorus sp.
           MP688]
 gi|312439728|gb|ADQ83834.1| dihydroorotase, multifunctional complex type [Methylovorus sp.
           MP688]
          Length = 425

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 144/424 (33%), Positives = 230/424 (54%), Gaps = 4/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R+IDP  +ID    I +  G I+  G+    A F  +  + D +GL+ +PG++D
Sbjct: 3   ILIKNGRLIDPKNNIDTTQDIYIAAGKIVGIGSGP--AGFEATQTL-DASGLLVLPGLVD 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L     E+   + +  + AVAGG+TS+   P      LDE   ++    + +   L
Sbjct: 60  LSARLREPGFEHKATLESEMQAAVAGGVTSLACPP-DTDPVLDEPGLVEMLKHKAKQLHL 118

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
            +VYP   +T  ++GK+++EM  L E G V F Q+ ++I DTQVL  +M+YA      + 
Sbjct: 119 AHVYPLGAITRQLQGKQLTEMSELTEAGCVGFSQADVAITDTQVLWRAMQYAATFGYTIW 178

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   + +L S G  ++G +A+ LGL GIP+ +ET+ +A  L IA+ TG   H   +S  +
Sbjct: 179 LRPEEPYLASGGTAHDGEVASRLGLKGIPAAAETLAIASILTIARETGASIHLCRLSTAE 238

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
            + +++ AK      TC +SIN+L L E+D+  ++    + PPLR + +R ++ + +  G
Sbjct: 239 GVEMVRAAKRQGLPVTCDVSINHLHLTEHDIGYFDPNCHLRPPLRGQRDRDALSQGVIDG 298

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID I SDHTP   D KL PF EA  G+ GLE +L    +    Q I L + + A++T+ 
Sbjct: 299 TIDAICSDHTPVDDDAKLQPFGEAEAGATGLELLLPLVCKWADEQNIPLTQALAAVTTKA 358

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A I ++P G L     AD+ L+D   +W V+A+ + S  KNT F      GKV  T ++G
Sbjct: 359 AAILDIPAGELSLHADADLCLLDPAQEWKVEANALQSQGKNTPFLGLHLRGKVRYTLVNG 418

Query: 424 KQVY 427
           + VY
Sbjct: 419 QLVY 422


>gi|58039719|ref|YP_191683.1| dihydroorotase [Gluconobacter oxydans 621H]
 gi|58002133|gb|AAW61027.1| Dihydroorotase [Gluconobacter oxydans 621H]
          Length = 433

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 138/430 (32%), Positives = 224/430 (52%), Gaps = 9/430 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M+  V  N R+IDP+   DE G ++V  G I+A      +   P  A + D  G V  PG
Sbjct: 1   MSDIVFENVRLIDPASGRDETGRLVVRQGRIVAC----EDGSVPEGARVIDGAGAVLCPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D RV L     EY +++++ ++ AVAGGIT++ ++P   S  +D    +         
Sbjct: 57  LVDMRVALGEPGSEYRESVSSGARAAVAGGITTMAVLP-NTSPPIDNPALVHLLRVRGEE 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             +++++P   LT   EG E++E+ LLQ  G V+F     +I D + + N + Y+  ++A
Sbjct: 116 TGMVSIHPYGALTRGCEGGEMAELGLLQNAGAVAFTDGTRAISDAKQMRNLLSYSRFIDA 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           IV     +  L        G  A  +GL  +P+ +E + +ARDL +   TG   H + +S
Sbjct: 176 IVVQHPEEPSLAKGACATAGARAVRMGLPSVPAEAEAIMIARDLRLTAMTGARLHFAHVS 235

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             + + LI+ AK+   + TC  +     + E+D+  + +  K+ PPLR+E +R ++  AL
Sbjct: 236 TAEGLDLIREAKSRGIRVTCDTAPPYFAMTEDDIGDFRTYAKLSPPLRNEADRKAVCAAL 295

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID + SDH P   D K LPFA+A  G  GL T+L   L    G  + L   +R ++
Sbjct: 296 ADGTIDAVASDHAPADADDKRLPFAQARAGGTGLVTLLGVTL----GAGLPLIDALRLVT 351

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           + PA +  L  GTL  G+ AD+ L D    WTV A ++    +NT FD +   G+V+RT+
Sbjct: 352 SAPAALLGLKAGTLAVGSDADLCLFDPEDSWTVVAGNLPGRAQNTPFDGKDLKGRVLRTF 411

Query: 421 ISGKQVYTLE 430
             G +V+T +
Sbjct: 412 KRGVEVFTAD 421


>gi|254510600|ref|ZP_05122667.1| aspartate transcarbamoylase, PyrC subunit [Rhodobacteraceae
           bacterium KLH11]
 gi|221534311|gb|EEE37299.1| aspartate transcarbamoylase, PyrC subunit [Rhodobacteraceae
           bacterium KLH11]
          Length = 426

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 147/428 (34%), Positives = 231/428 (53%), Gaps = 6/428 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAG-ADALNAKFPTSALIHDCTGLVAVP 59
           M++ +  N R+IDP    D +G + V +G I A G  DA     P    + DC G    P
Sbjct: 1   MSNLIFTNARLIDPEASTDRIGWLQVTDGQIAARGEGDAPKGGGP----VLDCGGQCLAP 56

Query: 60  GIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR 119
           GI+D  V +    + + ++  +    A AGG+T+I+  P  + + +D    +++A    +
Sbjct: 57  GIVDIGVKVCEPGERHKESYKSAGLAAAAGGVTTIVTRPDTLPA-VDTPETLEFATRRAQ 115

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
             + +NV P A LT    G+E++E+  LQ+ G V+F      I +T+V   ++ YA    
Sbjct: 116 ADAPVNVLPMAALTKGRAGREMTEIGFLQDAGAVAFTDCDHIITNTKVFSRALTYAKSCG 175

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
           A+V     +  L        G  A   GL  +  ++E + L RD+ + + TG  YHA  I
Sbjct: 176 ALVIAHPQEPGLSQGAAATSGKFAALRGLPAVSPMAERMGLDRDIALLEMTGAAYHADQI 235

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           +  +++  ++ AK +    T G SI++L LNE DV  Y +  KV PPLRSE +R +++EA
Sbjct: 236 TTARALPALERAKRNGLDITAGTSIHHLTLNELDVADYRTFFKVKPPLRSEDDRQAVIEA 295

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           +  G ID I S HTP+  ++K LPF EA+ G++ LET+L AALRL+H  Q+ L  L RA+
Sbjct: 296 VRTGLIDTISSMHTPQDEESKRLPFEEAASGAVALETLLPAALRLYHAGQLDLPVLFRAM 355

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           +  PA+   L GG L     AD+ L D +  + +    ++S  +NT FD +   GKV  T
Sbjct: 356 ALNPAKRLGLEGGRLAEAAPADLILFDPDVPFVLDRFTLASKSQNTPFDGQRMQGKVTAT 415

Query: 420 YISGKQVY 427
           Y++GK+VY
Sbjct: 416 YVAGKEVY 423


>gi|253998338|ref|YP_003050401.1| dihydroorotase, multifunctional complex type [Methylovorus sp.
           SIP3-4]
 gi|253985017|gb|ACT49874.1| dihydroorotase, multifunctional complex type [Methylovorus sp.
           SIP3-4]
          Length = 425

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 144/424 (33%), Positives = 230/424 (54%), Gaps = 4/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R+IDP  +ID    I +  G I+  G+    A F  +  + D +GL+ +PG++D
Sbjct: 3   ILIKNGRLIDPKNNIDTTQDIYIAAGKIVGIGSGP--AGFEATQTL-DASGLLVLPGLVD 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L     E+   + +  + AVAGG+TS+   P      LDE   ++    + +   L
Sbjct: 60  LSARLREPGFEHKATLESEMQAAVAGGVTSLACPP-DTDPVLDEPGLVEMLKHKAKQLHL 118

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
            +VYP   +T  ++GK+++EM  L E G V F Q+ ++I DTQVL  +M+YA      + 
Sbjct: 119 AHVYPLGAITRQLQGKQLTEMSELTEAGCVGFSQADVAITDTQVLWRAMQYAATFGYTIW 178

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   + +L S G  ++G +A+ LGL GIP+ +ET+ +A  L IA+ TG   H   +S  +
Sbjct: 179 LRPEEPYLASGGTAHDGEVASRLGLKGIPAAAETLAIASILTIARETGASIHLCRLSTAE 238

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
            + +++ AK      TC +SIN+L L E+D+  ++    + PPLR + +R ++ + +  G
Sbjct: 239 GVEMVRAAKRQGLPVTCDVSINHLHLTEHDIGYFDPNCHLRPPLRGQRDRDALRQGVIDG 298

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID I SDHTP   D KL PF EA  G+ GLE +L    +    Q I L + + A++T+ 
Sbjct: 299 TIDAICSDHTPVDDDAKLQPFGEAEAGATGLELLLPLVCKWADEQNIPLTQALAAVTTKA 358

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A I ++P G L     AD+ L+D   +W V+A+ + S  KNT F      GKV  T ++G
Sbjct: 359 AAILDIPAGELSLHADADLCLLDPAQEWKVEANALQSQGKNTPFLGLHLRGKVRYTLVNG 418

Query: 424 KQVY 427
           + VY
Sbjct: 419 QLVY 422


>gi|260431605|ref|ZP_05785576.1| dihydroorotase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415433|gb|EEX08692.1| dihydroorotase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 426

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 144/428 (33%), Positives = 231/428 (53%), Gaps = 6/428 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTS-ALIHDCTGLVAVP 59
           MT+ +  N R+IDP    D  G + V  G I+A+G    + + P + A + DC G    P
Sbjct: 1   MTALIFTNARLIDPEAGTDATGWLHVAGGRIVASG----DGRAPEADAQVIDCGGQCLAP 56

Query: 60  GIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR 119
           GI+D  V +    + + ++  +  + A AGG+T+++  P  + + +D    +++     +
Sbjct: 57  GIVDIGVKVCEPGERHKESYKSAGQAAAAGGVTTMVTRPDTLPA-IDTPETLEFVTRRAQ 115

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
             + +NV P A LT   +G+E++E+  L + G V+F      + DT+V   ++ YA    
Sbjct: 116 ADTPVNVLPMAALTKGRDGREMTEIGFLMDAGAVAFTDCDHVVADTKVFSRALTYARACG 175

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
           A+V     D  L        G  A   GL  +  ++E + L RD+ + + TG  YHA  I
Sbjct: 176 ALVIAHPQDPGLSHGAAATSGKFAALRGLPAVSPMAERMGLDRDIALLEMTGAAYHADQI 235

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           +  +++  ++ AK +    T G SI++L LNE DV  Y +  KV PPLRSE +R +++EA
Sbjct: 236 TTARALPALERAKRNGLDITAGTSIHHLTLNELDVADYRTFFKVKPPLRSEDDRQAVIEA 295

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           +  G ID I S HTP+  ++K LPF EA+ G++ LET+L AALRL+H  Q+ L  L RA+
Sbjct: 296 VRSGLIDTISSMHTPQDEESKRLPFEEAASGAVALETLLPAALRLYHADQLDLPTLFRAM 355

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           +  PAQ   L  G L     AD+ L D +  + +    + S  +NT FD +   GKV  T
Sbjct: 356 ALNPAQRLGLECGRLSADAPADLVLFDPDVPFVLDRFTLKSKSQNTPFDGQRMQGKVTAT 415

Query: 420 YISGKQVY 427
           Y++GK++Y
Sbjct: 416 YVAGKEIY 423


>gi|296535599|ref|ZP_06897780.1| dihydroorotase [Roseomonas cervicalis ATCC 49957]
 gi|296264115|gb|EFH10559.1| dihydroorotase [Roseomonas cervicalis ATCC 49957]
          Length = 429

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 139/427 (32%), Positives = 224/427 (52%), Gaps = 4/427 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M   +  N R++DP+  +D  G+++V  G+I   G    +   P +A + DC G V  PG
Sbjct: 5   MPDTLFVNARLLDPATGLDAPGSLLVSRGVIADHGG---SLGQPDAAEVVDCAGAVLAPG 61

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D R  L     EY + I + ++ A AGGIT++  +P      LD+   +++   +   
Sbjct: 62  LVDLRAALGEPGAEYRETIESAAQAAAAGGITTLCALPE-TQPVLDDPALVQFVRSKGEA 120

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
              +++ P    T    G+E++E  LL+E G V+F     +I   + +  ++ YA    +
Sbjct: 121 TGSLSILPYGAATKGCAGQEMAEFGLLKEAGAVAFTDGTRAIASARAMRLALSYARAFGS 180

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +     +  L   G   EG +A  LGL GIP  +E++ +ARD+ +A+ TGGH H + +S
Sbjct: 181 FIVQHPEEPSLARGGAATEGELATRLGLPGIPPAAESMMVARDIALARLTGGHVHFAHVS 240

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++ LI+ AKA   + TC  +     LNE  +  + +  K+ PPLR E +R+++V AL
Sbjct: 241 TAEALELIRRAKAEGLRVTCDTAPPYFDLNETAIGDFRTYAKLSPPLRREADRLAVVAAL 300

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID I SDH P   D K LPFA+AS G  GL T+L   L   HG  +SL   +  L+
Sbjct: 301 ADGTIDAIASDHQPADPDDKRLPFAQASAGGTGLATLLGITLARVHGGDLSLGAALALLT 360

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
            RPA +  LP G L+ G  AD+ L      W V++  +    +N+ FD     GKV+ T+
Sbjct: 361 CRPADLLGLPVGRLERGAPADLVLFHPERAWKVESGKLPGKAQNSPFDGRALEGKVLGTW 420

Query: 421 ISGKQVY 427
            +G++V+
Sbjct: 421 KAGRRVF 427


>gi|149200960|ref|ZP_01877935.1| dihydroorotase, multifunctional complex type [Roseovarius sp.
           TM1035]
 gi|149145293|gb|EDM33319.1| dihydroorotase, multifunctional complex type [Roseovarius sp.
           TM1035]
          Length = 428

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 148/431 (34%), Positives = 232/431 (53%), Gaps = 5/431 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT  +  N R+IDP    D  G ++++ G+I A G DA     P + ++ DC+G    PG
Sbjct: 1   MTQTLFTNARLIDPEAGTDAPGWLLIDKGVIAARGTDAP----PQAEVVMDCSGHCLAPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           I+D  V +    + + ++  +    A AGG+T+++  P   S  +D    +++       
Sbjct: 57  IVDIGVKVCEPGERHKESYRSAGLAAAAGGVTTMVTRP-DTSPAIDSPEVLEFVARRANE 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            S +NV   A LT   +G+E++E+  L + G V+F      + DT+VL  ++ YA  L A
Sbjct: 116 ASPVNVLVMAALTKGRQGREMTEIGFLMDAGAVAFTDCDHVVSDTKVLSRALTYARSLGA 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     D  L +      G  A+  GL  +  ++E + L RD+ + + TG  YHA  I+
Sbjct: 176 LVIGHPQDPGLSAGAAATSGKFASLRGLPAVSPMAERMGLDRDIALLEMTGARYHADQIT 235

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++  +  AK +    T G SI++L LNE DV  Y +  K+ PPLRSE +R +++EAL
Sbjct: 236 TARALPALARAKKNGLNITAGTSIHHLTLNELDVSDYRTFFKLKPPLRSEDDRQAVIEAL 295

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
            +G IDII S HTP+  ++K LPF EA+ G++ LET+L  ALRL+H + + L  L RA+S
Sbjct: 296 REGLIDIISSMHTPQDEESKRLPFEEAASGAVALETLLPVALRLYHAEALDLPALFRAMS 355

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+   L  G L  G  AD+ L D    + +    + S  KNT FD     GKV  TY
Sbjct: 356 LNPAKRLGLASGRLSIGAPADLVLFDPMKPFVLDRFALRSKSKNTPFDGARLQGKVCATY 415

Query: 421 ISGKQVYTLES 431
           ++G +VY  ++
Sbjct: 416 VAGTRVYEADT 426


>gi|221640494|ref|YP_002526756.1| dihydroorotase [Rhodobacter sphaeroides KD131]
 gi|221161275|gb|ACM02255.1| Dihydroorotase [Rhodobacter sphaeroides KD131]
          Length = 425

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 145/425 (34%), Positives = 231/425 (54%), Gaps = 5/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S +L N R+IDP    +  G +++E G+I A GA     + P  A + DC G    PGI+
Sbjct: 2   SLLLTNARLIDPEAGTETEGDLLIEGGLIAAVGA----LEPPPGAEVIDCGGKCLAPGIV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V +    + + ++  +    A AGG+T+I+  P  M + +D    +++        S
Sbjct: 58  DLGVKVGEPGERHRESFRSAGLAAAAGGVTTIVARPDTMPA-IDTPEVLEFVTRRAAEAS 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            + +   A LT   EG+E+ E+  L + G V+F      I  T+V    M YA  L A+V
Sbjct: 117 PVRIRHMAALTRGREGREMVELGFLLDTGAVAFSDCDHVIETTKVAARCMTYARSLGALV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L +      G  A+  G+  +  ++E +   RD+ + + +G  YHA  ++  
Sbjct: 177 IGHPQDPGLSAGASATNGKFASLRGIPAVHPMAERMGFDRDMALVEMSGVRYHADQVTTA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +++  ++ AKA+    T G+ I++L LNE DV  Y +  K+ PPLRSE +R++MVEA+  
Sbjct: 237 RTLPALERAKANGLDVTAGVGIHHLTLNEFDVGDYRTFFKLKPPLRSEEDRLAMVEAVGS 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G IDII S HTP+  ++K LPF EA++G++ LET L AALRL+H   ++L +L RA++  
Sbjct: 297 GLIDIISSMHTPQDEESKRLPFEEAAWGAVALETFLPAALRLYHAGLLTLPQLFRAMALN 356

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+   LP G L  G  AD+ L D +  + +    + S  KNT FD +   G+V+ TY+ 
Sbjct: 357 PAKRLGLPQGRLSEGAPADLVLFDPDAPFVLDRFTLRSKSKNTPFDGQRMEGRVLATYVG 416

Query: 423 GKQVY 427
           G++VY
Sbjct: 417 GRRVY 421


>gi|126740586|ref|ZP_01756273.1| dihydroorotase, multifunctional complex type [Roseobacter sp.
           SK209-2-6]
 gi|126718387|gb|EBA15102.1| dihydroorotase, multifunctional complex type [Roseobacter sp.
           SK209-2-6]
          Length = 436

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 148/434 (34%), Positives = 238/434 (54%), Gaps = 11/434 (2%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGII---LAAGAD------ALNAKFPTSALIHDCT 53
           + +  N R+I+P    D++GA++V+NG I   L+ GA       A N + P SA + DC 
Sbjct: 2   TLLFTNARLINPEAGTDQMGALLVKNGRITEVLSEGAQPEQLFRARNIE-PASASVVDCG 60

Query: 54  GLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKY 113
           G    PG+ID  V +    + + ++  +    A AGG+T+I+  P   +  +D    +++
Sbjct: 61  GKCLAPGLIDIGVKICEPGERHKESYKSAGLAAAAGGVTTIVTRP-DTTPAIDSPETLEF 119

Query: 114 ALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMK 173
                +  + +NV P A LT   EG+E++E+  L + G V+F      + +T+V   ++ 
Sbjct: 120 VTRRAQADAPVNVLPMAALTKGREGREMTEIGFLLDAGAVAFTDCDHVVTNTKVFSRALT 179

Query: 174 YAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGH 233
           YA    A+V     +  L +      G  A   GL  +  ++E + L RD+ + + TG  
Sbjct: 180 YAKSCGALVIAHPQEPGLSAGAAATSGKFAALRGLPSVSPMAERMGLDRDIALLEMTGAK 239

Query: 234 YHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETER 293
           YHA  I+  +++  ++ AK +    T G SI++L LNE DV  Y +  KV PPLRSE +R
Sbjct: 240 YHADQITTARALPALERAKNNGLDITAGTSIHHLTLNELDVADYRTFFKVKPPLRSEEDR 299

Query: 294 MSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLK 353
           +++VEA+  G IDII S HTP+  ++K LPF EA+ G++ LET+L AALRL+H + + L 
Sbjct: 300 LAVVEAVRTGLIDIISSMHTPQDEESKRLPFEEAAAGAVALETLLPAALRLYHAELLDLP 359

Query: 354 KLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFT 413
            L RA++  PAQ   L  G +  G  AD+ L D +  + +    + S  +NT FD +   
Sbjct: 360 TLFRAMTYNPAQRLGLASGRIAAGAPADLVLFDPDAPFVMDRFKLHSKSQNTPFDTQRMQ 419

Query: 414 GKVVRTYISGKQVY 427
           GKV+ TY+SG+ V+
Sbjct: 420 GKVLATYVSGEPVF 433


>gi|148263914|ref|YP_001230620.1| dihydroorotase, multifunctional complex type [Geobacter
           uraniireducens Rf4]
 gi|189038400|sp|A5GF42|PYRC_GEOUR RecName: Full=Dihydroorotase; Short=DHOase
 gi|146397414|gb|ABQ26047.1| dihydroorotase [Geobacter uraniireducens Rf4]
          Length = 425

 Score =  249 bits (636), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 145/428 (33%), Positives = 230/428 (53%), Gaps = 4/428 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++   R++DPS++ID+   ++VE+G I   G      K P  A I D  GL+  PG+I
Sbjct: 2   NLLIKGGRVVDPSQNIDDTMDLLVEDGRIKEIGK---GLKAPAGAEIIDAAGLLVTPGLI 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     EY ++I T ++ A AGG TS+  MP       D      Y + +   ++
Sbjct: 59  DMHVHLRDPGLEYKEDIVTGTRAAAAGGFTSVACMP-NTKPVNDNKAITSYIVNKAAKEA 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+NV+P   +T   +G+ ++EM  L+E G V+       + + +++  +++YA  +  +V
Sbjct: 118 LVNVFPVGSITQGSKGESLAEMGELKESGCVAVSDDGRPVVNGELMRRALEYAKGMGIMV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
              + +  L   GV+NEG  A  LGL GIP  +E V +ARD+ +A+ T    H + IS  
Sbjct: 178 ISHSEELALVGEGVMNEGFTATELGLKGIPWAAEDVAVARDVYLAEFTDSPLHIAHISTS 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S+ +I++AKA   K TC  + +   L ++ V  YN+  K+ PPLR   +  ++   L  
Sbjct: 238 GSVRIIRNAKARGVKVTCETAPHYFSLTDDAVRGYNTNAKMNPPLREAADVAAIKAGLAD 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID I +DH P H+D K L F  A  G +GLET L  +L+L     + LK L+  ++  
Sbjct: 298 GTIDAIATDHAPHHLDEKDLEFNLALNGIVGLETSLPLSLQLVEEGVVDLKVLLEKMTCN 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+I  +  GTL+ G AADI +ID + +W V A+ ++S  KN+ F      G  V T + 
Sbjct: 358 PAKILGIDRGTLKVGAAADITVIDPDREWLVAAEKLASKSKNSPFIGRKMKGAAVYTVVG 417

Query: 423 GKQVYTLE 430
           GK VY ++
Sbjct: 418 GKVVYKID 425


>gi|218506419|ref|ZP_03504297.1| dihydroorotase [Rhizobium etli Brasil 5]
          Length = 225

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 164/225 (72%)

Query: 140 EISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINE 199
           E++E+ LL + G V+F  +  S+HDTQVL   M YA    A+++ +T D +LG+ GV++E
Sbjct: 1   EMTEIGLLMQAGAVAFTDAHSSVHDTQVLRRIMTYAREFGAVISCETRDKYLGANGVMHE 60

Query: 200 GIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKAT 259
           G+ A++LGL GIP  +E +PL RDL IA  T G YHA++IS+PQS+  I+ A++   K T
Sbjct: 61  GLFASWLGLSGIPREAELIPLERDLRIAALTRGRYHAAMISVPQSVEAIELARSRGAKVT 120

Query: 260 CGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDT 319
            GISINNL LNEND+  Y +  K+ PPLR E +R++MV+AL +G IDIIVS H P+ +DT
Sbjct: 121 SGISINNLALNENDIGEYRTFFKLYPPLRPEDDRVAMVDALARGAIDIIVSAHDPQDVDT 180

Query: 320 KLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           K LPF EA+ G++GLETML+AALRL HG Q+SL +LI A+STRP 
Sbjct: 181 KRLPFGEAADGAVGLETMLAAALRLHHGGQVSLMRLIDAMSTRPG 225


>gi|56695199|ref|YP_165547.1| dihydroorotase, multifunctional complex type [Ruegeria pomeroyi
           DSS-3]
 gi|56676936|gb|AAV93602.1| dihydroorotase, multifunctional complex type [Ruegeria pomeroyi
           DSS-3]
          Length = 429

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 143/427 (33%), Positives = 228/427 (53%), Gaps = 1/427 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +  N R+IDP    D +G + V  G I+A G D+        A   DC G    PG
Sbjct: 1   MSNILFTNARLIDPEAGTDRIGWLRVTGGRIVATGEDSPQGLEEPPAETLDCGGKCLAPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           I+D  V +    + + ++  +  + A AGG+T+II  P   +  +D    +++     + 
Sbjct: 61  IVDIGVKVGEPGERHKESYKSAGQAAAAGGVTTIITRP-DTNPAIDTPEALEFVTRRAQA 119

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            + +NV P A LT   +G+E++E+  L + G V+F      + +T+V   ++ YA    A
Sbjct: 120 DTPVNVLPMAALTKGRQGREMTEIGFLLDAGAVAFTDCDHVVTNTKVFSRALTYAKSCGA 179

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     D  L        G  A   GL  +  ++E + L RD+ + + TG  YHA  I+
Sbjct: 180 LVIAHPQDPGLSEGAAATSGKFAALYGLPAVSPMAERMGLDRDIALLEMTGAKYHADQIT 239

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++  ++ AK +    T G SI++L LNE DV  Y +  KV PPLRSE +R +++EA+
Sbjct: 240 TARALPALERAKKNGLDITAGTSIHHLTLNELDVSGYRTFFKVKPPLRSEDDRQAVIEAV 299

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID I S HTP+  ++K LPF EA+ G++ LET+L AALRL+H  Q+ L  L RA++
Sbjct: 300 RTGLIDTISSMHTPQDEESKRLPFEEAASGAVALETLLPAALRLYHAGQLDLPTLFRAMA 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+   L  G L  G  AD+ L D +  + +    + S  +NT FD +   G+V+ TY
Sbjct: 360 LNPARRLGLASGRLGAGAPADLVLFDPDVPFVLDRFTLKSKSQNTPFDGQRMQGRVLATY 419

Query: 421 ISGKQVY 427
           ++G+ VY
Sbjct: 420 VAGQAVY 426


>gi|254440043|ref|ZP_05053537.1| Amidohydrolase family, putative [Octadecabacter antarcticus 307]
 gi|198255489|gb|EDY79803.1| Amidohydrolase family, putative [Octadecabacter antarcticus 307]
          Length = 422

 Score =  249 bits (635), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 141/418 (33%), Positives = 223/418 (53%), Gaps = 10/418 (2%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
             N R+IDP    D  G + V +G+I    +DA++        + DC G    PGI+D  
Sbjct: 5   FKNARLIDPETGTDTFGDLFVVDGLI----SDAIDVD-----EVIDCGGKCLAPGIVDIG 55

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V ++   + + ++  +  + AVAGGIT+I+  P      +D    +++      + + +N
Sbjct: 56  VKVSEPGERHKESFASAGRAAVAGGITTIVTRP-DTDPAIDTPETLEFVERRASIDAAVN 114

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V P A LT    G+E++E+  L + G V+F      + +T++    + YAH L A+V   
Sbjct: 115 VLPMAALTKGRNGREMTEIGFLLDAGAVAFTDCDRVVTNTKIFSRVLTYAHSLGALVIGH 174

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             +  L + G +  G  A   GL G+  ++E + L RD+ + + TG  YH   I+  +++
Sbjct: 175 VQEPGLSAGGSVTSGKFATLRGLSGVSPMAERMGLDRDIALLEMTGAAYHVDQITTARAL 234

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
             ++ AKA+    T G+ I++L LNE DV  Y +  K+ PPLR+E +R++ VEA+  G I
Sbjct: 235 PALERAKANGLDITAGVGIHHLTLNELDVADYRTFFKLKPPLRAEDDRLAGVEAVASGLI 294

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           DII S HTP+  ++K LP+ EA+ G++ LET+L AALRL H   + L  L RAL+  PA 
Sbjct: 295 DIICSMHTPQDEESKRLPYEEAASGAVALETLLPAALRLVHAGHMDLPHLFRALALNPAN 354

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
              L  G L  G  AD+ L D +  + +    + S  KNT FD     GKV+ TY+ G
Sbjct: 355 RLGLACGRLSVGAPADLVLFDPDASYRLDRFALLSKSKNTPFDGAILQGKVIATYVGG 412


>gi|197118280|ref|YP_002138707.1| dihydroorotase, multifunctional complex type [Geobacter
           bemidjiensis Bem]
 gi|226710827|sp|B5EB50|PYRC_GEOBB RecName: Full=Dihydroorotase; Short=DHOase
 gi|197087640|gb|ACH38911.1| dihydroorotase, multifunctional complex type [Geobacter
           bemidjiensis Bem]
          Length = 424

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 143/425 (33%), Positives = 230/425 (54%), Gaps = 4/425 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++   R+IDPS+ ID    +++ +G++L  G   L A   T A+  D +GL+  PG+I
Sbjct: 2   NLLIKGGRVIDPSQGIDANLDVLIADGVVLELG-QGLAAPEGTPAI--DASGLIVTPGLI 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     EY ++I T S+ A AGG TS+  MP   S  +D      Y + + + ++
Sbjct: 59  DMHVHLRDPGLEYKEDIATGSRSAAAGGFTSVACMP-NTSPVIDSKAIASYIINKAKSEA 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+NV+P  C+T   +G+ ++EM  L+E G V+       + +++++  +++YA  +   V
Sbjct: 118 LVNVFPIGCITKGGKGESLAEMGELKEAGCVAVSDDGKPVCNSELMRRALEYAKGIGIAV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
              + D  L   GV+NEG ++  LGL GIP  +E + +AR++ +A+  G   H + IS  
Sbjct: 178 ISHSEDLALVGEGVMNEGFVSTELGLKGIPWAAEDIAVAREVYLAEFAGAPVHIAHISTV 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S  +I++AKA   K TC  + +   L +  V  Y +  K+ PPLRS  +  +M   L  
Sbjct: 238 GSARIIRNAKARGVKVTCETAPHYFTLTDEAVRGYETNAKMNPPLRSAADVEAMKAGLAD 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID I +DH P H D K + F  A  G +GLET LS +L+L    ++ L +L+  +S  
Sbjct: 298 GTIDAIATDHAPHHPDEKDVEFNVALNGIVGLETSLSLSLKLVEEGRLDLNQLVSLMSCT 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+I  L  GTL+ G   D+ +ID   +W V+A  + S  KN+ F      G+ V T + 
Sbjct: 358 PAKILGLDRGTLKVGAVGDVTIIDPAKEWQVEAAKLESKSKNSPFLGWKMKGRAVYTVVK 417

Query: 423 GKQVY 427
           G+ VY
Sbjct: 418 GQVVY 422


>gi|260429136|ref|ZP_05783113.1| dihydroorotase [Citreicella sp. SE45]
 gi|260419759|gb|EEX13012.1| dihydroorotase [Citreicella sp. SE45]
          Length = 427

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 150/429 (34%), Positives = 233/429 (54%), Gaps = 7/429 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFP--TSALIHDCTGLVAV 58
           MT+ +++N R+IDP +     GA ++ +G++    A+  +   P  T A   D  G    
Sbjct: 1   MTATLISNARLIDPEQGTVTEGAALLRDGVL----AELFDTAEPGLTDADRIDARGAFLA 56

Query: 59  PGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           PGI+D  V +    D + ++  T    A AGG+T+I+  P   +  +D    +++  +  
Sbjct: 57  PGIVDIGVKVGEPGDRHKESYKTAGLAAAAGGVTTIVTRP-DTTPAIDTPEVLEFIRDRA 115

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
              S +NV P A LT    G+E++E+  L + G V+F      + DT+VL  +M YA  L
Sbjct: 116 EDDSPVNVLPMAALTKGRAGREMTEIGFLLDAGAVAFTDCDHVVTDTKVLARAMTYARSL 175

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
            A+V     +  L   G    G  A+  GL  +  ++E + L RD+ + + TG  YHA  
Sbjct: 176 GALVIGHPQEPGLSKGGAATSGKFASLRGLPSVSPMAERMGLDRDIALVEMTGVRYHADQ 235

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           I+  +++  ++ AK +    T G S+++L LNE D+  Y +  KV PPLRSE +R ++VE
Sbjct: 236 ITTARALPALERAKKNGFDVTAGTSMHHLTLNEMDLADYRTFFKVKPPLRSEDDRQAVVE 295

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
           A+  G IDII S HTP+  ++K LPF EA+ G++GLETML   LRL+H  ++ L  L RA
Sbjct: 296 AVRSGLIDIIGSFHTPQDEESKRLPFEEAASGAVGLETMLPVLLRLYHSGELDLPTLFRA 355

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           LS  PA+   LP G +  G  AD+ L D +  + +    + S  KNT FD     GKV+ 
Sbjct: 356 LSLNPARRLGLPCGRMVAGAPADLVLFDADKPFILDRFKLQSKSKNTPFDGARLQGKVLA 415

Query: 419 TYISGKQVY 427
           T+++GK VY
Sbjct: 416 TFVAGKAVY 424


>gi|126728287|ref|ZP_01744103.1| dihydroorotase, multifunctional complex type [Sagittula stellata
           E-37]
 gi|126711252|gb|EBA10302.1| dihydroorotase, multifunctional complex type [Sagittula stellata
           E-37]
          Length = 435

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 156/437 (35%), Positives = 235/437 (53%), Gaps = 14/437 (3%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGII------LAAGADALNAKFPTSALIH-DCT 53
           M+  +  N R+IDP    D +GA++VENG I      +      L     +  ++  DC 
Sbjct: 1   MSQTIFTNARLIDPDAGTDTLGALLVENGRIKEIETQVTENEGKLFTAVNSDTVVQVDCK 60

Query: 54  GLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSF--LDEYTFI 111
           G    PGI+D  V +    + + ++  T  + A AGG+T+I+  P         ++  FI
Sbjct: 61  GKCLAPGIVDIGVKVGEPGERHKESYGTAGQAAAAGGVTTIVTRPDTHPPIDTPEQLDFI 120

Query: 112 KY-ALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +  A EE RV    NV P A LT    G+E++E+  L + G V+F      + DT+VL  
Sbjct: 121 RRRAAEECRV----NVLPMAALTKGRAGREMTEIGFLMDAGAVAFTDCDHVVIDTKVLSR 176

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +M YA  L A++     D  L        G  A+  GL  +  ++E + L RD+ + + T
Sbjct: 177 AMTYARSLGALIIGHPQDPGLSQGAAATSGKFASLRGLPSVSPMAERMGLDRDIGMVEMT 236

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G  YHA  I+  +++  ++ AKA+    T G S+++L LNE DV  Y +  KV PPLRSE
Sbjct: 237 GARYHADQITAARALPTLERAKANGFDVTAGTSMHHLTLNEMDVADYRTFFKVKPPLRSE 296

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQI 350
            +R ++VEA+  G IDII S HTP+  ++K LPF EA+ G++GLETML+  LRL+H +++
Sbjct: 297 DDRKAIVEAVRSGLIDIIGSFHTPQDEESKRLPFEEAASGAVGLETMLTVLLRLYHAEEM 356

Query: 351 SLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKE 410
           +L  L RALS  PA+   L  G L  G  AD+ L D +    +    + S  KNT FD  
Sbjct: 357 TLPTLFRALSLNPAKRLGLDCGRLSAGAPADLVLFDADKPVILDRFKLRSKSKNTPFDGA 416

Query: 411 FFTGKVVRTYISGKQVY 427
              GKV+ T+++G +VY
Sbjct: 417 RLQGKVLGTWVAGDRVY 433


>gi|78486171|ref|YP_392096.1| dihydroorotase, multifunctional complex type [Thiomicrospira
           crunogena XCL-2]
 gi|78364457|gb|ABB42422.1| dihydroorotase [Thiomicrospira crunogena XCL-2]
          Length = 428

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 153/424 (36%), Positives = 222/424 (52%), Gaps = 3/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N RIIDPS+ +D+V  + +  G IL   +D     F    +I D TG   +PG++D
Sbjct: 3   LLIENARIIDPSQKMDQVSNLYISRGRILKI-SDTDPEGFTPDQVI-DGTGKWILPGLVD 60

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L      Y  NI + +K AV+GGIT+I   P   +   D     +      R  + 
Sbjct: 61  LHARLAEPGSRYEGNIASETKAAVSGGITTIC-SPPDTNPVNDTQAVTELIQRRARQAAT 119

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             V P   LT  +EGK +S M  L+  G ++  Q+   I +   L N+M YA     ++ 
Sbjct: 120 AFVLPIGALTQGLEGKMLSNMAALKNAGCIALSQASQPIQNPLTLKNAMAYAASNEILLM 179

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   D  L + GV++ G+I++ LGL  IP+ +ET  LARDL++A+ TG   H S IS  +
Sbjct: 180 LRCEDTELKNNGVVHSGVISSRLGLSEIPASAETAALARDLILAEETGARVHFSQISTAR 239

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +I  AK      TC ++I+ L L E DV  ++SL  V PPLR+  ++ ++   ++ G
Sbjct: 240 SLEMIADAKKRGMPVTCDVAIHQLHLTEYDVMDFDSLFHVTPPLRTHDDKEALRLGVKMG 299

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID IVSDHTP   D KLLPF E+  G  GLET+L   LRL     + L   I AL+ RP
Sbjct: 300 IIDAIVSDHTPLDRDVKLLPFGESEPGISGLETLLPLTLRLVEEGVLDLNTAISALTQRP 359

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A I  +  G+L  G  AD +L +    WT+   +M S   N+ F    FTG++  TY  G
Sbjct: 360 ADILGIHNGSLIEGHYADFSLFNPETPWTLNRSEMVSQGDNSPFHGWEFTGQIETTYFQG 419

Query: 424 KQVY 427
           + VY
Sbjct: 420 RPVY 423


>gi|146276278|ref|YP_001166437.1| dihydroorotase, multifunctional complex type [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145554519|gb|ABP69132.1| dihydroorotase [Rhodobacter sphaeroides ATCC 17025]
          Length = 424

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 145/428 (33%), Positives = 229/428 (53%), Gaps = 5/428 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S  L N R+IDP    +  G +++E G+I A GA     + P    + DC G    PGI+
Sbjct: 2   SLFLTNARLIDPEAGTETEGDLLIEGGLIAAVGA----LEPPPGTEVIDCGGKCLAPGIV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V +    + + ++  +    A AGG+T+II  P  M + +D    +++        S
Sbjct: 58  DLGVKVGEPGERHRESFRSAGLAAAAGGVTTIIARPDTMPA-IDTPEVLEFVTRRAAEAS 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            + +   A LT   EG+E+ E+  L + G ++F      I  T+V    M YA  L A+V
Sbjct: 117 PVRIRHMAALTKGREGREMVELGFLLDTGAIAFTDCDHVIETTKVAARCMTYARSLGALV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L +      G  A+  G+  +  ++E +   RD+ + + +G  YHA  ++  
Sbjct: 177 IGHPQDPGLSAGASATNGKFASLRGIPAVHPMAERMGFDRDMALVEMSGVRYHADQVTTA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +++  ++ AK +    T GI I++L LNE DV  Y +  K+ PPLRSE +R++MVEA+  
Sbjct: 237 RTLPALERAKRNGLDVTAGIGIHHLTLNEFDVGDYRTFFKLKPPLRSEEDRLAMVEAVGS 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G IDII S HTP+  ++K LPF EA++G++ LET L AALRL H   +SL +L RA++  
Sbjct: 297 GLIDIISSMHTPQDEESKRLPFEEAAWGAVALETFLPAALRLHHAGLLSLPQLFRAMALN 356

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+   LP G L  G  AD+ L D +  + +    + S  KNT FD +   G+V+ T++ 
Sbjct: 357 PAKRLGLPQGRLSEGAPADLVLFDPDAPFVLDRFTLRSKSKNTPFDGQRMEGRVLATFVG 416

Query: 423 GKQVYTLE 430
           G+QV+ +E
Sbjct: 417 GRQVFAVE 424


>gi|329851392|ref|ZP_08266149.1| dihydroorotase [Asticcacaulis biprosthecum C19]
 gi|328840238|gb|EGF89810.1| dihydroorotase [Asticcacaulis biprosthecum C19]
          Length = 439

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 143/425 (33%), Positives = 238/425 (56%), Gaps = 11/425 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH----DCTGLVAVPGIID 63
           N R++DP+ D D  G++I+ +G+I     D ++ + P +  +     DC G   +PG+ID
Sbjct: 18  NARLVDPASDYDGPGSVIIADGVI----TDIIHGEHPPAGQVGMKVIDCDGNAVMPGLID 73

Query: 64  ARVTLTGSP-DEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
            RV  TG P  E  + + + S  A AGG+TS ++ P      +D    + + L   R   
Sbjct: 74  MRVK-TGEPGSEPKETLKSASLAAAAGGVTSFVVQP-DTDPVIDGPAMVDFILRRARDIE 131

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L++VYP    T   +GK ++E+ L+ + G V F      I ++++L   + YA+  NA++
Sbjct: 132 LVHVYPAGAATKGADGKHLAEIGLMVQAGAVYFTDVDRPIVNSKILSRVLTYANGFNALI 191

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           A    + +L    V   G +A  +GL  + ++SE + L RDL +A+ TG  +    IS  
Sbjct: 192 AHRPKEPWLSEGAVATSGEMAMRMGLPSVTALSERIALERDLALAELTGARFLVDQISTR 251

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           + +  ++ AKA   +     SIN+L+ NE D+  Y +  ++ PPLRSE +R ++V ALE 
Sbjct: 252 EGLGSLERAKAKGLEVYASASINHLVFNEIDIGDYRTFYRLDPPLRSERDRQALVAALES 311

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID++VS+H P   + K LPF+EA+ G+IGL+T+L A + L    ++ L  LIRA++  
Sbjct: 312 GLIDVVVSNHCPAPAEDKRLPFSEAAPGAIGLQTLLPALIGLHLDAEVPLLDLIRAVTIN 371

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PAQI  L  G L  G  AD+ ++D++  + ++  D+ S  KN+ F+     GKV++T++ 
Sbjct: 372 PAQILGLEAGRLARGAPADLIMVDIDAPFALRERDILSKSKNSPFENRTLQGKVLKTFVD 431

Query: 423 GKQVY 427
           G+ VY
Sbjct: 432 GRLVY 436


>gi|163745652|ref|ZP_02153012.1| dihydroorotase, multifunctional complex type [Oceanibulbus
           indolifex HEL-45]
 gi|161382470|gb|EDQ06879.1| dihydroorotase, multifunctional complex type [Oceanibulbus
           indolifex HEL-45]
          Length = 426

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 145/426 (34%), Positives = 228/426 (53%), Gaps = 9/426 (2%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGII---LAAGADALNAKFPTSALIHDCTGLVAVPGI 61
           +  N R++DP     E  A++V NG+I   L  GA A +      A + DC G +  PGI
Sbjct: 4   LFTNLRLLDPEAGTLEPAAVLVRNGVIAEVLDHGATAAD-----GAEVIDCGGHILAPGI 58

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           +D  V +    + + ++  +    A AGG+T+++  P      +D    +++        
Sbjct: 59  VDIGVKVCEPGERHKESYRSAGLAAAAGGVTTMVTRP-DTDPAIDSPETLEFVTRRANEA 117

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           + +NV P A LT   EG+E++E+  L + G  +F      + DT+V   ++ YA  L A+
Sbjct: 118 APVNVVPMAALTKGREGREMTEIGFLMDAGAAAFTDCDRVVTDTKVFSRALTYARSLGAL 177

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V     D  L     +  G  A+  GL  +  ++E + L RD+ + + TG  YHA  I+ 
Sbjct: 178 VIAHPQDPGLSKGAAVTSGKFASLRGLPAVSPMAERMGLDRDIALIEMTGARYHADQITT 237

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
            +++  ++ AK +    T G+ I++L LN  DV  Y +  KV PPLR E +R+++VEA+ 
Sbjct: 238 ARALPALERAKRNGLDITAGVGIHHLTLNALDVADYRTFFKVKPPLRDEEDRIAVVEAVA 297

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G IDII S HTP+  ++K LPF EA+ G++GLET+L AALRL H + + L  L RALS 
Sbjct: 298 SGLIDIICSMHTPQDEESKRLPFEEAASGAVGLETLLPAALRLVHAEMMDLPTLWRALSL 357

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA+   LPGG +  G  AD+ L + +  + +    + S  +NT FD     GKV+ TY+
Sbjct: 358 NPAKRLGLPGGRIAVGAPADMVLFNPDAPFVLDRATLRSKSRNTPFDGMRMQGKVMATYV 417

Query: 422 SGKQVY 427
           +G  VY
Sbjct: 418 AGSCVY 423


>gi|259415192|ref|ZP_05739114.1| dihydroorotase [Silicibacter sp. TrichCH4B]
 gi|259349102|gb|EEW60856.1| dihydroorotase [Silicibacter sp. TrichCH4B]
          Length = 436

 Score =  246 bits (627), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 147/438 (33%), Positives = 233/438 (53%), Gaps = 9/438 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKF-------PTSALIHDCT 53
           MT+  LN  R+IDP    D  G+++V++G ILA    +  A F            + DC 
Sbjct: 1   MTTLFLN-ARLIDPEAGSDAPGSLLVQHGRILARSDQSDKAAFLAAHNLNTADVQVVDCH 59

Query: 54  GLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKY 113
           G    PGI+D  V +    + + ++  +    A AGG+T+I+  P   +  +D    +++
Sbjct: 60  GKCLAPGIVDIGVKVCEPGERHKESYKSAGLAAAAGGVTTIVTRP-DTTPCIDSPETLEF 118

Query: 114 ALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMK 173
                +  + +NV P A LT   EG+E++E+  L + G V+F      +  T+V   ++ 
Sbjct: 119 VTRRAQADAPVNVLPMAALTKGREGREMTEIGFLLDAGAVAFTDCDHVVTSTKVFSRALT 178

Query: 174 YAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGH 233
           YA    A+V     +  L +      G  A   GL  +  ++E + L RD+ + + TG  
Sbjct: 179 YAKSCGALVIAHPQEPGLSAGAAATSGKFAALRGLPSVSPMAERMGLDRDIALLEMTGAK 238

Query: 234 YHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETER 293
           YHA  I+  +++  ++ AKA+    T G SI++L LNE DV  Y +  KV PPLRSE +R
Sbjct: 239 YHADQITTARALPALERAKANGIDITAGTSIHHLTLNELDVADYRTFFKVKPPLRSEEDR 298

Query: 294 MSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLK 353
           +++VEA+  G ID+I S HTP+  ++K LPF EA+ G++ LET+L AA+RL+H + + L 
Sbjct: 299 LAVVEAVRTGLIDVISSMHTPQDEESKRLPFEEAAAGAVALETLLPAAMRLYHAELLDLP 358

Query: 354 KLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFT 413
            L RA+S  PA    L  G L  G  AD+ L D +    +    + S  KNT FD +   
Sbjct: 359 TLFRAMSLNPATRLGLASGRLSAGAPADLVLFDPDAPLVLDRFTLQSKSKNTPFDTQQMQ 418

Query: 414 GKVVRTYISGKQVYTLES 431
           G+V+ TY++G+ VY  E+
Sbjct: 419 GRVLATYVAGEPVYRKEA 436


>gi|114762042|ref|ZP_01441510.1| dihydroorotase, multifunctional complex type [Pelagibaca
           bermudensis HTCC2601]
 gi|114545066|gb|EAU48069.1| dihydroorotase, multifunctional complex type [Roseovarius sp.
           HTCC2601]
          Length = 427

 Score =  245 bits (626), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 150/429 (34%), Positives = 228/429 (53%), Gaps = 7/429 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH--DCTGLVAV 58
           MT+ +L N R+IDP+ D    GA+++ +G I    A+  +   P  A     D  G    
Sbjct: 1   MTATLLTNARLIDPAADTVTDGAVLLRDGFI----AEIFDQPDPQVADADRIDAGGAFLA 56

Query: 59  PGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           PGI+D  V +    D + ++  T    A AGG+T+I+  P      +D    +++  +  
Sbjct: 57  PGIVDIGVKVGEPGDRHKESYKTAGLAAAAGGVTTIVTRP-DTGPAIDTPEVLEFIRDRA 115

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
              + +NV P A LT    G+E++E+  L + G V+F        DT+VL  ++ YA  L
Sbjct: 116 EDDAPVNVLPMAALTKGRAGREMTELGFLLDAGAVAFTDCDHVATDTKVLSRALTYARSL 175

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
            A+V     +  L   G    G  A+  GL  + S++E + L RD+ + + TG  YHA  
Sbjct: 176 GALVICHPQEPGLSKGGAATSGKFASLRGLPAVSSMAERMGLDRDIALVEMTGVRYHADQ 235

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           I+  +++  ++ AK +    T G S+++L LNE DV  Y +  KV PPLRSE +R + VE
Sbjct: 236 ITTARALPALERAKRNGFDVTAGTSMHHLTLNELDVSDYRTFFKVKPPLRSEEDRQATVE 295

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
           A+  G IDII S HTP+  ++K LPF EA+ G++GLETML   LRL+H  ++ L  L RA
Sbjct: 296 AVRSGLIDIIGSFHTPQDEESKRLPFEEAASGAVGLETMLPVLLRLYHSGELELPTLFRA 355

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           LS  PA+   L  G +  G  AD+ L D +  + +    + S  KNT FD     GKV+ 
Sbjct: 356 LSLNPAKRLGLASGRMAKGAPADLVLFDADKPFVLDRFKLQSKSKNTPFDGARLQGKVLA 415

Query: 419 TYISGKQVY 427
           T+++G  VY
Sbjct: 416 TFVAGTAVY 424


>gi|83854888|ref|ZP_00948418.1| dihydroorotase, multifunctional complex type [Sulfitobacter sp.
           NAS-14.1]
 gi|83842731|gb|EAP81898.1| dihydroorotase, multifunctional complex type [Sulfitobacter sp.
           NAS-14.1]
          Length = 426

 Score =  245 bits (626), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 143/420 (34%), Positives = 222/420 (52%), Gaps = 3/420 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N ++IDP       G + VE+G I A   D   A  P  A + DC G    PGI+D  V 
Sbjct: 7   NAQLIDPEAGTVTRGTLRVEDGKIAAVLDD--TAPIPGDAQVVDCRGKYLAPGIVDLGVK 64

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           +    + + ++  +    A AGG+T+++  P      +D    +++        + +NV 
Sbjct: 65  VCEPGERHKESFRSAGLAAAAGGVTTMVTRP-DTDPTIDSPEVLEFVTRRANEAAPVNVV 123

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P A LT   EG+E++E+  L + G V F      + DT+V   ++ YA  L A+V     
Sbjct: 124 PMAALTKGREGREMTEIGFLMDAGAVGFTDCDRVVTDTKVFSRALTYARSLGALVIAHPQ 183

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           +  L     +  G  A+  GL  +  ++E + L RD+ + + TG  YHA  I+  +++  
Sbjct: 184 EPILSKGAAVTSGKFASLRGLPAVSPMAERMGLDRDIALIEMTGARYHADQITTARALPA 243

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           ++ AK +    T G+ I++L LN  DV  Y +  K+ PPLR E +R+++VEA+  G IDI
Sbjct: 244 LERAKKNGLDITAGVGIHHLTLNALDVADYRTFFKLKPPLRDEEDRIAVVEAVASGLIDI 303

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S HTP+  ++K LPF EA+ G++ LET+L AALRL H + I +  L RALS  PA+  
Sbjct: 304 ICSMHTPQDEESKRLPFEEAASGAVALETLLPAALRLVHAEMIDIATLWRALSFNPAKRL 363

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LPGG +  G  AD+ L D    + +  + + S  +NT FD     GKV+ TY+SG  +Y
Sbjct: 364 GLPGGRMSVGAPADLVLFDDGAPFVMNREVLRSKSRNTPFDGMRMQGKVLETYVSGTCIY 423


>gi|253700928|ref|YP_003022117.1| dihydroorotase [Geobacter sp. M21]
 gi|259547438|sp|C6DZ51|PYRC_GEOSM RecName: Full=Dihydroorotase; Short=DHOase
 gi|251775778|gb|ACT18359.1| dihydroorotase, multifunctional complex type [Geobacter sp. M21]
          Length = 425

 Score =  245 bits (626), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 228/425 (53%), Gaps = 4/425 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++   R+IDPS+ ID    +++ +G++L  G   L A   T A+  D  GL+  PG+I
Sbjct: 2   NLLIKGGRVIDPSQGIDANLDVLIADGVVLELG-QGLAAPEGTPAI--DAGGLIVTPGLI 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     EY ++I T S+ A AGG TS+  MP   S  +D      Y + + + ++
Sbjct: 59  DMHVHLRDPGLEYKEDIATGSRSAAAGGFTSVACMP-NTSPVIDSKAIASYIINKAKSEA 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+NV+P  C+T   +G+ ++EM  L+E G V        + +++++  +++YA  +   V
Sbjct: 118 LVNVFPIGCITKGGKGESLAEMGELKEAGCVGVSDDGKPVCNSELMRRALEYAKGIGITV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
              + D  L   GV+NEG ++  LGL GIP  +E + +AR++ +A+  G   H + IS  
Sbjct: 178 ISHSEDLALVGEGVMNEGFVSTELGLKGIPWAAEDIAVAREVYLAEFAGAPVHIAHISTV 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S  ++++AKA   K TC  + +   L +  V  Y++  K+ PPLRS  +  +M   L  
Sbjct: 238 GSARIVRNAKARGVKVTCETAPHYFTLTDEAVRGYDTNAKMNPPLRSAADIEAMKAGLAD 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID I +DH P H D K + F  A  G +GLET L  +L+L    ++ L +L+  +S  
Sbjct: 298 GTIDAIATDHAPHHPDEKDVEFNVALNGIVGLETSLPLSLKLVEEGRLDLNQLVSLMSCN 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+I  L  GTL+ G   D+ +ID   +W V+A  + S  KN+ F      G+ V T + 
Sbjct: 358 PAKILGLDRGTLKVGAVGDVTVIDPAKEWQVEAAKLESKSKNSPFLGWKMKGRAVYTVVK 417

Query: 423 GKQVY 427
           G+ VY
Sbjct: 418 GQVVY 422


>gi|83941411|ref|ZP_00953873.1| dihydroorotase, multifunctional complex type [Sulfitobacter sp.
           EE-36]
 gi|83847231|gb|EAP85106.1| dihydroorotase, multifunctional complex type [Sulfitobacter sp.
           EE-36]
          Length = 426

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 143/420 (34%), Positives = 222/420 (52%), Gaps = 3/420 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N ++IDP       G + VE+G I A   D   A  P  A + DC G    PGI+D  V 
Sbjct: 7   NAQLIDPEAGTVTRGTLRVEDGKIAAVLDD--TAPIPGDAQVVDCRGKYLAPGIVDLGVK 64

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           +    + + ++  +    A AGG+T+++  P      +D    +++        + +NV 
Sbjct: 65  VCEPGERHKESFRSAGLAAAAGGVTTMVTRP-DTDPTIDSPEVLEFVTRRANEAAPVNVV 123

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P A LT   EG+E++E+  L + G V F      + DT+V   ++ YA  L A+V     
Sbjct: 124 PMAALTKGREGREMTEIGFLMDAGAVGFTDCDRVVTDTKVFSRALTYARSLGALVIAHPQ 183

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           +  L     +  G  A+  GL  +  ++E + L RD+ + + TG  YHA  I+  +++  
Sbjct: 184 EPILSKGAAVTSGKFASLRGLPAVSPMAERMGLDRDIALIEMTGARYHADQITTARALPA 243

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           ++ AK +    T G+ I++L LN  DV  Y +  K+ PPLR E +R+++VEA+  G IDI
Sbjct: 244 LERAKKNGLDITAGVGIHHLTLNALDVADYRTFFKLKPPLRDEEDRIAVVEAVASGLIDI 303

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S HTP+  ++K LPF EA+ G++ LET+L AALRL H + I +  L RALS  PA+  
Sbjct: 304 ICSMHTPQDEESKRLPFEEAASGAVALETLLPAALRLVHSEMIDIATLWRALSFNPAKRL 363

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LPGG +  G  AD+ L D    + +  + + S  +NT FD     GKV+ TY+SG  +Y
Sbjct: 364 GLPGGRMSVGAPADLVLFDDGAPFVMNREVLRSKSRNTPFDGMRMQGKVLETYVSGTCIY 423


>gi|222056347|ref|YP_002538709.1| dihydroorotase, multifunctional complex type [Geobacter sp. FRC-32]
 gi|254788860|sp|B9M4S4|PYRC_GEOSF RecName: Full=Dihydroorotase; Short=DHOase
 gi|221565636|gb|ACM21608.1| dihydroorotase, multifunctional complex type [Geobacter sp. FRC-32]
          Length = 425

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 142/422 (33%), Positives = 224/422 (53%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDPS++IDE   ++V  G I   G      K P  A + D  GL+  PG+ID  
Sbjct: 5   IKGGRVIDPSQNIDETLDLLVVAGRIKELGK---GLKAPADAEVIDAAGLLVTPGLIDMH 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L     EY +++ T +  A AGG TS+  MP       D      Y + + + ++L+N
Sbjct: 62  VHLRDPGLEYKEDVITGTMAAAAGGFTSVACMP-NTKPVNDNKAITSYIVNKAKAEALVN 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V+P   +T   +G+ ++EM  L+E G V+       + + +++  +++YA  +  +V   
Sbjct: 121 VFPVGAITQGSKGENLAEMGELKEAGCVAVSDDGRPVVNAELMRRALEYAKGMGVMVIAH 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
           + +  L   GV+NEG  A  LGL GIP  +E V +ARD+ +A+ T    H + IS   S+
Sbjct: 181 SEELALVGEGVMNEGFTATELGLKGIPWAAEDVAVARDVYLAEFTNSPIHIAHISTKGSV 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +I+ AKA   + TC  + +   L ++ V  Y +  K+ PPLR   +  ++   L  G I
Sbjct: 241 RIIRDAKARGVQVTCETAPHYFSLTDDAVRGYETNAKMNPPLREAEDVAAIKTGLADGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I +DH P H+D K + F  A  G IGLET L  +L+L   + + +K L+  ++ RPAQ
Sbjct: 301 DAIATDHAPHHLDEKDVEFNVALNGIIGLETSLPLSLKLVEEKVLDMKTLVEKMAVRPAQ 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I  L  GTL+TG  AD+ +ID   +W V+A+ ++S  KN+ F     TG    T + GK 
Sbjct: 361 ILGLDRGTLKTGAPADVTIIDPKAEWVVEAEKLASKSKNSPFLGRKMTGAAAYTIVDGKV 420

Query: 426 VY 427
           V+
Sbjct: 421 VH 422


>gi|85704402|ref|ZP_01035504.1| dihydroorotase, multifunctional complex type [Roseovarius sp. 217]
 gi|85670810|gb|EAQ25669.1| dihydroorotase, multifunctional complex type [Roseovarius sp. 217]
          Length = 428

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 146/431 (33%), Positives = 230/431 (53%), Gaps = 5/431 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT  +  N R+IDP    D +G ++++ G+I A G  A     P +  + DC G    PG
Sbjct: 1   MTQTLFTNARLIDPEAGTDALGWLLIDKGVIAARGTGAA----PQAEAVIDCGGHCLAPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           I+D  V +    + + ++  +    A AGG+T+++  P   S  +D    +++       
Sbjct: 57  IVDIGVKVCEPGERHKESYRSAGLAAAAGGVTTMVTRP-DTSPAIDSPEVLEFVARRANE 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            + +NV   A LT   +G+E++E+  L + G V+F      + DT+VL  ++ YA  L A
Sbjct: 116 AAPVNVLVMAALTKGRQGREMTEIGFLMDAGAVAFTDCDHVVTDTKVLSRALTYARSLGA 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     D  L +      G  A+  GL  +  ++E + L RD+ + + TG  YHA  I+
Sbjct: 176 LVIGHPQDPGLSAGAAATSGKFASLRGLPAVSPMAERMGLDRDIALLEMTGARYHADQIT 235

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++  +  AK +    T G SI++L LNE DV  Y +  KV PPLRSE +R +++EAL
Sbjct: 236 TARALPALARAKKNGLDITAGTSIHHLTLNELDVSDYRTFFKVKPPLRSEDDRQAVIEAL 295

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
            +G IDII S HTP+  ++K LPF EA+ G++ LET+L  ALRL+H + + L  L RA+S
Sbjct: 296 REGLIDIISSMHTPQDEESKRLPFEEAASGAVALETLLPVALRLYHAEALDLPTLFRAMS 355

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+   L  G L  G  AD+ L D    + +    + S  KNT FD     GKV  TY
Sbjct: 356 LNPAKRLGLASGRLAVGAPADLVLFDPMKPFVLDRFALRSKSKNTPFDGARLQGKVCATY 415

Query: 421 ISGKQVYTLES 431
           ++G +V+  ++
Sbjct: 416 VAGTRVFEADT 426


>gi|325294897|ref|YP_004281411.1| dihydroorotase, multifunctional complex type [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065345|gb|ADY73352.1| dihydroorotase, multifunctional complex type [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 427

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 149/428 (34%), Positives = 233/428 (54%), Gaps = 5/428 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MTS ++   R+IDPS+ ID    +++ENG ++       N     S+ + D   L+  PG
Sbjct: 1   MTSLLIKGGRVIDPSQGIDGQYDVLIENGRVVKVEE---NISTVESSKVLDVRDLIVSPG 57

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
            ID    L     E+ ++I + S  A+AGGITS+  M        D  T  +Y +E+   
Sbjct: 58  FIDLHSHLRDPGQEWKEDIESGSHAAIAGGITSVCCMA-NTDPVNDNPTVTRYIIEKATK 116

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             L +V+P   +T  ++G+E++E+ L+ + G V+      +  D ++L N+M YA  L  
Sbjct: 117 VGLCDVFPVGAITKGLKGEELAEIGLMVKAGAVAISDDGETPKDAKLLRNAMDYAKSLGI 176

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V   + +  L + G +NEG +++YLG+ GIP+ +E +   RD+LIA+ TG H H   +S
Sbjct: 177 PVFCHSEEKSLSASGHMNEGYLSSYLGIPGIPAEAEDIGTMRDILIAKLTGAHVHICHVS 236

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              ++ +IK AK    K TC I+ ++  L E  V+ +++  K+ PPLR+E +     EAL
Sbjct: 237 SKGALKIIKTAKEEGIKVTCEITPHHFTLTEEAVKNFDTNAKMAPPLRTEEDVKMCKEAL 296

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G  D+I +DH P  +D KL+ F +A FG IG +TML  +L L     +SLKKLI  LS
Sbjct: 297 KTGIADVIATDHAPHTIDEKLVEFCQAPFGIIGFQTMLPLSLNLVREGYLSLKKLIEKLS 356

Query: 361 TRPAQIFNLPG-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           T PA+I N    GTL+ G  A+I + D   ++T   + + S   N+ F  +   GKV  T
Sbjct: 357 TVPARIINKNDIGTLKKGARANITIFDPEEEYTFTKELVKSKSCNSPFLNKKLKGKVKFT 416

Query: 420 YISGKQVY 427
             +GK VY
Sbjct: 417 IYNGKIVY 424


>gi|294084183|ref|YP_003550941.1| dihydroorotase and related cyclic amidohydrolase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663756|gb|ADE38857.1| Dihydroorotase and related cyclic amidohydrolase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 428

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 150/430 (34%), Positives = 228/430 (53%), Gaps = 8/430 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAG-ADALNAKFPTSALIHDCTGLVAVP 59
           M+     N  IIDPS+D+D +G + VE+GII      DA   K    A I DCT     P
Sbjct: 1   MSDIQFINAHIIDPSQDMDGIGYVSVEDGIITDCRLGDA--PKPSKDAKIVDCTHGYLAP 58

Query: 60  GIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           G++D RV  +G P  E+ +++ +L   A AGG+T+   +P  +    D        L   
Sbjct: 59  GLVDMRVQ-SGDPGAEHLEDLNSLLSAAAAGGVTAFACLPNTLPIIDDPAMIDSLCLRAS 117

Query: 119 RVK-SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHM 177
           R   S + VY  A  T  + GKE++E+ ++ E G + F     SI D  V+   + YA M
Sbjct: 118 RQGGSRLYVYGAA--TKGLAGKEMAELGMMAESGAIGFSNGLTSIQDALVMRRLLSYASM 175

Query: 178 LNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS 237
           ++  V     D  L + G +NEG  +  LGL+G PS++E + + RDL + + TGG YH +
Sbjct: 176 IDKPVIQHCEDASLTADGEMNEGETSTRLGLIGSPSVAEVIIIDRDLHLVRLTGGRYHVA 235

Query: 238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMV 297
            IS    I  ++ AKA     T   +    ILNE  V  Y++  K+ PPLRSE +R++++
Sbjct: 236 HISTRAGIDAVRKAKAEGLPVTADTAPPYFILNELAVSTYDTAMKLSPPLRSEDDRLAVI 295

Query: 298 EALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIR 357
           E L  G ID + SDHTP   D K+ PF  +  G+ G++T+ +  + L H   IS+ + I 
Sbjct: 296 EGLADGTIDAVSSDHTPVDGDAKMQPFGPSQPGASGIDTLFALTMSLVHADHISMMRAIE 355

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            LS  PA I ++PGG+L  G+ AD+ L   +  W VK  + +S  + T F+ +   G + 
Sbjct: 356 ILSLAPATILDVPGGSLVPGSMADVILFRPDTGWIVKGVNFASASRITPFEGQPVQGVID 415

Query: 418 RTYISGKQVY 427
            TY+SGK+ +
Sbjct: 416 ATYVSGKETF 425


>gi|99078050|ref|YP_611308.1| dihydroorotase [Ruegeria sp. TM1040]
 gi|99035188|gb|ABF62046.1| dihydroorotase [Ruegeria sp. TM1040]
          Length = 436

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 145/434 (33%), Positives = 230/434 (52%), Gaps = 9/434 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKF-------PTSALIHDCT 53
           MT+  LN  R+IDP    D  G+++V+ G ILA    +    F            + DC 
Sbjct: 1   MTTLFLN-ARLIDPETGTDAPGSLLVQRGKILARADQSDKEMFLADNGLRTKDVQMVDCN 59

Query: 54  GLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKY 113
           G    PGI+D  V +    + + ++  +    A AGG+T+I+  P   S  +D    +++
Sbjct: 60  GKCLAPGIVDIGVKVCEPGERHKESYKSAGLAAAAGGVTTIVTRP-DTSPCIDSPETLEF 118

Query: 114 ALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMK 173
                +  + +NV P A LT   EG+E++E+  L + G V+F      +  T+VL  ++ 
Sbjct: 119 VTRRAQADAPVNVLPMAALTKGREGREMTEIGFLLDAGAVAFTDCDHVVTSTKVLSRALT 178

Query: 174 YAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGH 233
           YA    A+V     +  L        G  A   GL  +  ++E + L RD+ + + TG  
Sbjct: 179 YAKSCGALVIAHPQEPGLSQGAAATSGKFAALRGLPSVSPMAERMGLDRDIALLEMTGAK 238

Query: 234 YHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETER 293
           YHA  I+  +++  ++ AKA+    T G SI++L LNE DV  Y +  KV PPLRSE +R
Sbjct: 239 YHADQITTARALPALERAKANGLDITAGTSIHHLTLNELDVADYRTFFKVKPPLRSEDDR 298

Query: 294 MSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLK 353
           +++VEA+  G ID+I S HTP+  ++K LPF EA+ G++ LET+L AA+RL+H + + L 
Sbjct: 299 LAVVEAVRSGLIDVISSMHTPQDEESKRLPFEEAAAGAVALETLLPAAMRLYHAELLDLP 358

Query: 354 KLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFT 413
            L RA++  P++   L  G L  G  AD+ L D +    +    + S  KNT FD +   
Sbjct: 359 TLFRAMALNPSRRLGLASGRLSAGAPADLVLFDPDAPLVLDRFKLQSKSKNTPFDTQRMQ 418

Query: 414 GKVVRTYISGKQVY 427
           G+V+ TY++G+ VY
Sbjct: 419 GRVLATYVAGEPVY 432


>gi|188587357|ref|YP_001918902.1| dihydroorotase, multifunctional complex type [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179352044|gb|ACB86314.1| dihydroorotase, multifunctional complex type [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 441

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 135/378 (35%), Positives = 214/378 (56%), Gaps = 2/378 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D +GL  VPG++D  V L     EY + I T +K A  GG TSI  MP       D    
Sbjct: 55  DVSGLTIVPGLVDMHVHLREPGFEYKETIATGTKSAARGGFTSIACMP-NTKPTADNSGT 113

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           I++  +  + + L++ YP A LT +  GKEI EM  L   G V+F      +HD+ V+  
Sbjct: 114 IEFIKQRAKEQGLVHTYPIAALTVDRVGKEIVEMDDLYSAGAVAFSDDGSWVHDSGVMRT 173

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +++Y+ + N  V     D  L   G +NEG +A+ +GL GIP+ SE++ +ARD+++++ T
Sbjct: 174 ALEYSQLFNVPVISHCEDEGLSDSGQVNEGYLASVMGLSGIPNESESIAVARDVMLSELT 233

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G H H + IS  QS+ +I+ AK      T  ++ ++LIL ++ ++ YN++ KV PPLR+E
Sbjct: 234 GAHLHIAHISTAQSVDIIRKAKDRGVPVTAEVTPHHLILTDSTIQNYNTMAKVNPPLRTE 293

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQ 349
            +  ++ + +++G ID I +DH P   D K + F  A FG +GLET  S + + L     
Sbjct: 294 EDVKALRQGIKEGVIDCIATDHAPHSTDEKNVEFDNAPFGLVGLETAFSVSKKALVDSGV 353

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
           +SL +LI  +ST PA++  LP G L     AD+ ++ L+ ++TV   D +S+ KN+ F  
Sbjct: 354 LSLSELIEKMSTNPAKLLKLPSGKLVHEAPADLTILSLDEKYTVNPGDFASLGKNSPFAG 413

Query: 410 EFFTGKVVRTYISGKQVY 427
               GK+V T +SG+  Y
Sbjct: 414 WELEGKIVATMVSGEFSY 431


>gi|39996374|ref|NP_952325.1| dihydroorotase, multifunctional complex type [Geobacter
           sulfurreducens PCA]
 gi|81702666|sp|Q74DP4|PYRC_GEOSL RecName: Full=Dihydroorotase; Short=DHOase
 gi|39983254|gb|AAR34648.1| dihydroorotase, multifunctional complex type [Geobacter
           sulfurreducens PCA]
          Length = 425

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 146/426 (34%), Positives = 226/426 (53%), Gaps = 4/426 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++   R+IDPS+ IDEV  I+VENG I   G   L A  P  A + D  GL+  PG+I
Sbjct: 2   NLLIKGGRVIDPSQGIDEVLDILVENGAIKELG-KGLAA--PAGAGVVDAAGLIVTPGLI 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     EY ++I T ++ A AGG TS+  MP       D      Y + + + + 
Sbjct: 59  DMHVHLRDPGLEYKEDIVTGTRAAAAGGFTSVACMP-NTKPVNDNKAVTSYIVAKAKAEG 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+NV+P   +T   +G  ++EM  L+E G V+       +  ++++  +++YA  +  +V
Sbjct: 118 LVNVFPVGSITQGSKGDALAEMGDLKEAGCVAVSDDGRPVTSSELMRRALEYAKGMGIMV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   GV+NEG ++  LGL GIP  +E    ARD+ +A+ T    H + +S  
Sbjct: 178 ISHAEDLSLVGEGVMNEGFVSTELGLKGIPWAAEDAATARDVYLAEFTNSPLHIAHVSTM 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S+ +I++AKA   K TC  + +   L ++ V  YN+  K+ PPLR+  +  ++ EAL+ 
Sbjct: 238 GSLRIIRNAKARGVKVTCETAPHYFSLTDDAVRGYNTNAKMNPPLRTADDLAAVKEALKD 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID I +DH P H+D K + F  A  G IGLET L  +L+L     ++L  L+  ++  
Sbjct: 298 GTIDAIATDHAPHHLDEKDVEFNVALNGIIGLETSLPLSLKLVEEGVLTLPALVEKMACN 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA I  +  GTL+ G  ADI +ID    WTV+A  ++S  KN+ F      G    T + 
Sbjct: 358 PAAILGIDRGTLRQGAVADITVIDPAAVWTVEAGALASKSKNSPFLGWEMKGAAAYTIVG 417

Query: 423 GKQVYT 428
           G  V++
Sbjct: 418 GTVVHS 423


>gi|254796548|ref|YP_003081384.1| dihydroorotase [Neorickettsia risticii str. Illinois]
 gi|254589785|gb|ACT69147.1| dihydroorotase [Neorickettsia risticii str. Illinois]
          Length = 438

 Score =  242 bits (618), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 136/422 (32%), Positives = 231/422 (54%), Gaps = 4/422 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADAL-NAKFPTSALIHDCTGLVAVPGIIDARV 66
           + RI+DP   ++ +G ++V  G I   G   L + +  +   + +C G + +PGIID  V
Sbjct: 18  DARIVDPESGLEVLGDLVVHKGRISDFGESLLSDVELKSFDEVVNCDGHILMPGIIDIHV 77

Query: 67  TLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
            L      ++++I + +K A AGG+T+++  P      +D    + Y  ++ +    +NV
Sbjct: 78  HLRDPGQLHNEDIHSGTKSAAAGGVTTVVCQP-NTDPPIDTVETLAYIRDKAKRVGFVNV 136

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
              A +T     +E+++M  L + G V F    + + ++  +  +   A +L   VA   
Sbjct: 137 LCYASITGRW--RELTDMFALHKAGAVGFTDDGLPVMNSLFMRQAFMNAALLKVPVAQHA 194

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIA 246
            D  L + G INEG++++ L + GIP I+E+V +ARD+L+ +    HYH   +S  +++ 
Sbjct: 195 EDLDLSNGGCINEGLMSHKLNVPGIPHIAESVMVARDVLLLEQLDAHYHVLHVSTKKTVE 254

Query: 247 LIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDID 306
           +++ AK    + TC ++ ++ +L E  V+ YN+  K+ PPLR+E +R+ M+EAL+ G ID
Sbjct: 255 IVRAAKDKGMRVTCEVTPHHFLLTEEAVDGYNTAAKMNPPLRTEQDRLCMIEALKDGTID 314

Query: 307 IIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQI 366
            I SDH P +   K LP  EA+FG +GLETML  +L L+H   + L  L+  L+  PA+I
Sbjct: 315 AIASDHAPHNEVYKELPLKEAAFGVVGLETMLPLSLELYHSGALDLHSLLAKLTCNPARI 374

Query: 367 FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
                G ++ G  AD+ L+DLN +  +     +S  KN+ F      GKV+RT + G  V
Sbjct: 375 VGSEAGRIKVGAPADLVLLDLNSEVRIDTRQFASKSKNSPFGGRKTRGKVLRTIVGGDTV 434

Query: 427 YT 428
           YT
Sbjct: 435 YT 436


>gi|298505384|gb|ADI84107.1| dihydroorotase, multifunctional complex type [Geobacter
           sulfurreducens KN400]
          Length = 425

 Score =  242 bits (618), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 146/425 (34%), Positives = 225/425 (52%), Gaps = 4/425 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++   R+IDPS+ IDEV  I+VENG I   G   L A  P  A + D  GL+  PG+I
Sbjct: 2   NLLIKGGRVIDPSQGIDEVLDILVENGAIKELG-KGLAA--PAGAGVVDAAGLIVTPGLI 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     EY ++I T ++ A AGG TS+  MP       D      Y + + + + 
Sbjct: 59  DMHVHLRDPGLEYKEDIVTGTRAAAAGGFTSVACMP-NTKPVNDNKAVTSYIVAKAKAEG 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+NV+P   +T   +G  ++EM  L+E G V+       +  ++++  +++YA  +  +V
Sbjct: 118 LVNVFPVGSITQGSKGDALAEMGDLKEAGCVAVSDDGRPVTSSELMRRALEYAKGMGIMV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   GV+NEG ++  LGL GIP  +E    ARD+ +A+ T    H + +S  
Sbjct: 178 ISHAEDLSLVGEGVMNEGFVSTELGLKGIPWAAEDAATARDVYLAEFTNSPLHIAHVSTM 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S+ +I++AKA   K TC  + +   L ++ V  YN+  K+ PPLR+  +  ++ EAL+ 
Sbjct: 238 GSLRIIRNAKARGVKVTCETAPHYFSLTDDAVRGYNTNAKMNPPLRTADDLAAVKEALKD 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID I +DH P H+D K + F  A  G IGLET L  +L+L     ++L  L+  ++  
Sbjct: 298 GTIDAIATDHAPHHLDEKDVEFNVALNGIIGLETSLPLSLKLVEEGVLTLPALVEKMACN 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA I  +  GTL+ G  ADI +ID    WTV+A  ++S  KN+ F      G    T + 
Sbjct: 358 PAAILGIDRGTLRQGAVADITVIDPAAVWTVEAGALASKSKNSPFLGWEMKGAAAYTIVG 417

Query: 423 GKQVY 427
           G  V+
Sbjct: 418 GTVVH 422


>gi|108762395|ref|YP_631705.1| dihydroorotase, multifunctional complex type [Myxococcus xanthus DK
           1622]
 gi|108466275|gb|ABF91460.1| dihydroorotase, multifunctional complex type [Myxococcus xanthus DK
           1622]
          Length = 437

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 136/428 (31%), Positives = 227/428 (53%), Gaps = 4/428 (0%)

Query: 1   MTSFVL-NNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVP 59
           M+S VL    R+IDP   +D V  ++V +G ++      L    P+SA + D TG   +P
Sbjct: 1   MSSTVLFRRGRVIDPRNGVDGVRDVLVRDGKVVEVSVTLL--PVPSSAEVVDATGKWVLP 58

Query: 60  GIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR 119
           G ID  V L    +E  + + T  + AVAGG T+++ MP       D     +  L   R
Sbjct: 59  GFIDLHVHLREPGEEGKETVLTGCRAAVAGGFTAVVAMP-NTKVVNDNAMVTELVLNRAR 117

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
              L +VYP   +T  ++G+E++EM  L   G V+       + +  ++  +++YA   +
Sbjct: 118 AAGLCHVYPAGAITKGLKGEELAEMGELVSAGCVAITDDGRPVMNASLMRRTLQYATQFD 177

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
             V +   D  L + G ++EG  +  LGL GIP+ +E   +ARDL++ + T G  H + +
Sbjct: 178 VPVMVHEEDLTLSAGGAMHEGTTSTRLGLRGIPASAEVAMVARDLVLLEETKGRLHVAHV 237

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           S   S+ LI+ AK    + TC ++ ++ IL++  V  Y++  K+ PPLR++T+  ++ EA
Sbjct: 238 SCEGSVRLIREAKRSGLRVTCEVAPHHFILDDRAVGDYDTHAKMAPPLRADTDVQALREA 297

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           L  G +D I +DH P  +  K + F +   G +GLET L   L L H   ++  + +  L
Sbjct: 298 LVDGTVDAIATDHAPHGVLDKQVEFEKGINGIVGLETALGLTLELVHAGVLTANRAVELL 357

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           +  PA+ F LPGG L  G  AD+ ++D + +WTV A    S  +NT F      G+V++T
Sbjct: 358 THGPAKAFGLPGGHLAPGAPADVTVVDPDAEWTVDAHQFHSRSRNTPFHGRKQKGRVIQT 417

Query: 420 YISGKQVY 427
           +++G +V+
Sbjct: 418 WVAGHKVF 425


>gi|255004501|ref|ZP_05279302.1| dihydroorotase [Anaplasma marginale str. Virginia]
          Length = 451

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 140/423 (33%), Positives = 220/423 (52%), Gaps = 6/423 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAK-FPTSA-LIHDCTGLVAVPGIIDAR 65
           N R+IDP  + D  G ++     I   G     A  F +SA  + DC G V +PGI+D  
Sbjct: 29  NARVIDPGSNTDAPGYVVTRGREISHFGFGEHKADDFQSSANEVIDCGGRVLMPGIVDIH 88

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L     E+ + I T S+ A AGG+T+++  P   S  +D     KY        S +N
Sbjct: 89  VHLREPGGEHKETIDTGSRSAAAGGVTTVVCQP-NTSPHIDSVMVAKYLKMRALESSCVN 147

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           +     +T       + +MR L+E G + F      + +   +  + + A  L  +VA  
Sbjct: 148 IEFYGSITKPC--GSLCDMRALKEAGALGFTDDGSPVMNALSMKRAFECASTLGVVVAQH 205

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDL-LIAQHTGGHYHASVISIPQS 244
             D  L   G INEG ++  LGL GI  +SE++ + RD+ L+ +  G  YH   +S  ++
Sbjct: 206 AEDCHLSDGGCINEGKVSQELGLKGISDLSESIMVGRDIELLREVPGARYHVLHVSTKKA 265

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           I LI+ AK      TC ++ ++  L E+ V  + ++ K+ PPLR+E +R+ MVE L  G 
Sbjct: 266 IDLIRSAKNEGLPVTCEVTPHHFALTEDAVREHGTMAKMNPPLRTEEDRLCMVEGLVDGT 325

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I +DH P     K LP +  +FG +GLETML  +L L+H  ++ L +++  L+ +P+
Sbjct: 326 IDCIATDHAPHSCQDKALPISSCAFGVVGLETMLPLSLELYHSGKMGLLEVLSKLTDKPS 385

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            I  +P G +  G  AD+ L+DL+++WTV     +S  KN+ F      GK +RT ++GK
Sbjct: 386 DIVKIPRGRIAKGLVADLVLVDLDHEWTVDTTKFASKSKNSPFHGRTVKGKALRTVVAGK 445

Query: 425 QVY 427
            VY
Sbjct: 446 TVY 448


>gi|254475795|ref|ZP_05089181.1| dihydroorotase [Ruegeria sp. R11]
 gi|214030038|gb|EEB70873.1| dihydroorotase [Ruegeria sp. R11]
          Length = 436

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 144/433 (33%), Positives = 233/433 (53%), Gaps = 9/433 (2%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAK--FPTSAL------IHDCTG 54
           + +  N R+IDP    D +GA++V+NG I A   +  N    F T  +      + DC G
Sbjct: 2   TLLFTNARLIDPEAGTDSIGAVLVQNGRIAAVEKNDTNPDQLFRTRNIGAEDVTLVDCGG 61

Query: 55  LVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYA 114
               PGI+D  V +    + + ++  +    A AGG+T++I  P   +  +D    +++ 
Sbjct: 62  KCLAPGIVDIGVKVCEPGERHKESYKSAGLAAAAGGVTTMITRP-DTTPAIDSPETLEFV 120

Query: 115 LEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKY 174
               +  + +NV   A LT   EG+E++E+  L + G V+F      + DT+V   ++ Y
Sbjct: 121 TRRAQADAPVNVLAMAALTKGREGREMTEIGFLMDAGAVAFTDCDHVVADTKVFSRALTY 180

Query: 175 AHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHY 234
           A    A+V     +  L        G  A   GL  +  ++E + L RD+ + + TG  Y
Sbjct: 181 ARSCGALVIAHPQEPGLSKGAAATAGKFAALRGLPSVTPMAERMGLDRDIALLEMTGAKY 240

Query: 235 HASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERM 294
           HA  I+  +++  ++ AKA+    T G SI++L LNE DV  Y +  KV PPLRSE +R+
Sbjct: 241 HADQITTARALPALERAKANGLDITAGTSIHHLTLNELDVADYRTFFKVKPPLRSEEDRL 300

Query: 295 SMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKK 354
           +++EA+ +G ID+I S HTP+  ++K LPF EA+ G++ +ET+L AALRL+H  Q+ L  
Sbjct: 301 AVIEAVREGLIDVISSMHTPQDEESKRLPFEEAAAGAVAMETLLPAALRLYHNDQLDLPT 360

Query: 355 LIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTG 414
           L RA+S  PA+   L  G L  G  AD+ L D +  + +    + S  +NT FD +   G
Sbjct: 361 LFRAMSLNPAKRLGLACGRLAEGAPADLVLFDPDSPFVMDRFALKSKSQNTPFDGQRMQG 420

Query: 415 KVVRTYISGKQVY 427
           +V+ TY++G+ VY
Sbjct: 421 RVLETYVAGEPVY 433


>gi|56417026|ref|YP_154100.1| dihydroorotase [Anaplasma marginale str. St. Maries]
 gi|222475394|ref|YP_002563811.1| dihydroorotase [Anaplasma marginale str. Florida]
 gi|255003380|ref|ZP_05278344.1| dihydroorotase [Anaplasma marginale str. Puerto Rico]
 gi|56388258|gb|AAV86845.1| dihydroorotase [Anaplasma marginale str. St. Maries]
 gi|222419532|gb|ACM49555.1| dihydroorotase [Anaplasma marginale str. Florida]
          Length = 454

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 140/423 (33%), Positives = 220/423 (52%), Gaps = 6/423 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAK-FPTSA-LIHDCTGLVAVPGIIDAR 65
           N R+IDP  + D  G ++     I   G     A  F +SA  + DC G V +PGI+D  
Sbjct: 32  NARVIDPGSNTDAPGYVVTRGREISHFGFGEHKADDFQSSANEVIDCGGRVLMPGIVDIH 91

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L     E+ + I T S+ A AGG+T+++  P   S  +D     KY        S +N
Sbjct: 92  VHLREPGGEHKETIDTGSRSAAAGGVTTVVCQP-NTSPHIDSVMVAKYLKMRALESSCVN 150

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           +     +T       + +MR L+E G + F      + +   +  + + A  L  +VA  
Sbjct: 151 IEFYGSITKPC--GSLCDMRALKEAGALGFTDDGSPVMNALSMKRAFECASTLGVVVAQH 208

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDL-LIAQHTGGHYHASVISIPQS 244
             D  L   G INEG ++  LGL GI  +SE++ + RD+ L+ +  G  YH   +S  ++
Sbjct: 209 AEDCHLSDGGCINEGKVSQELGLKGISDLSESIMVGRDIELLREVPGARYHVLHVSTKKA 268

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           I LI+ AK      TC ++ ++  L E+ V  + ++ K+ PPLR+E +R+ MVE L  G 
Sbjct: 269 IDLIRSAKNEGLPVTCEVTPHHFALTEDAVREHGTMAKMNPPLRTEEDRLCMVEGLVDGT 328

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I +DH P     K LP +  +FG +GLETML  +L L+H  ++ L +++  L+ +P+
Sbjct: 329 IDCIATDHAPHSCQDKALPISSCAFGVVGLETMLPLSLELYHSGKMGLLEVLSKLTDKPS 388

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            I  +P G +  G  AD+ L+DL+++WTV     +S  KN+ F      GK +RT ++GK
Sbjct: 389 DIVKIPRGRIAKGLVADLVLVDLDHEWTVDTTKFASKSKNSPFHGRTVKGKALRTVVAGK 448

Query: 425 QVY 427
            VY
Sbjct: 449 TVY 451


>gi|83746226|ref|ZP_00943280.1| Aspartate carbamoyltransferase non-catalytic chain [Ralstonia
           solanacearum UW551]
 gi|207744135|ref|YP_002260527.1| dihydroorotase-like protein [Ralstonia solanacearum IPO1609]
 gi|83727192|gb|EAP74316.1| Aspartate carbamoyltransferase non-catalytic chain [Ralstonia
           solanacearum UW551]
 gi|206595539|emb|CAQ62466.1| dihydroorotase-like protein [Ralstonia solanacearum IPO1609]
          Length = 425

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 142/422 (33%), Positives = 219/422 (51%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  ID    + +  G ++  G     A F  +  I D TGLV  PG+ID  
Sbjct: 5   IKGGRLIDPANGIDAQQDLYIAAGKVVGIGRTP--ADFHANKTI-DATGLVVCPGLIDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A+AGG+TS++  P      LDE   ++      R  +  +
Sbjct: 62  ARLREPGYEYKATLESEMAAAMAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNLNQAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G  ++EM  L E G V F Q+   + DT VL+ +++YA      V L 
Sbjct: 121 VYPLGALTVGLKGLVLTEMAELTEAGCVGFSQADAPMTDTLVLMRALQYAQTFGFTVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D FLG  GV   G +A+ LGL G+P ++ETV L     + + TG   H   +S    +
Sbjct: 181 PEDPFLGKGGVAASGPLASRLGLAGVPVMAETVRLHTIFELMRSTGARVHLCRLSSVAGL 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L++ AKA     TC ++++++ L + D+  +NS  + +PPLR+  +R  +V AL  G I
Sbjct: 241 ELVRRAKAEGLPVTCDVNVHHISLTDVDIGYFNSQMRFVPPLRAGRDRDGIVRALADGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I SDHTP   D KLLPFAEAS G+ GLET+L   LR     ++ L + +  +++ PA+
Sbjct: 301 DAICSDHTPVDDDEKLLPFAEASPGATGLETLLPLTLRWAAEHKVDLPRALARITSEPAR 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  LP G+L+ G  AD+ + D    W ++   + S  KN+ +      G+V  T ++G  
Sbjct: 361 VLGLPAGSLEVGALADVCVFDPEATWKIEPRSLRSQGKNSPYLGFELAGRVRATLVAGHL 420

Query: 426 VY 427
            Y
Sbjct: 421 AY 422


>gi|329889389|ref|ZP_08267732.1| dihydroorotase [Brevundimonas diminuta ATCC 11568]
 gi|328844690|gb|EGF94254.1| dihydroorotase [Brevundimonas diminuta ATCC 11568]
          Length = 433

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 141/421 (33%), Positives = 218/421 (51%), Gaps = 4/421 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N R++DP+ D D  GA+++ENG I+         + P    I D  G    PG+ID RV 
Sbjct: 13  NARLLDPASDYDGPGAVLIENGRIVEV-IHGQATQRPEGVQIIDAEGRCLAPGLIDIRVK 71

Query: 68  LTGSP-DEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
            TG P +E  + + + S  A AGG+T+I++ P      +D+   I +         L++V
Sbjct: 72  -TGEPGNEPKETLKSASLSAAAGGVTTIVVQP-DTDPAIDDPALIDHIQRRGAALDLVHV 129

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
                 T   +G+ ++E+ L+ E G + F      I +T+ L   M YA   NA++A   
Sbjct: 130 RAAGAATQARDGERMAEIGLMHEAGALYFTDGDRVIRNTRTLQRVMSYAASFNALIACRP 189

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIA 246
            + +L    V   G +A  LGL G P+I+E + L RDL + + TG  +    IS   ++ 
Sbjct: 190 TEPWLSEGAVATSGELATRLGLSGAPAIAERIQLERDLALVEQTGARFLIDQISTEGALE 249

Query: 247 LIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDID 306
            +  A+A   +     SIN+L  NE D+  Y +  ++ PPLR+E++R ++VEA+  G ID
Sbjct: 250 TLARARARGLEVAASASINHLCFNEIDIGDYRTFYRLDPPLRAESDRQALVEAVRDGLID 309

Query: 307 IIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQI 366
           +I S H P   + K  PFAEA  G++GLET++ AAL L H   + L  ++R L+  PA +
Sbjct: 310 VITSAHCPEPAENKRRPFAEAEPGAVGLETLMPAALTLHHEYGVDLLDVLRPLTQGPAAL 369

Query: 367 FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
             L  G L  G  AD+ L D      + A  + S  KN+ FD     GKV+ T +SG+ V
Sbjct: 370 LGLEAGELSQGAPADLVLFDAGAPVVIDAATLRSKSKNSPFDGRRLQGKVLLTVVSGRIV 429

Query: 427 Y 427
           +
Sbjct: 430 H 430


>gi|84499770|ref|ZP_00998058.1| dihydroorotase, multifunctional complex type [Oceanicola batsensis
           HTCC2597]
 gi|84392914|gb|EAQ05125.1| dihydroorotase, multifunctional complex type [Oceanicola batsensis
           HTCC2597]
          Length = 422

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 143/427 (33%), Positives = 226/427 (52%), Gaps = 9/427 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT+  L N R+IDP    +  G + VE+G+I         A    S    DC GL   PG
Sbjct: 1   MTTLALTNARLIDPETGEERPGGLTVEDGVI--------TALHDGSGPGIDCGGLCLAPG 52

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           I+D  V +    + + ++  +    A AGG+T+I+  P   +  +D    +++     R 
Sbjct: 53  IVDIGVKVCEPGERHKESFRSAGLAAAAGGVTTIVTRP-DTTPAIDSPETLEFVARRARE 111

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            + + V P A LT    G E++E+  L + G V+F      I DT+VL  ++ YA    A
Sbjct: 112 AAPVRVLPMAALTKGRAGHEMTEIGFLMDAGAVAFSDGDRVIADTKVLTRALTYARSRGA 171

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     +  L +      G  A+  GL  + +++E + L RD+ + + TG  YH   I+
Sbjct: 172 LVIGHVQEPGLSAGAAATSGKFASLRGLPSVSAMAERMGLDRDIALLEMTGVAYHVDQIT 231

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++  ++ AKA+    T G+SI++L LNE DV  Y +  KV PPLRSE +R ++V A+
Sbjct: 232 TARALPALERAKANGLDITAGVSIHHLTLNEFDVSNYRTFFKVKPPLRSEDDRQAVVAAI 291

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID+I S HTP+  ++K LPF  A+ G++GL+T+L AA+RL H   ++L +L RALS
Sbjct: 292 ASGLIDVICSMHTPQDEESKRLPFEAAASGAVGLQTLLPAAMRLVHAGDLTLAQLWRALS 351

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             P+    LP G L  G   D+ L D +  +T+    + S  +NT FD+    G V  T+
Sbjct: 352 LNPSDRLGLPSGRLAVGAPGDLVLFDPDAPFTLDRFKLLSKSRNTPFDEARMQGVVRATW 411

Query: 421 ISGKQVY 427
           + G+QV+
Sbjct: 412 VGGRQVF 418


>gi|225165567|ref|ZP_03727384.1| Dihydroorotase [Opitutaceae bacterium TAV2]
 gi|224800189|gb|EEG18602.1| Dihydroorotase [Opitutaceae bacterium TAV2]
          Length = 433

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 140/431 (32%), Positives = 232/431 (53%), Gaps = 9/431 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M +  + N R+IDP+   D +G + + +G I A     L+A     A   D  GLVA PG
Sbjct: 1   MPTLWIQNARVIDPAAKRDAIGDLYIVDGKIAAT----LSAADKKKARKIDAAGLVAAPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D  V        + + I T S+ A AGG TS++ MP   S   D    I+   + IR 
Sbjct: 57  LVDIHVHFREPGQTHKETIETGSRAAAAGGFTSVVCMP-NTSPVADTAGTIQLINDSIRR 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            S I VYPT C+T+ M+G+ ++ +  L+  G+V+       +   +++  + +YA M + 
Sbjct: 116 TSCIKVYPTGCITTGMKGQALAPIGSLKRAGVVAITDDGDCVQSNELMRRACEYARMFDL 175

Query: 181 IVALDTHDHFLGSRG-VINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
            +     DH + + G V+NEG+++  LGL G P+ +E + ++R++++A +TG   H   I
Sbjct: 176 PLMDHCQDHSMTNAGAVMNEGVMSTRLGLRGWPNAAEDIIVSRNVILATYTGARIHMQHI 235

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           S   ++ +I+ AK      T   + ++  L +  +E Y++  K+ PPLR+E +R++++E 
Sbjct: 236 SSHNAVDIIRRAKTRGVPVTAEGTPHHFALTDACLETYDTRFKMNPPLRTEDDRLAIIEG 295

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQ-QISLKKLIRA 358
           L  G +DII +DH P   D K   F  A  G IGLET L  +L + H Q +  L  +I  
Sbjct: 296 LRDGTLDIIATDHAPHTDDEKDKEFDYAPNGIIGLETSLPISLEILHRQNKFKLATVIDL 355

Query: 359 LSTRPAQIFNLPG--GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
           ++ +PA I NLPG  GTL  G+AAD+ L D + +W   ++   S   N+ + ++   G+V
Sbjct: 356 MTRKPAAIVNLPGGAGTLAEGSAADLVLFDPDEEWLYDSNKGFSKSGNSPWHRQKLRGRV 415

Query: 417 VRTYISGKQVY 427
             TY+ GK +Y
Sbjct: 416 KATYVDGKLIY 426


>gi|83952420|ref|ZP_00961151.1| dihydroorotase, multifunctional complex type [Roseovarius
           nubinhibens ISM]
 gi|83836093|gb|EAP75391.1| dihydroorotase, multifunctional complex type [Roseovarius
           nubinhibens ISM]
          Length = 425

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 144/427 (33%), Positives = 232/427 (54%), Gaps = 5/427 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT+ +L N R+I+P    +  G ++++ G I A G DA     P +    DC G    PG
Sbjct: 1   MTTTLLTNARLINPDSAEEAQGWLLIDQGRIAATGQDAP----PKADRTVDCRGKCLAPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           I+D  V +    + + ++  +  + A AGG+T+++  P  + + +D    +++       
Sbjct: 57  IVDIGVKVCEPGERHKESYRSAGRAAAAGGVTTMVTRPDTLPA-IDNPETLEFVARRANE 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            + +NV P A LT   EG+E++E+  L + G V+F      I  ++V   ++ YA    A
Sbjct: 116 AAPVNVLPMAALTKGREGREMTEIGFLMDAGAVAFTDCDHVITSSKVFSRALTYARACGA 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     +  L      + G  A+  GL  +  ++E + L RD+ + + TG  YHA  I+
Sbjct: 176 LVIAHPQEPGLSQGAAASSGKFASLRGLPAVTPMAERMGLDRDIALLEMTGARYHADQIT 235

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++  +  AK +    T G SI++L LNE D+  Y +  KV PPLRSE +R +++EAL
Sbjct: 236 TARALPALARAKRNRLDITAGTSIHHLTLNELDIADYRTFFKVKPPLRSEEDRQAVIEAL 295

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G IDII S HTP+  ++K LPF EA+ G++GLET+L AALRL+H   ++L +L RA+S
Sbjct: 296 RDGLIDIISSMHTPQDEESKRLPFEEAASGAVGLETLLPAALRLYHSGDLTLAELFRAMS 355

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+   L  G L  G  AD+ L D +  + +    ++S  KNT FD     GKV+ TY
Sbjct: 356 LNPAKRLGLASGRLTEGAPADLVLFDPDAPFVLDRWKLNSKSKNTPFDGARMQGKVLATY 415

Query: 421 ISGKQVY 427
           ++G  V+
Sbjct: 416 VAGTPVF 422


>gi|149913417|ref|ZP_01901950.1| dihydroorotase, multifunctional complex type [Roseobacter sp.
           AzwK-3b]
 gi|149812537|gb|EDM72366.1| dihydroorotase, multifunctional complex type [Roseobacter sp.
           AzwK-3b]
          Length = 427

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 141/423 (33%), Positives = 226/423 (53%), Gaps = 4/423 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           +  N R+IDP +  D  G +++E   I A G +      P +  + DC G    PGI+D 
Sbjct: 6   LFTNARLIDPEQGTDAPGWLLIEGTTIKALGTEDAA---PAADAVIDCGGHCLAPGIVDI 62

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V +    + + ++  +    A AGG+T++I  P  + + +D    +++          +
Sbjct: 63  GVKVCEPGERHKESYRSAGLAAAAGGVTTMITRPDTLPA-IDTPEALEFVARRANAAGPV 121

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           NV P A LT   EG+E++E+  L + G V+F      I +T+V   ++ YA  L A++  
Sbjct: 122 NVRPMAALTKGREGREMTEIGFLLDAGAVAFTDCDHVITNTKVFQRALTYARGLGALIIA 181

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              +  L +      G  A+  GL  +  ++E + L RD+ + + TG  YHA  I+  ++
Sbjct: 182 HPQEPGLSAGASATSGKFASLRGLPSVSPMAERMGLDRDIALLEMTGARYHADQITTARA 241

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           +  ++ AK +    T G SI++L LNE DV  Y +  KV PPLRSE +R +++EA+  G 
Sbjct: 242 LPALERAKRNGLDITAGTSIHHLTLNELDVADYRTFFKVKPPLRSEDDRQAVIEAVRSGL 301

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID+I S HTP+ +++K LPF EA+ G++ LET+L AALRL+H   + L  L RA+   PA
Sbjct: 302 IDVICSMHTPQDVESKRLPFEEAASGAVALETLLPAALRLYHSGDLDLPTLFRAMVFNPA 361

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           Q   L  G L +G  AD+ + D +  + +    + S  KNT FD +   GKV  TY++G 
Sbjct: 362 QRLGLASGRLASGAPADLLVFDPDKPFVMDRTTLHSKSKNTPFDGQRLQGKVRLTYVAGT 421

Query: 425 QVY 427
            VY
Sbjct: 422 CVY 424


>gi|189425143|ref|YP_001952320.1| dihydroorotase [Geobacter lovleyi SZ]
 gi|238692108|sp|B3E3I1|PYRC_GEOLS RecName: Full=Dihydroorotase; Short=DHOase
 gi|189421402|gb|ACD95800.1| dihydroorotase, multifunctional complex type [Geobacter lovleyi SZ]
          Length = 425

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 135/428 (31%), Positives = 227/428 (53%), Gaps = 8/428 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH--DCTGLVAVPG 60
           + ++   R+IDPS+ ID+   ++VENG++   G         TSA     D +G   VPG
Sbjct: 2   NLLIKGGRVIDPSQGIDDTLDVVVENGLVKEIGKG-----LATSAGAETIDASGKYVVPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +ID  V L     EY ++I + ++ AVAGG TS+  MP      +D      Y + + + 
Sbjct: 57  LIDMHVHLRDPGLEYKEDIISGTRAAVAGGFTSVCCMP-NTKPAIDNKAIASYIINKAKT 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           +   NV+P   +T  M G  ++EM  L+E G V+       + +++++  +++YA  +  
Sbjct: 116 EGACNVFPVGTITQGMHGDRLAEMGELKESGCVAVSDDGKPVKNSELMRRALQYAAGIGI 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     +  L   GV+NEG  +  LGL GIP ++E +  AR++++A++ G   H + +S
Sbjct: 176 MVISHAEELELVGEGVMNEGFTSTELGLKGIPRVAEDIATAREIMLAEYVGAPIHIAHVS 235

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              ++ +I+ AK    K TC  + +   L ++ V  YN+  K+ PPLR   +  ++   L
Sbjct: 236 TKGAVRIIREAKGRGVKVTCETAPHYFTLTDDAVRGYNTNAKMNPPLREADDLAAIKAGL 295

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G ID I +DH P H+D K + F EA  G +GLET L  +L+L     ++L +LI  +S
Sbjct: 296 KDGTIDCIATDHAPHHLDEKDVEFNEAMNGIVGLETSLPLSLKLVDEGVLNLSQLIEKMS 355

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
            +P+++  L  G+L+ G  ADI +ID   QWTV    ++S  KN+ +      G    T 
Sbjct: 356 CKPSELLGLGRGSLKAGNVADITVIDPAKQWTVTESALASKSKNSPWLGATMAGAAACTV 415

Query: 421 ISGKQVYT 428
           + GK V++
Sbjct: 416 VGGKIVFS 423


>gi|17545398|ref|NP_518800.1| dihydroorotase [Ralstonia solanacearum GMI1000]
 gi|17427690|emb|CAD14209.1| probable dihydroorotase-like protein [Ralstonia solanacearum
           GMI1000]
          Length = 425

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 142/422 (33%), Positives = 219/422 (51%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  ID    + +  G ++  G     A F  +  I D TGLV  PG+ID  
Sbjct: 5   IKGGRLIDPANGIDAQQDLYLAAGKVVGVGR--APADFHANKTI-DATGLVVCPGLIDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A+AGG+TS++  P      LDE   ++      R  +  +
Sbjct: 62  ARLREPGYEYKATLESEMAAAMAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNLNQAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G  ++EM  L E G V F Q+   + DT VL+ +++YA      V L 
Sbjct: 121 VYPLGALTVGLKGLVLTEMAELTEAGCVGFSQADAPMTDTLVLMRALQYAQTFGFTVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D FLG  GV   G +A+ LGL G+P ++ETV L     + + TG   H   +S    +
Sbjct: 181 PEDPFLGKGGVAASGPLASRLGLAGVPVMAETVRLHTIFELIRSTGARVHLCRLSSAAGL 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L++ AKA     TC ++++++ L + D+  +NS  + +PPLR+  +R  +V AL  G I
Sbjct: 241 ELVRRAKAEGLPVTCDVNVHHISLTDVDIGYFNSQMRFMPPLRAGRDRDGIVRALADGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I SDHTP   D KLLPFAEAS G+ GLET+L   LR     ++ L + +  +++ PA+
Sbjct: 301 DAICSDHTPVDDDEKLLPFAEASPGATGLETLLPLTLRWAAEHKVDLPRALARITSEPAR 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  L  G+L+ G  AD+ + D +  W V+   + S  KN+ +      G+V  T ++G  
Sbjct: 361 VLGLQAGSLEEGAMADVCVFDPDATWKVEPRSLRSQGKNSPYLGFELAGRVRATLVAGHL 420

Query: 426 VY 427
            Y
Sbjct: 421 AY 422


>gi|74318601|ref|YP_316341.1| dihydroorotase [Thiobacillus denitrificans ATCC 25259]
 gi|74058096|gb|AAZ98536.1| dihydroorotase multifunctional complex type [Thiobacillus
           denitrificans ATCC 25259]
          Length = 424

 Score =  240 bits (612), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 142/420 (33%), Positives = 223/420 (53%), Gaps = 10/420 (2%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           + N R+IDP+   DE+  + +  G I+ + A   +A         D +GLV  PG++D  
Sbjct: 5   IKNGRVIDPASGRDEIADLFIAAGRIVTSDAPTFHANRTI-----DASGLVVCPGLVDLS 59

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI- 124
           V L     EY   + +    A AGG+TS+   P      LDE   ++  + + R K+L  
Sbjct: 60  VRLREPGFEYKATLESEMLAAAAGGVTSLACPP-DTDPPLDEPGLVE--MLKFRAKNLPG 116

Query: 125 -NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             VYP   LT  +EGK ++EM  L E G  +F Q+   + DT VLL +M+YA      + 
Sbjct: 117 PRVYPVGALTQKLEGKMLTEMAELTEAGCRAFTQADAPLTDTLVLLRAMEYAATFGFRLW 176

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   D  L   G+ ++G IA+ LGL GIP+++ETV LA  L + + TG   H + +S  +
Sbjct: 177 LRAQDVTLARGGIAHDGAIASRLGLPGIPALAETVALATILQLMRETGARVHLARLSTRE 236

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
            IA+++ AKA     TC ++  ++ L+END+  ++S   ++PPLRS  +R ++ EAL  G
Sbjct: 237 GIAMVQAAKAQGLAVTCDVATTHVHLSENDLVGFDSHLHLVPPLRSLRDRDAIREALRDG 296

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            +D + SDHTP   D K +PF E+S G+ G+E +L   L+      + L + +  ++  P
Sbjct: 297 AVDALCSDHTPVDEDEKQVPFGESSPGASGVELLLPLTLKWAREMNVPLPRALALITCEP 356

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+I ++P G L  G  AD+ + D   +W V +  ++S   NT F      G+V  T I G
Sbjct: 357 ARILDIPAGELAAGANADVCIFDAQAEWVVTSKSLASQGDNTPFLNHPMQGRVRYTLIDG 416


>gi|117923420|ref|YP_864037.1| dihydroorotase [Magnetococcus sp. MC-1]
 gi|117607176|gb|ABK42631.1| dihydroorotase [Magnetococcus sp. MC-1]
          Length = 428

 Score =  240 bits (612), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 136/425 (32%), Positives = 230/425 (54%), Gaps = 5/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S  +   R++DP+ + DE+  I++ +G+I   G   L+A  P    + +  GL+A PG++
Sbjct: 6   SLFIRGARVVDPANERDEIADILIVDGVIREIGK--LDA--PAHVPVIEADGLIAAPGLV 61

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     EY + I   ++ A AGG+TS+  MP       D+ +   Y L++ RV  
Sbjct: 62  DMHVHLREPGYEYKETIAGGTRAAAAGGVTSVAAMP-NTKPVNDDPSVTGYMLDKARVAG 120

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
             N++P   ++  ++GKEI+EM LLQ  G V+F    + I ++ ++  ++ Y+     ++
Sbjct: 121 FANLFPIGAVSKGLQGKEITEMGLLQAAGCVAFSDDGLPIMNSGLMRRALDYSRAFGGLI 180

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G +NEG +A  LGL GI + +E + + RD+ + + TGG YH + IS  
Sbjct: 181 IQHAEDSGLVGCGCMNEGEVATRLGLSGICNAAEDILVERDIRLVELTGGRYHVAHISSA 240

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++A +  A+    + +C  + ++L+LN+  V  Y++  K+ PPLR++ +  ++ EAL +
Sbjct: 241 GAVASVAKAREKGLRVSCEAAPHHLVLNDTHVGNYDTNAKMAPPLRNQRDVNAIQEALAR 300

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G I +I +DH P   D+K +PF +A+ G +GLET+L   L L     + L K + A+S  
Sbjct: 301 GVISVIATDHAPHEEDSKRVPFCQAANGVVGLETLLPITLELVEAGVLPLAKALAAISCN 360

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA++  +P GTL      D+ L D    WTV A  +    KNT F      G+V  T ++
Sbjct: 361 PARLLGMPRGTLSLNAVGDVVLFDPQQSWTVDALALHGSSKNTAFAGRQVKGRVKYTILA 420

Query: 423 GKQVY 427
           G+ V+
Sbjct: 421 GRIVH 425


>gi|241662188|ref|YP_002980548.1| dihydroorotase [Ralstonia pickettii 12D]
 gi|240864215|gb|ACS61876.1| dihydroorotase, multifunctional complex type [Ralstonia pickettii
           12D]
          Length = 425

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 143/422 (33%), Positives = 219/422 (51%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  ID    + +    ++  G     A F  +  I D TGLV  PG+ID  
Sbjct: 5   IKGGRLIDPANGIDAQQDLYIAASKVVGVGH--APADFHANKTI-DATGLVVCPGLIDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A+AGG+TS++  P      LDE   ++      R  +  +
Sbjct: 62  ARLREPGFEYKATLESEMAAAMAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNLNQAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G  ++EM  L E G V F Q+   + DTQVL+ +++YA      V L 
Sbjct: 121 VYPLGALTVGLKGAVLTEMAELTESGCVGFSQTDAPMADTQVLMRALQYAQTFGFTVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D +LG  GV   G +A+ LGL G+P I+ETV L     + + TG   H   +S    I
Sbjct: 181 PEDPYLGKGGVAASGPLASRLGLSGVPVIAETVRLHTIFELIRSTGARVHLCRLSSAAGI 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L++ AKA     TC ++++++ L + D+  +NS  + +PPLRS  +R  +V AL  G I
Sbjct: 241 ELVRRAKAEGLPVTCDVNVHHISLTDVDIGYFNSQMRFVPPLRSGRDRDGIVRALADGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I SDHTP   D KLLPFAEA+ G+ GLET+L   LR     ++ L K +  +++ PA+
Sbjct: 301 DAICSDHTPVDDDEKLLPFAEATPGATGLETLLPLTLRWATEHKVELSKALARITSEPAR 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  L  G+L+ G  AD+ + D +  W ++   + S  KN+ +      G+V  T ++G  
Sbjct: 361 VLGLHAGSLEVGAMADVCVFDPDATWKLEPRALRSQGKNSPYLGFELAGRVRATMVAGHL 420

Query: 426 VY 427
            Y
Sbjct: 421 AY 422


>gi|253996007|ref|YP_003048071.1| dihydroorotase, multifunctional complex type [Methylotenera mobilis
           JLW8]
 gi|253982686|gb|ACT47544.1| dihydroorotase, multifunctional complex type [Methylotenera mobilis
           JLW8]
          Length = 424

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 146/422 (34%), Positives = 227/422 (53%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           + N ++IDP  +I+E   + +  G IL+ GA  +   F  +  I D T L   PG++D  
Sbjct: 5   IKNGQVIDPKNNINEKLDVYIAAGKILSVGA--MPDGFVATKTI-DATNLTVCPGLVDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L    DEY   + +  + AVAGG+TS+   P      LDE   ++      + + L +
Sbjct: 62  ARLREPGDEYKARLASELQAAVAGGVTSLACPP-DTDPVLDEPGLVEMLKHRAKQQGLAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   +T  ++G  +SEM  L   G V F Q+ +++ DTQVL  +M+YA   +  + L 
Sbjct: 121 VYPLGAMTRQLKGAALSEMNELHNAGCVGFSQANIAVTDTQVLWRAMEYAATFDFTLFLH 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             + FL + GV ++G +A  +GL GIPS +E + LA  L IAQ TG   H S +S  + +
Sbjct: 181 AEEPFLAANGVAHDGEVATRMGLKGIPSAAEALALASILRIAQETGASVHISRLSTAEGV 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
           ++I+ AKA   K +C +S N+L+L E+D+  +++   + PPLR++ ++  +   L+ G I
Sbjct: 241 SMIRAAKAQGLKVSCDVSANHLLLTEHDIAYFDANCHLKPPLRTQRDKAELSAGLKDGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I SDHTP   D KL PFAEA  G+ GLE +L   L+    +++SL + I  ++   A 
Sbjct: 301 DAICSDHTPVDDDAKLAPFAEAEIGATGLELLLPLTLKWAAQEKVSLSQAIEHITQASAS 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I  +  G L   + AD+ + D N  W V    + S  KNT F      GKV  T ++G+ 
Sbjct: 361 ILGVAAGDLSPNSNADLCIFDANEYWKVSPKTLKSQGKNTPFTGLELAGKVKFTLVNGQV 420

Query: 426 VY 427
           VY
Sbjct: 421 VY 422


>gi|85860057|ref|YP_462259.1| dihydroorotase [Syntrophus aciditrophicus SB]
 gi|123517126|sp|Q2LVI3|PYRC_SYNAS RecName: Full=Dihydroorotase; Short=DHOase
 gi|85723148|gb|ABC78091.1| dihydroorotase [Syntrophus aciditrophicus SB]
          Length = 426

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 142/424 (33%), Positives = 234/424 (55%), Gaps = 3/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L   R+IDP++++D    +++ENG I AA A+A+ +  P    + D  G++ +PG++D
Sbjct: 3   ILLKGGRVIDPAQNLDGQMDLLLENGKI-AAIAEAVGS-VPEDTRLLDLKGMILLPGLVD 60

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L     EY + I + S+ A  GG TSI  MP  +    D  T  +Y L+  +    
Sbjct: 61  MHTHLREPGYEYKETIRSGSEAAAVGGFTSIACMPNTLP-VNDNRTVTEYILKRAKECDT 119

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           ++VYP A ++ N EGK ++E   L+E G ++F      + ++ ++  +++YA  L+ I+ 
Sbjct: 120 VHVYPVAAVSRNSEGKILAEFGDLKEAGAIAFSDDGKPVMNSILMRRALEYASSLDRIII 179

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  L + G++NEG I+  LGL GIP+++E V +ARDLL+A+ +G   H + +S   
Sbjct: 180 SHCEDLNLSAGGLMNEGKISTELGLPGIPTLAEDVMVARDLLLAEFSGAALHIAHVSSAG 239

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           ++ +I+ AK    + T   + +   L +  V  +N+  KV PPLRS  +  ++ E L  G
Sbjct: 240 AVRMIRDAKKRGVRVTAETTPHYFTLTDEAVTNFNTNTKVSPPLRSREDLQAVREGLRDG 299

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            +D IV+DH P  +  K + F  A+ G  GLET L+ +L L     ++L +L+R +S  P
Sbjct: 300 TLDAIVTDHAPHALTDKEVEFEYAANGISGLETALALSLTLVDDGLLTLSELVRKMSVNP 359

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+I N+P GTL+ G  ADI +++    W V   +  S  KNT F      GKV+ T + G
Sbjct: 360 AKILNIPKGTLRPGADADITVLNPGKTWVVDPSNWRSQGKNTPFFGWTLKGKVIMTLVQG 419

Query: 424 KQVY 427
           + VY
Sbjct: 420 RIVY 423


>gi|309780783|ref|ZP_07675524.1| dihydroorotase, multifunctional complex type [Ralstonia sp.
           5_7_47FAA]
 gi|308920465|gb|EFP66121.1| dihydroorotase, multifunctional complex type [Ralstonia sp.
           5_7_47FAA]
          Length = 425

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 143/422 (33%), Positives = 218/422 (51%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  ID    + +    ++  G     A F  +  I D TGLV  PG+ID  
Sbjct: 5   IKGGRLIDPANGIDAQQDLYIAASKVVGVGH--APADFHANKTI-DATGLVVCPGLIDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A+AGG+TS++  P      LDE   ++      R  +  +
Sbjct: 62  ARLREPGFEYKATLESEMAAAMAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNLNQAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G  ++EM  L E G V F Q+   + DTQVL+ +++YA      V L 
Sbjct: 121 VYPLGALTVGLKGAVLTEMAELTESGCVGFSQTDAPMADTQVLMRALQYAQTFGFTVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D +LG  GV   G +A+ LGL G+P I+ETV L     + + TG   H   +S    I
Sbjct: 181 PEDPYLGKGGVAASGPLASRLGLSGVPVIAETVRLHTIFELIRSTGARVHLCRLSSAAGI 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L++ AKA     TC ++++++ L + D+  +NS  + +PPLRS  +R  +V AL  G I
Sbjct: 241 ELVRRAKAEGLPVTCDVNVHHISLTDIDIGYFNSQMRFVPPLRSGRDRDGIVRALADGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I SDHTP   D KLLPFAEA+ G+ GLET+L   LR     ++ L K +  +++ PA+
Sbjct: 301 DAICSDHTPVDDDEKLLPFAEATPGATGLETLLPLTLRWATEHKVELSKALARITSEPAR 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  L  G+L+ G  AD+ + D    W ++   + S  KN+ +      G+V  T ++G  
Sbjct: 361 VLGLRAGSLEVGAMADVCVFDPEATWKLEPRALRSQGKNSPYLGFELAGRVRATMVAGHL 420

Query: 426 VY 427
            Y
Sbjct: 421 AY 422


>gi|159045634|ref|YP_001534428.1| dihydroorotase [Dinoroseobacter shibae DFL 12]
 gi|157913394|gb|ABV94827.1| dihydroorotase [Dinoroseobacter shibae DFL 12]
          Length = 432

 Score =  239 bits (610), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 147/424 (34%), Positives = 229/424 (54%), Gaps = 3/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
             L + RI+DP       G +++ NG+I A    A   + P    + DC G    PGI+D
Sbjct: 7   LALIHARIVDPGTGELREGGLLLRNGVIAAHLGPA--ERLPADTEVLDCGGKCLAPGIVD 64

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V +    + + ++  T  + A AGG+T+++      +  +D    +++A       S 
Sbjct: 65  IGVKVGEPGERHKESFRTAGRAAAAGGVTTMVTR-ADTTPAIDSPETLEFAARRAAEASP 123

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + + P A LT   +G+E+ E+  LQ+ G V+F      + D +V    + YA  L A+V 
Sbjct: 124 VRLAPMAALTKGRQGREMVEIGFLQDAGAVAFSDGDHVVADPKVFQRCLAYATSLGALVM 183

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  L +   +  G  A   GL  +  ++E + L RDL + + TG  YHA  I+  +
Sbjct: 184 AHPQDPGLSAGAAVTSGKFATLRGLPAVSPMAERMGLERDLALVEMTGARYHADQITTAR 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           ++  ++ A+      T GISI++L LNE DV  Y +  KV PPLR+ET+R++MV A+  G
Sbjct: 244 ALPSLRRAREIGLDVTAGISIHHLTLNEFDVGDYRTFFKVKPPLRAETDRVAMVAAVAAG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
           +IDII S HTP+  ++K LPF EA+ G++GLET+L AALRL H  +++L +L RALS  P
Sbjct: 304 EIDIISSMHTPQDEESKRLPFEEAASGAVGLETLLPAALRLVHSGELTLPQLWRALSLNP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A    LP G L  G+ AD+ L D +  + +    + S  KNT FD     G+V+RTY+ G
Sbjct: 364 ANRLGLPQGRLDPGSPADLVLFDPDAPFVLDRTMLHSKSKNTPFDGARLQGRVLRTYVDG 423

Query: 424 KQVY 427
           + V+
Sbjct: 424 RPVH 427


>gi|86139056|ref|ZP_01057627.1| dihydroorotase, multifunctional complex type [Roseobacter sp.
           MED193]
 gi|85824287|gb|EAQ44491.1| dihydroorotase, multifunctional complex type [Roseobacter sp.
           MED193]
          Length = 436

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 140/428 (32%), Positives = 230/428 (53%), Gaps = 9/428 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGII---LAAGADA---LNAKFPTSALIH--DCTGLVAVP 59
           N R+IDP    D +G ++V++G I   L AG +      A+   +  +   DC G    P
Sbjct: 7   NARLIDPEAGTDSLGVLLVQDGKIAEILPAGTEPGQLFRARNIDAEAVEVVDCEGKCLAP 66

Query: 60  GIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR 119
           GI+D  V +    + + ++  T    A AGG+T+I+  P   +  +D    +++     +
Sbjct: 67  GIVDIGVKVCEPGERHKESYKTAGLAAAAGGVTTIVTRP-DTTPAIDSPETLEFVTRRAQ 125

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
             + ++V P A LT   EG+E++E+  L + G V+F      + +T+V   ++ YA    
Sbjct: 126 ADAPVHVRPMAALTKGREGREMTEIGFLMDAGAVAFSDCDHVVSNTKVFSRALTYARSCG 185

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
           A+V     +  L +      G  A   GL  +  ++E + L RD+ + + TG  YHA  I
Sbjct: 186 ALVIAHPQEPLLSAGAAATSGKFAALRGLPAVSPMAERMGLDRDIALLEMTGAKYHADQI 245

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           +  +++  ++ AKA+    T G SI++L LNE DV  Y +  KV PPLRSE +R+++ EA
Sbjct: 246 TTARALPALERAKANGLDITAGTSIHHLTLNELDVADYRTFFKVKPPLRSEEDRLAVAEA 305

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           +  G ID I S HTP+  ++K LPF EA+ G++ LET+L AA+RL+HG+ + L  L RA+
Sbjct: 306 VRTGLIDTISSMHTPQDEESKRLPFEEAAAGAVALETLLPAAMRLYHGELMDLPTLFRAM 365

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           +  PA+   L  G L  G  AD+ L D +  + +    + S  +NT +D +   G+V+ T
Sbjct: 366 ALNPAKRLGLSSGRLSPGAPADLVLFDPDMPFVMDRFQLKSKSQNTPYDGQRMQGRVLAT 425

Query: 420 YISGKQVY 427
           Y++G  VY
Sbjct: 426 YVTGTPVY 433


>gi|15606174|ref|NP_213551.1| dihydroorotase [Aquifex aeolicus VF5]
 gi|3914514|sp|O66990|PYRC_AQUAE RecName: Full=Dihydroorotase; Short=DHOase
 gi|221046673|pdb|3D6N|A Chain A, Crystal Structure Of Aquifex Dihydroorotase Activated By
           Aspartate Transcarbamoylase
 gi|2983361|gb|AAC06948.1| dihydroorotase [Aquifex aeolicus VF5]
          Length = 422

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 147/428 (34%), Positives = 231/428 (53%), Gaps = 9/428 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M   ++ N  +IDPS++++    I+VENG I     + L    P + +I D  GL+  PG
Sbjct: 1   MLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNIL---VPEAEII-DAKGLIVCPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
            ID  V L      Y ++I + S+ AVAGG T+I+ MP   +  +D  T + Y L++ + 
Sbjct: 57  FIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMP-NTNPPIDNTTVVNYILQKSKS 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             L  V PT  +T   +GKEI++   L+E G V+F      + D+ V+  +++ A  L  
Sbjct: 116 VGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGV 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +     D  L + GVINEG ++  LGL      +E + +ARD ++AQ TGGH H   +S
Sbjct: 176 PIMDHCEDDKL-AYGVINEGEVSALLGLSSRAPEAEEIQIARDGILAQRTGGHVHIQHVS 234

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S+ +I+  K    K TC ++ N+L+  E +V    +  +V PPLR + +R++++E +
Sbjct: 235 TKLSLEIIEFFKEKGVKITCEVNPNHLLFTEREVLNSGANARVNPPLRKKEDRLALIEGV 294

Query: 301 EKGDIDIIVSDHTPRH-MDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           ++G ID   +DH P    + +L+ FA    G IGL+T L +AL L+    ISLKKLI   
Sbjct: 295 KRGIIDCFATDHAPHQTFEKELVEFAMP--GIIGLQTALPSALELYRKGIISLKKLIEMF 352

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           +  PA+I  +  GTL+ G+ ADI + D N +W +  +   S  +NT    +   GKV+ T
Sbjct: 353 TINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYT 412

Query: 420 YISGKQVY 427
              GK VY
Sbjct: 413 IKDGKMVY 420


>gi|73536332|pdb|1XRF|A Chain A, The Crystal Structure Of A Novel, Latent Dihydroorotase
           From Aquifex Aeolicus At 1.7 A Resolution
 gi|73536333|pdb|1XRT|A Chain A, The Crystal Structure Of A Novel, Latent Dihydroorotase
           From Aquifex Aeolicus At 1.7 A Resolution
 gi|73536334|pdb|1XRT|B Chain B, The Crystal Structure Of A Novel, Latent Dihydroorotase
           From Aquifex Aeolicus At 1.7 A Resolution
          Length = 467

 Score =  239 bits (609), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 147/428 (34%), Positives = 231/428 (53%), Gaps = 9/428 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M   ++ N  +IDPS++++    I+VENG I     + L    P + +I D  GL+  PG
Sbjct: 46  MLKLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNIL---VPEAEII-DAKGLIVCPG 101

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
            ID  V L      Y ++I + S+ AVAGG T+I+ MP   +  +D  T + Y L++ + 
Sbjct: 102 FIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMP-NTNPPIDNTTVVNYILQKSKS 160

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             L  V PT  +T   +GKEI++   L+E G V+F      + D+ V+  +++ A  L  
Sbjct: 161 VGLCRVLPTGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMDSSVMRKALELASQLGV 220

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +     D  L + GVINEG ++  LGL      +E + +ARD ++AQ TGGH H   +S
Sbjct: 221 PIMDHCEDDKL-AYGVINEGEVSALLGLSSRAPEAEEIQIARDGILAQRTGGHVHIQHVS 279

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S+ +I+  K    K TC ++ N+L+  E +V    +  +V PPLR + +R++++E +
Sbjct: 280 TKLSLEIIEFFKEKGVKITCEVNPNHLLFTEREVLNSGANARVNPPLRKKEDRLALIEGV 339

Query: 301 EKGDIDIIVSDHTPRH-MDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           ++G ID   +DH P    + +L+ FA    G IGL+T L +AL L+    ISLKKLI   
Sbjct: 340 KRGIIDCFATDHAPHQTFEKELVEFAMP--GIIGLQTALPSALELYRKGIISLKKLIEMF 397

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           +  PA+I  +  GTL+ G+ ADI + D N +W +  +   S  +NT    +   GKV+ T
Sbjct: 398 TINPARIIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKVIYT 457

Query: 420 YISGKQVY 427
              GK VY
Sbjct: 458 IKDGKMVY 465


>gi|323140644|ref|ZP_08075568.1| putative dihydroorotase [Phascolarctobacterium sp. YIT 12067]
 gi|322414908|gb|EFY05703.1| putative dihydroorotase [Phascolarctobacterium sp. YIT 12067]
          Length = 428

 Score =  239 bits (609), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 139/423 (32%), Positives = 229/423 (54%), Gaps = 6/423 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           ++ N R++DPS+ +D V  I+VE+G I A G D   A    +  + D TGLV  PG+ID 
Sbjct: 1   MIKNGRVVDPSQQLDAVMDILVEDGKIKALGKDIAEA----ADEVFDATGLVVTPGLIDV 56

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
              +     E  ++I + +K A AGG+T++  MP      +D    +    E  R +S  
Sbjct: 57  HTHMREPGLEAKEDIISGTKAAAAGGVTTVACMP-NTKPVIDTAIVVSGIKERAREESYA 115

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           NV     ++   +G+E++EM  + E+G + F      +  +++++ + KY    +  +  
Sbjct: 116 NVEVIGAISKGEKGEELAEMGDMAEKGAMGFSDDGHYVKSSRLMVLAAKYVTAFDKPLLC 175

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D  L S G ++EG+++  +G+ G+P+ISE + +ARD +IA++TG H H   ++   +
Sbjct: 176 HAIDPELDSEGYMHEGVVSARIGVPGVPAISEDIAVARDCIIAEYTGAHVHICHVASKGA 235

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           I +I+ AK      T  +++++L L +     YNS  +V PPLRS     +M EA+  G 
Sbjct: 236 IDIIRQAKKRGVNVTSEVTVHHLTLTDEACADYNSATRVNPPLRSADHVQAMREAVLDGT 295

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALSTRP 363
           +D IV+DH+P   + K + F  A  G  GLET L+  L  L+H     L  +I  +S  P
Sbjct: 296 VDAIVTDHSPHAPEEKDVEFRYAPNGFCGLETSLAVILTDLYHTHVFDLNTIISKMSCEP 355

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++F L GGTL+ G+ ADI ++DLN +WTV +    +  K T ++ +  TGK V T + G
Sbjct: 356 AKLFKLAGGTLKEGSVADITIMDLNKKWTVDSSKFYTRGKFTPYEGKACTGKAVATMLHG 415

Query: 424 KQV 426
             V
Sbjct: 416 NFV 418


>gi|269958559|ref|YP_003328346.1| dihydroorotase [Anaplasma centrale str. Israel]
 gi|269848388|gb|ACZ49032.1| dihydroorotase [Anaplasma centrale str. Israel]
          Length = 454

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 139/423 (32%), Positives = 220/423 (52%), Gaps = 6/423 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAK-FPTSA-LIHDCTGLVAVPGIIDAR 65
           N R+IDP  + D  G ++     I   G     A+ F +SA  + DC G V +PGI+D  
Sbjct: 32  NARVIDPGSNTDAPGYVVTRGREISHFGFGEHKAEDFQSSANEVIDCGGHVLMPGIVDIH 91

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L     E+ + I T S+ A AGG+T+++  P   S  +D     KY        S +N
Sbjct: 92  VHLREPGGEHKETIDTGSRSAAAGGVTTVVCQP-NTSPHIDSVMVAKYLKMRALESSCVN 150

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           +     +T       + +M  L+E G + F      + +   +  + + A  L  +VA  
Sbjct: 151 IEFYGSITKPC--GSLCDMPALKEAGALGFTDDGSPVMNALSMKRAFECASTLGVVVAQH 208

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDL-LIAQHTGGHYHASVISIPQS 244
             D  L   G INEG ++  LGL GI  +SE++ + RD+ L+ +  G  YH   +S  ++
Sbjct: 209 AEDCHLSDGGCINEGKVSQELGLKGISDLSESIMVGRDIELLREVPGARYHVLHVSTKKA 268

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           I LI+ AK      TC ++ ++  L E+ V  + ++ K+ PPLR+E +R+ MVE L  G 
Sbjct: 269 IDLIRSAKNEGLPVTCEVTPHHFALTEDAVREHGTMAKMNPPLRTEEDRLCMVEGLVDGT 328

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I +DH P     K LP +  +FG +GLETML  +L L+H  ++ L +++  L+ +P+
Sbjct: 329 IDCIATDHAPHSCQDKALPISSCAFGVVGLETMLPLSLELYHSGKMGLLEVLSKLTDKPS 388

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            I  +P G +  G  AD+ L+DL+++WTV     +S  KN+ F      GK +RT ++GK
Sbjct: 389 DIVKIPRGRIAKGLVADLVLVDLDHEWTVDTTKFASKSKNSPFHGRTVKGKALRTVVAGK 448

Query: 425 QVY 427
            VY
Sbjct: 449 TVY 451


>gi|299067783|emb|CBJ38993.1| Dihydroorotase, Carbamoylaspartic dehydrase [Ralstonia solanacearum
           CMR15]
          Length = 425

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 140/422 (33%), Positives = 218/422 (51%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  ID    + +  G ++  G     A F  +  + D  GLV  PG+ID  
Sbjct: 5   IKGGRLIDPANGIDAQQDLYIAAGKVVGVGR--APADFHANKTV-DAAGLVVCPGLIDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A+AGG+TS++  P      LDE   ++      R  +  +
Sbjct: 62  ARLREPGYEYKATLESEMAAAMAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNLNQAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G  ++EM  L E G V F Q+   + DT VL+ +++YA      V L 
Sbjct: 121 VYPLGALTVGLKGLVLTEMAELTEAGCVGFSQADAPMTDTLVLMRALQYAQTFGFTVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D FLG  GV   G +A+ LGL G+P ++ETV L     + + TG   H   +S    +
Sbjct: 181 PEDPFLGKGGVAASGPLASRLGLAGVPVMAETVRLHTIFELIRSTGARVHLCRLSSAAGL 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L++ AKA     TC ++++++ L + D+  +NS  + +PPLR+  +R  +V AL  G I
Sbjct: 241 ELVRRAKAEGLPVTCDVNVHHISLTDVDIGYFNSQMRFMPPLRAGRDRDGIVRALADGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I SDHTP   D KLLPFAEAS G+ GLET+L   LR     ++ L + +  +++ PA+
Sbjct: 301 DAICSDHTPVDDDEKLLPFAEASPGATGLETLLPLTLRWAAEHKVDLPRALARITSEPAR 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  L  G+L+ G  AD+ + D +  W V+   + S  KN+ +      G+V  T ++G  
Sbjct: 361 VLGLQAGSLEEGAMADVCVFDPDATWKVEPRSLRSQGKNSPYLGFELAGRVRATLVAGHL 420

Query: 426 VY 427
            Y
Sbjct: 421 AY 422


>gi|187927719|ref|YP_001898206.1| dihydroorotase [Ralstonia pickettii 12J]
 gi|187724609|gb|ACD25774.1| dihydroorotase, multifunctional complex type [Ralstonia pickettii
           12J]
          Length = 425

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 142/422 (33%), Positives = 218/422 (51%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  +D    + +    ++  G     A F  +  I D TGLV  PG+ID  
Sbjct: 5   IKGGRLIDPANGVDAQQDLYIAASKVVGVGH--APADFHANKTI-DATGLVVCPGLIDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A+AGG+TS++  P      LDE   ++      R  +  +
Sbjct: 62  ARLREPGFEYKATLESEMAAAMAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNLNQAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G  ++EM  L E G V F Q+   + DTQVL+ +++YA      V L 
Sbjct: 121 VYPLGALTVGLKGAVLTEMAELTESGCVGFSQTDAPMADTQVLMRALQYAQTFGFTVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D +LG  GV   G +A+ LGL G+P I+ETV L     + + TG   H   +S    I
Sbjct: 181 PEDPYLGKGGVAASGPLASRLGLSGVPVIAETVRLHTIFELIRSTGARVHLCRLSSAAGI 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L++ AKA     TC ++++++ L + D+  +NS  + +PPLRS  +R  +V AL  G I
Sbjct: 241 ELVRRAKAEGLPVTCDVNVHHISLTDIDIGYFNSQMRFVPPLRSGRDRDGIVRALADGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I SDHTP   D KLLPFAEA+ G+ GLET+L   LR     ++ L K +  +++ PA+
Sbjct: 301 DAICSDHTPVDDDEKLLPFAEATPGATGLETLLPLTLRWATEHKVELSKALARITSEPAR 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  L  G+L+ G  AD+ + D    W ++   + S  KN+ +      G+V  T ++G  
Sbjct: 361 VLGLRAGSLEVGAMADVCVFDPAATWKLEPRALRSQGKNSPYLGFELAGRVRATMVAGHL 420

Query: 426 VY 427
            Y
Sbjct: 421 AY 422


>gi|300692306|ref|YP_003753301.1| dihydroorotase, carbamoylaspartic dehydrase [Ralstonia solanacearum
           PSI07]
 gi|299079366|emb|CBJ52038.1| Dihydroorotase, Carbamoylaspartic dehydrase [Ralstonia solanacearum
           PSI07]
          Length = 425

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 140/422 (33%), Positives = 219/422 (51%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  ID    + +  G ++  G    +  F  +  I D TGLV  PG+ID  
Sbjct: 5   IKGGRLIDPANGIDAQQDLYIAAGKVVGVGRAPTD--FHANKTI-DATGLVVCPGLIDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A+AGG+TS++  P      LDE   ++      R  +  +
Sbjct: 62  ARLREPGYEYKATLESEMAAAMAGGVTSLVCPP-DTEPVLDEPGLVEMLKFRARNLNQAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G  ++EM  L E G V F Q+   + DT VL+ +++YA      V L 
Sbjct: 121 VYPLGALTVGLKGLVLTEMAELTEAGCVGFSQADAPMTDTLVLMRALQYAQTFGFTVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D FLG  GV   G +A+ LGL G+P ++ETV L     + + TG   H   +S    +
Sbjct: 181 PEDPFLGKGGVAASGPLASRLGLAGVPVMAETVRLHTIFELMRSTGARVHLCRLSSAAGL 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +++ AKA     TC ++++++ L + D+  +NS  + +PPLR+  +R  +V AL  G I
Sbjct: 241 EVVRRAKAEGLPVTCDVNVHHISLTDVDIGYFNSQMRFVPPLRAGRDRDGIVRALADGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I SDHTP   D KLLPFAEAS G+ GLET+L   LR     ++ L + +  +++ PA+
Sbjct: 301 DAICSDHTPVDDDEKLLPFAEASPGATGLETLLPLTLRWAAEHKVDLPRALARITSEPAR 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  L  G+L+ G  AD+ + D +  W V+   + S  KN+ +      G+V  T ++G  
Sbjct: 361 VLGLQAGSLEEGARADVCVFDPDATWKVEPRSLRSQGKNSPYLGFELAGRVRATLVAGHL 420

Query: 426 VY 427
            Y
Sbjct: 421 AY 422


>gi|302037852|ref|YP_003798174.1| dihydroorotase [Candidatus Nitrospira defluvii]
 gi|300605916|emb|CBK42249.1| Dihydroorotase [Candidatus Nitrospira defluvii]
          Length = 430

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 142/428 (33%), Positives = 221/428 (51%), Gaps = 5/428 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++    +IDP R ++ V  +++ENG I A G  AL A  P  A +    G + +PG +
Sbjct: 2   TLLIQGGHVIDPGR-VNGVADVLIENGTISAVGP-ALKA--PAGATVIQAKGQLVLPGFV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V       EY + I + +  AVAGG T++  MP   +   D     ++ LE  +   
Sbjct: 58  DLHVHFREPGFEYKETIQSGTAAAVAGGFTTVCAMP-NTNPVNDNQAVTEFMLERAKAAG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
             ++YP   +T   EGKE++E+  L+  G V+       + ++ V+  +M+YA   +  V
Sbjct: 117 NAHLYPIGAITKKSEGKELAEIGDLRRAGCVAISDDGKPVMNSLVMRRAMEYARAFDVPV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G +NEG+++  LGL GIPS +E V +AR++ +A+ TG   H + IS  
Sbjct: 177 VDHCEDLHLSEGGCMNEGLVSTELGLPGIPSAAEDVMVARNVSLAELTGARLHLAHISTA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S+ +++ AKA   K T     ++  L E     YN+  K+ PPLR+  +  ++ E L  
Sbjct: 237 GSVRMVREAKARGLKVTAEACPHHFTLTEELTRGYNTHAKMNPPLRTMQDVQAIKEGLRD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID+I +DH P     K   F EA FG +GLET LS  L L     ++L+  I  L+T 
Sbjct: 297 GTIDVIATDHAPHATQEKQQEFTEAPFGIVGLETALSLTLALVDEGVLTLESAIDKLATA 356

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ F+L  GTL  G  AD+A++D N +W V      S  +NT F      G+V  T +S
Sbjct: 357 PAKAFSLNAGTLAVGAPADVAIVDPNREWQVDPSRFRSKSRNTPFAGWKVRGRVTTTIVS 416

Query: 423 GKQVYTLE 430
           G+ V+ L+
Sbjct: 417 GRVVFELD 424


>gi|295690148|ref|YP_003593841.1| dihydroorotase, multifunctional complex type [Caulobacter segnis
           ATCC 21756]
 gi|295432051|gb|ADG11223.1| dihydroorotase, multifunctional complex type [Caulobacter segnis
           ATCC 21756]
          Length = 433

 Score =  238 bits (606), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 139/425 (32%), Positives = 228/425 (53%), Gaps = 3/425 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N R++DP    D  G +IV  G+I          K   +  + DC G +  PG+ID RV 
Sbjct: 11  NARLVDPESGYDGRGGVIVSEGVITDVAKGREFGKLSKAVRVIDCGGALLAPGLIDLRVR 70

Query: 68  LTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
            TG P  E  + + + +K A AGG+TS ++ P   +  +D+ + + + L   R      +
Sbjct: 71  -TGEPGAETKETLASAAKAAAAGGVTSFVVQP-DTAPAIDDPSVVDFILRRARDIDSARI 128

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
                 T  ++G++++E+ L++E G V    +   I D++V+   + YA   +A++A   
Sbjct: 129 LVAGAATRGLKGEQMAEIGLMREAGCVYVTDAGKPIVDSKVMQRVLTYAKGFDALLAHRP 188

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIA 246
            D +LG  G    G  A  +GL  I  ++E + L RD+ + + TGG      IS  Q++ 
Sbjct: 189 MDPWLGKGGAAIGGEFAGRMGLPSISPMAERIMLERDVALLEATGGKLLVDQISSAQALE 248

Query: 247 LIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDID 306
            ++ AK    +    +SIN+L  NE D+  Y +  K+ PPLR E +R +++EAL  G ID
Sbjct: 249 TLERAKKKGLRIHASVSINHLSFNELDIGDYRTFAKLNPPLRGEDDRQALIEALASGLID 308

Query: 307 IIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQI 366
           ++VS H+P   + K LPF EA+ G++GLET+L A L L+H ++I+L  LIRA++  PA++
Sbjct: 309 VVVSSHSPAPAEDKRLPFDEAAPGAVGLETLLPALLSLYHEERIALVDLIRAVTLAPAEL 368

Query: 367 FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
             L GG +  G  AD+ L D++    + A  + S  KN+ FD     G+V+ T + G+ V
Sbjct: 369 LGLRGGRIAPGAPADLVLCDIDAPIIIDAARLLSKSKNSPFDGRRLQGQVLMTVVDGRVV 428

Query: 427 YTLES 431
           +  E 
Sbjct: 429 HRAEG 433


>gi|254463660|ref|ZP_05077071.1| dihydroorotase [Rhodobacterales bacterium Y4I]
 gi|206684568|gb|EDZ45050.1| dihydroorotase [Rhodobacterales bacterium Y4I]
          Length = 436

 Score =  238 bits (606), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 144/428 (33%), Positives = 230/428 (53%), Gaps = 9/428 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAA---GADA---LNAKFPTSALIH--DCTGLVAVP 59
           N R+IDP    D  G ++V NG I A    G DA   L+A   +   ++  +C G    P
Sbjct: 7   NARLIDPEHGSDTPGMVLVLNGRIAAVEKNGTDAASLLSAHNISQGDVNQVNCGGKCLAP 66

Query: 60  GIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR 119
           GI+D  V +    + + ++  +    A AGG+T+I+  P   +  +D    +++     +
Sbjct: 67  GIVDIGVKVCEPGERHKESYKSAGLAAAAGGVTTIVTRP-DTAPAIDSPETLEFVTRRAQ 125

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
             + +NV P A LT   EG+E++E+R L + G V+F      + +T+V   ++ YA    
Sbjct: 126 ADTPVNVLPMAALTKGREGREMTEIRFLMDAGAVAFSDCDHVVQNTKVFQRALTYARSCG 185

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
           A+V     +  L        G +A   GL  +  ++E + L RD+ + + TG  YHA  I
Sbjct: 186 ALVIAHPQEPGLSHGAAATSGKLAALYGLPSVSPMAERMGLDRDIALLEMTGAKYHADQI 245

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           +  +++  ++ AKA+    T G SI++L LNE DV  Y S  KV PPLRSE +R+++VEA
Sbjct: 246 TTARALPALERAKANGLDVTAGTSIHHLTLNELDVAGYRSFFKVKPPLRSEEDRLAVVEA 305

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           +  G ID+I S HTP+  ++K LPF EA+ G++ LET+L AALRL H   + +  L RA+
Sbjct: 306 VRTGLIDVISSMHTPQDEESKRLPFEEAAAGAVALETLLPAALRLCHDGLLDMPALFRAM 365

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           +  PA+   L  G L  G  AD+ L D +  + +    + S  +NT +D +   G+V  T
Sbjct: 366 ALNPAKRLGLDSGRLAKGAPADLVLFDPDVPFVMDRFKLRSKSQNTPYDGQRMQGRVEAT 425

Query: 420 YISGKQVY 427
           Y++G+ VY
Sbjct: 426 YVAGEPVY 433


>gi|51892396|ref|YP_075087.1| dihydroorotase [Symbiobacterium thermophilum IAM 14863]
 gi|51856085|dbj|BAD40243.1| dihydroorotase [Symbiobacterium thermophilum IAM 14863]
          Length = 434

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 137/427 (32%), Positives = 223/427 (52%), Gaps = 7/427 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M+S ++   R++DP+  +D V  ++V +G I A G        P  A + + +G V  PG
Sbjct: 1   MSSLLIRGGRLLDPANGVDRVADVLVADGRIRAIGE---GLPVPPGATVIEASGKVVAPG 57

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
            ID  V L     EY +++ T +  AV GG   ++ MP      +D    + + L+    
Sbjct: 58  FIDVHVHLRVPGQEYKEDMRTGTAAAVRGGFVGVVCMP-NTRPVIDSAPLVAHVLDLAGR 116

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           + L  V+P   +T   +G+E++E+  +   G V+       +   + +  +M YA   + 
Sbjct: 117 EGLCRVWPAGAITKGSQGEELAEIGEMARAGAVAVTDDGKPVDRAETMRQAMIYARQFDL 176

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V     D  L + G ++EG +++ LGL GIP+ +E V +ARD+L+A  TG   H   +S
Sbjct: 177 PVMDHCEDRSLSAGGAMHEGRVSSLLGLKGIPAAAEEVHVARDILLALETGARVHLQHLS 236

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVE--MYNSLRKVLPPLRSETERMSMVE 298
             +S+ L++  KA   + T   + ++  L +  V    Y+   K+ PPLR E +R +++E
Sbjct: 237 SRRSVELVRWGKAQGARVTAEATPHHFTLTDQAVADMAYSPNTKMNPPLREEADRQAILE 296

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIR 357
            L  G ID+I +DH P H+D K + +  A+FG  GLET +  AL RL     I L++LI 
Sbjct: 297 GLADGTIDVIATDHAPHHVDEKDVEYPLAAFGITGLETAVGLALDRLVRPGLIRLEQLIL 356

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            LSTRPA++ N     L+ G  ADI ++DL+  WTV AD+M+S  +N+ F     TG   
Sbjct: 357 MLSTRPARLINRTPPALREGAEADITVLDLDRTWTVSADEMASKSRNSPFIGWTLTGAPY 416

Query: 418 RTYISGK 424
            T + G+
Sbjct: 417 ATVVGGR 423


>gi|16126683|ref|NP_421247.1| aspartate transcarbamoylase subunit PyrC' [Caulobacter crescentus
           CB15]
 gi|221235462|ref|YP_002517899.1| dihydroorotase [Caulobacter crescentus NA1000]
 gi|13423989|gb|AAK24415.1| aspartate transcarbamoylase, pyrC' subunit [Caulobacter crescentus
           CB15]
 gi|220964635|gb|ACL95991.1| dihydroorotase [Caulobacter crescentus NA1000]
          Length = 433

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 224/425 (52%), Gaps = 3/425 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N R++DP    D  G +IV  G+I          K   +  + DC G +  PG+ID RV 
Sbjct: 11  NARLVDPESGYDGPGGVIVSEGVITDVAKGREFGKLSKAVRVVDCGGALLAPGLIDLRVR 70

Query: 68  LTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
            TG P  E  + + + +K A AGG+TS ++ P   +  +D+ + + + L   R      +
Sbjct: 71  -TGEPGAETKETLASAAKAAAAGGVTSFVVQP-DTAPAIDDPSMVDFILRRARDVDSARI 128

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
                 T  + G++++E+ L++E G V    +   I D++V+   + YA   + ++A   
Sbjct: 129 LVAGAATKALLGEQMAEIGLMREAGCVYVTDAGKPIVDSKVMQRVLTYAKGFDTLLAHRP 188

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIA 246
            D +LG  G    G  A  +GL  I  ++E + L RD+ + + TGG      IS  Q++ 
Sbjct: 189 MDPWLGKGGAAIGGEFAGRMGLPSISPMAERIMLERDVALLEATGGRLLVDQISSAQALE 248

Query: 247 LIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDID 306
            +  AK    +    +SIN+L  NE D+  Y +  K+ PPLR E +R +++EAL  G ID
Sbjct: 249 TLARAKGKGLRINASVSINHLSFNELDIGDYRTFAKLNPPLRGEDDRQALIEALASGLID 308

Query: 307 IIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQI 366
           I+VS H+P   + K LPF EA+ G++GLET+L A L L+H +++ L  LIRA++  PAQ+
Sbjct: 309 IVVSSHSPAPAEDKRLPFDEAAPGAVGLETLLPALLSLYHEERLPLLDLIRAVTLAPAQL 368

Query: 367 FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
             L GG L  G  AD+ L D++    V A  + S  KN+ FD     G+V+ T + G+ V
Sbjct: 369 LGLRGGRLAPGAPADLVLCDIDAPIIVDAARLLSKSKNSPFDGRRLQGQVLMTVVDGRVV 428

Query: 427 YTLES 431
           +  E 
Sbjct: 429 HRAEG 433


>gi|163732351|ref|ZP_02139797.1| dihydroorotase, multifunctional complex type [Roseobacter litoralis
           Och 149]
 gi|161394649|gb|EDQ18972.1| dihydroorotase, multifunctional complex type [Roseobacter litoralis
           Och 149]
          Length = 426

 Score =  237 bits (605), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 139/427 (32%), Positives = 226/427 (52%), Gaps = 5/427 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M    L N R++DP      +G + +ENG I    A+ L+          DC      PG
Sbjct: 2   MKPLNLVNARLVDPETGTISIGGLRIENGRI----AERLDKNARPDGETVDCNLKHLAPG 57

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           I+D  V +    + + ++  +  + A AGG+T+++  P   +  +D    +++       
Sbjct: 58  IVDIGVKVCEPGERHKESYRSAGRAAAAGGVTTMVTRP-DTTPAIDSPETLEFVTRRANQ 116

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            + +NV P A LT    G+E++E+  L + G V+F      + DT+VL  ++ YA  L A
Sbjct: 117 AAAVNVLPMAALTKGRAGREMTEIGFLMDAGAVAFTDCDRVVTDTKVLSRALSYARSLGA 176

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     D  L +  V   G  A+  GL  +  ++E + L RD+ + + TG  YHA  I+
Sbjct: 177 LVIAHPQDPGLSAGAVATSGKFASLRGLPAVSPMAERMALDRDIALVEMTGARYHADQIT 236

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++  ++ AK +    T G SI++L LN  DV  Y +  K+ PPLR ET+R+++ +A+
Sbjct: 237 CARALPALERAKQNGHDVTAGTSIHHLTLNALDVADYRTFFKLKPPLRDETDRLAVADAV 296

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID+I S HTP+  ++K LPF EA+ G++ LET+L AA+RL+H   I L  L RA+S
Sbjct: 297 RSGLIDVISSMHTPQDEESKRLPFEEAASGAVALETLLPAAMRLYHADLIDLPTLWRAMS 356

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+   L  G L  G  AD+ L D +  + +    + S  +NT FD     G+V+ TY
Sbjct: 357 LNPAKRLGLDSGRLAAGAPADLVLFDPDAPFLMDRTTLRSKSRNTPFDGSRMQGRVLATY 416

Query: 421 ISGKQVY 427
           ++G++VY
Sbjct: 417 VAGQRVY 423


>gi|207728130|ref|YP_002256524.1| dihydroorotase-like protein [Ralstonia solanacearum MolK2]
 gi|206591375|emb|CAQ56987.1| dihydroorotase-like protein [Ralstonia solanacearum MolK2]
          Length = 425

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 141/422 (33%), Positives = 218/422 (51%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  ID    + +  G ++  G     A F  +  I D TGLV  PG+ID  
Sbjct: 5   IKGGRLIDPANGIDAQQDLYIAAGKVVGIGRTP--ADFHANKTI-DATGLVVCPGLIDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A+AGG+TS++  P      LDE   ++      R  +  +
Sbjct: 62  ARLREPGYEYKATLESEMAAAMAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNLNQAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G  ++EM  L E G V F Q+   + DT VL+ +++YA      V L 
Sbjct: 121 VYPLGALTVGLKGLVLTEMAELTEAGCVGFSQADAPMTDTLVLMRALQYAQTFGFTVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D FLG  GV   G +A+ LGL G+P ++ETV L     + + TG   H   +S    +
Sbjct: 181 PEDPFLGKGGVAASGPLASRLGLAGVPVMAETVRLHTIFELMRSTGARVHLCRLSSVAGL 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L++ AKA     TC ++++++ L + D+  +NS  + +PPLR+  +R  +V AL  G I
Sbjct: 241 ELVRRAKAEGLPVTCDVNVHHISLTDVDIGYFNSQMRFVPPLRAGRDRDGIVRALVDGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I SDHTP   D KLLPFAEAS G+ GLET+L   LR     ++ L + +  +++ PA+
Sbjct: 301 DAICSDHTPVDDDEKLLPFAEASPGATGLETLLPLTLRWAAEHKVDLPRALARITSEPAR 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  L  G+L+ G  AD+ + D    W ++   + S  KN+ +      G+V  T ++G  
Sbjct: 361 VLGLQAGSLEVGALADVCVFDPEATWKIEPRSLRSQGKNSPYLGFELAGRVRATLVAGHL 420

Query: 426 VY 427
            Y
Sbjct: 421 AY 422


>gi|254459599|ref|ZP_05073015.1| dihydroorotase [Rhodobacterales bacterium HTCC2083]
 gi|206676188|gb|EDZ40675.1| dihydroorotase [Rhodobacteraceae bacterium HTCC2083]
          Length = 419

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 141/422 (33%), Positives = 225/422 (53%), Gaps = 10/422 (2%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
             N R+I+P    D++G + V +G I    ADA          + DC G    PGIID  
Sbjct: 5   FTNARLINPETGTDDIGDLGVVDGKIAEPTADAE---------VIDCAGKCLAPGIIDIG 55

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V +    + + ++  +    A AGG+T+++  P   +  +D    +++        + +N
Sbjct: 56  VKVCEPGERHKESYRSAGLAAAAGGVTTMVTRP-DTAPAIDSPEVLEFVRRRANEATPVN 114

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V   A LT   EG+E++E+  LQ+ G V+F      + DT+V   ++ YA  L A+V   
Sbjct: 115 VLVMAALTKGREGREMTEIGFLQDAGAVAFTDCDHVVSDTKVYSRALTYARSLGALVIAH 174

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             +  L     +  G  A+  GL  + +++E + L RD+ + + TG  YH   I+  +++
Sbjct: 175 VQEPNLSKGAAVTSGKFASLRGLPAVSAMAERMGLDRDIALIEMTGVRYHVDQITTARAL 234

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
             ++ AKA+    T G+SI++L LNE DV  Y +  KV PPLRSE++R++++ AL  G I
Sbjct: 235 PALERAKANGLDITAGVSIHHLTLNELDVADYRTFFKVKPPLRSESDRLAVINALANGTI 294

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D+I S HTP+  ++K LPF EA+ G++ +ET+L AA+RL H   + L  L RALS  PA+
Sbjct: 295 DLISSMHTPQDEESKRLPFEEAASGAVAMETLLPAAMRLIHNDYMDLPTLWRALSLAPAK 354

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
              L  G L  G  AD+ L D +  + +    + S  KNT FD     GKV  TY++G+ 
Sbjct: 355 RLGLDAGRLAVGAPADLVLFDPDAPFIMDRFKLQSKSKNTPFDGARMQGKVHATYVAGRP 414

Query: 426 VY 427
           V+
Sbjct: 415 VF 416


>gi|330719606|gb|EGG98180.1| Dihydroorotase [gamma proteobacterium IMCC2047]
          Length = 421

 Score =  236 bits (603), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 137/423 (32%), Positives = 219/423 (51%), Gaps = 11/423 (2%)

Query: 10  RIIDPSRDIDEVGAIIVENGIILAAGA-DALNAKFPTSALIHDCTGLVAVPGIIDARVTL 68
           R+IDP+ + D +  + + +G ++  G  D       TSA + D  GL+  PG +D  V+L
Sbjct: 9   RLIDPANNTDTITDLHIHDGKVVTIGPYDG------TSATVIDAKGLIVCPGFVDLSVSL 62

Query: 69  TGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYP 128
                +   +++  S+ A AGGITS+  +P   S  +D  +      +        NV+P
Sbjct: 63  R---KQQKASVSAESRAAAAGGITSMCCLP-DTSPVIDSSSAATLVQDLAHQAGFCNVWP 118

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  + G ++SEM  L+E G +          +T+VLL  ++YA   N +V  +  +
Sbjct: 119 IGALTQGLAGSQLSEMGTLKEAGCIGMSNLRQPFENTRVLLRCLEYAASYNVMVFFNPVE 178

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
           H L   G ++EG  A  LGL G+P  +ETV L RDLL+ + TG   H   ++  +S+ LI
Sbjct: 179 HSLADDGCVHEGPFATRLGLKGVPETAETVALTRDLLLVEQTGVRAHFGQLTCARSVDLI 238

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
            +A+      T  + I++L+  E DV+ +NSL  + PPLR++ +R ++   ++ G I  I
Sbjct: 239 ANAQKRGLPVTADVCIHHLLGTEADVQNFNSLNHIQPPLRTQRDREALQRGVQDGIISAI 298

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            S H P  M  K+ PFA    G   L+T+L  +L+L     ++L ++I  L+  PAQ  N
Sbjct: 299 CSHHHPHPMSAKMAPFAATEPGISTLDTLLPQSLKLVENNVLTLTQMIERLTCGPAQAAN 358

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYT 428
           L  G+L  G  ADI + D +  W V A+ ++S   NT        G+V  T ++G+QVY 
Sbjct: 359 LKSGSLAVGDIADICIFDADEDWLVSAETLNSSGHNTPLMGTELRGRVKHTLLAGRQVYP 418

Query: 429 LES 431
           L S
Sbjct: 419 LRS 421


>gi|300704907|ref|YP_003746510.1| dihydroorotase, carbamoylaspartic dehydrase [Ralstonia solanacearum
           CFBP2957]
 gi|299072571|emb|CBJ43921.1| Dihydroorotase, Carbamoylaspartic dehydrase [Ralstonia solanacearum
           CFBP2957]
          Length = 425

 Score =  236 bits (602), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 141/422 (33%), Positives = 217/422 (51%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  ID    + +  G ++  G     A F  +  I D  GLV  PG+ID  
Sbjct: 5   IKGGRLIDPANGIDAQQDLYIAAGKVVGIGRTP--ADFHANKTI-DAIGLVVCPGLIDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A+AGG+TS++  P      LDE   ++      R  +  +
Sbjct: 62  ARLREPGYEYKATLESEMAAAMAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNLNQAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G  ++EM  L E G V F Q+   + DT VL+ +++YA      V L 
Sbjct: 121 VYPLGALTVGLKGLVLTEMAELTEAGCVGFSQADAPMTDTLVLMRALQYAQTFGFTVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D FLG  GV   G +A+ LGL G+P ++ETV L     + + TG   H   +S    +
Sbjct: 181 PEDPFLGKGGVAASGPLASRLGLAGVPVMAETVRLHTIFELMRSTGARVHLCRLSSVAGL 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L++ AKA     TC ++++++ L + D+  +NS  + +PPLR+  +R  +V AL  G I
Sbjct: 241 ELVRRAKAEGLPVTCDVNVHHISLTDVDIGYFNSQMRFVPPLRAGRDRDGIVRALADGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I SDHTP   D KLLPFAEAS G+ GLET+L   LR     ++ L + +  +++ PA+
Sbjct: 301 DAICSDHTPVDDDEKLLPFAEASPGATGLETLLPLTLRWAAEHKVDLPRALARITSEPAR 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  L  G+L+ G  AD+ + D    W V+   + S  KN+ +      G+V  T ++G  
Sbjct: 361 VLGLQAGSLEVGALADVCVFDPEATWKVEPRSLRSQGKNSPYLGFELAGRVRATLVAGHL 420

Query: 426 VY 427
            Y
Sbjct: 421 AY 422


>gi|197104786|ref|YP_002130163.1| aspartate transcarbamoylase, pyrC' subunit [Phenylobacterium
           zucineum HLK1]
 gi|196478206|gb|ACG77734.1| aspartate transcarbamoylase, pyrC' subunit [Phenylobacterium
           zucineum HLK1]
          Length = 431

 Score =  236 bits (601), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 144/427 (33%), Positives = 230/427 (53%), Gaps = 11/427 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGII--LAAGAD--ALNAKFPTSALIHDCTGLVAVPGIID 63
           N R++DP+   D  GA+IV  G+I  +  G D  AL+        + D  G + +PG+ID
Sbjct: 10  NVRLLDPASGFDGPGAVIVTEGVIADVVPGGDLGALSKDIE----VIDGGGKLLIPGLID 65

Query: 64  ARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
            RV  TG P  E  + + +  + A AGG+T+I++ P   S  +DE + + + L   R   
Sbjct: 66  IRVK-TGEPGFETKETLKSAGRAAAAGGVTTIVVQP-DTSPVVDEPSVVDFILRRARDIE 123

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+NVYP    T    G+ ++E+ L+ E G +    +   I +++V    + YA   +  V
Sbjct: 124 LVNVYPAGAATKGAMGERMAEIGLMHEAGCLYVTDADRPIVNSKVFQRVLSYAKAFDTPV 183

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           A    D +L +      G  A  +GL  +P+I+E + L RDL +A+ TG       ++  
Sbjct: 184 AHRPADPWLSAGAAATSGEFAARMGLPNVPAIAEKIMLERDLALAEVTGAKLIVDQLTTA 243

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++   + A      AT   SIN+L  NE D+  Y +  K+ PPLRSE +R +++EA+  
Sbjct: 244 AALESFERAVKRGVNATATTSINHLSFNELDIGDYRTFCKLDPPLRSEDDRQAVIEAVAS 303

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G I +IVS H P   + K LP+ EA+ G++GLET+L A L   H  +I L  L+R +++ 
Sbjct: 304 GLIKVIVSAHAPAPAEDKRLPYDEAAPGAVGLETLLPALLAFHHEGRIPLIDLVRTVTSA 363

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA++  LPGG +  G  AD+ L+D +    + AD ++S  KN+ FD     GKV+RT + 
Sbjct: 364 PAELLGLPGGRIAKGAPADLVLVDPDAPVVIDADKLTSKSKNSPFDGRRLQGKVLRTVVD 423

Query: 423 GKQVYTL 429
           G+ VY++
Sbjct: 424 GRTVYSV 430


>gi|292490360|ref|YP_003525799.1| dihydroorotase [Nitrosococcus halophilus Nc4]
 gi|291578955|gb|ADE13412.1| dihydroorotase, multifunctional complex type [Nitrosococcus
           halophilus Nc4]
          Length = 429

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 142/430 (33%), Positives = 222/430 (51%), Gaps = 8/430 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAG--ADALNAKFPTSALIHDCTGLVAVPGI 61
            V+ N  +IDP  ++D V  + + +G ++A G   +   A+   +A      G +  PG+
Sbjct: 3   LVIKNGHLIDPYNEVDAVQDLYLADGRVVAIGNAPEGFRAEQEINA-----QGQIVCPGL 57

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           ID R  L     E    I T +  A  GGIT++   P  +S  +D               
Sbjct: 58  IDLRARLREPGQERKGTIATETLAAAKGGITTLCCPPDTIS-VVDTPAVADLIAHRAAQH 116

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
               + P   LT  ++G +++EM +L+E G V    + + I ++QV+  +M+YA  L   
Sbjct: 117 QRTRILPLGALTQGLKGLQLAEMAILREAGCVGVSNALVPIANSQVMRRAMEYAATLGIT 176

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V L   D +LG  G  +EGI++  LGL GIP  +ETV LARDLL+ + TG   H   +S 
Sbjct: 177 VFLHPRDPWLGIDGCCHEGIVSARLGLTGIPETAETVALARDLLLIEQTGVQAHFCHLSS 236

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
            +++ +++ A+A     T  ++  +L L E+D+  +NS   V+PPLRS  +R ++ E L 
Sbjct: 237 SRAVRMVREARAEGLPITADVTAYHLHLTEHDIGEFNSQCHVIPPLRSLRDRDALHEGLR 296

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G    I SDH P  +D KL PF     G  GLET+L  +LRL     ++L ++I  L+ 
Sbjct: 297 DGAFSAICSDHQPHEIDAKLGPFPITEPGISGLETLLPLSLRLTQDDILTLPEVIAYLTY 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           +PAQ+  + GG L  G  ADI + D +  W +K ++M S  KNT F    F G+V  T +
Sbjct: 357 QPAQVLGIEGGHLAPGQRADICIFDPHDHWVLKPEEMVSQGKNTPFGGWEFQGRVTHTLL 416

Query: 422 SGKQVYTLES 431
            G+ V+  E+
Sbjct: 417 EGQVVFATET 426


>gi|297537842|ref|YP_003673611.1| dihydroorotase, multifunctional complex type [Methylotenera sp.
           301]
 gi|297257189|gb|ADI29034.1| dihydroorotase, multifunctional complex type [Methylotenera sp.
           301]
          Length = 425

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 153/425 (36%), Positives = 227/425 (53%), Gaps = 4/425 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           + N  +IDP  +ID    + +  G I+A G       F  S  I D + L+  PG++D  
Sbjct: 5   IKNGHVIDPKNNIDSQLDVFIAAGKIVALGK--APEGFIASQTI-DASNLIVCPGLVDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L    DEY   + +  + AVAGG+TS+   P      LDE   ++      +  +L +
Sbjct: 62  ARLREPGDEYKATLISELQAAVAGGVTSLACPP-DTDPVLDEPGLVEMLKHRAKQLNLAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++GK +SEM  L+E G V F Q+ ++I DTQVL  +M+YA      + L 
Sbjct: 121 VYPLGALTRQLQGKVLSEMGELREAGCVGFSQANIAITDTQVLWRAMEYAATFGFTLFLH 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             + FL   GV ++G +A+ LGL GIPS +E + LA  L IA+ TG   H S +S  + +
Sbjct: 181 AEEPFLAKDGVAHDGEVASRLGLKGIPSAAEALALASILRIAKETGARIHISRLSTAEGV 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +I+ AK H    TC +S N+L L E+D+  +++   + PPLR++ ++ ++   L+ G I
Sbjct: 241 DMIREAKKHGVNITCDVSANHLHLTEHDIGFFDANCHLKPPLRTQRDKDALGAGLKDGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I SDHTP   D KL PFAEA  G+ GLE +L+  L+  + ++ SL K I  +S   A+
Sbjct: 301 DAICSDHTPVDDDAKLAPFAEAEVGATGLELLLALTLKWANQEKTSLAKAIALISQSSAK 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I  +  G L     ADI + D N  W +    + S  KNT F+     GKV  T I+G+ 
Sbjct: 361 ILGIAAGDLSVNANADICIFDANEYWKIVPSALKSQGKNTPFNGLEIAGKVKTTLINGQV 420

Query: 426 VYTLE 430
           VY  E
Sbjct: 421 VYQSE 425


>gi|317051288|ref|YP_004112404.1| dihydroorotase, multifunctional complex type [Desulfurispirillum
           indicum S5]
 gi|316946372|gb|ADU65848.1| dihydroorotase, multifunctional complex type [Desulfurispirillum
           indicum S5]
          Length = 425

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 143/428 (33%), Positives = 230/428 (53%), Gaps = 8/428 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVEN-GIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           ++ N  +++P+   DEV  I++   G I   G +  +      A I D +G    PG+ID
Sbjct: 3   IIRNGWLVNPATATDEVCDILINGEGRIQEVGKNLQH----EGADIIDASGRHVFPGLID 58

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V       E+ +++ T S  A  GG T++  M    +   D  T  +Y + + R    
Sbjct: 59  LHVHFRDPGQEWKEDVHTGSDAAAKGGFTTVCCMA-NTTPVNDSKTVTEYIVNKARAYGK 117

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
            NV P   +T  M+G+ IS M  + E G + F     ++++++V+  +++YA M  AI+A
Sbjct: 118 CNVLPFGTITGGMKGETISAMAEMIEAGAIGFSDDGRNVNNSEVMRIALEYASMFGAIMA 177

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             + D  +G  GV++EG  ++  GL GIP I+E++ +ARD+ +A++TG   H   +S  +
Sbjct: 178 SHSEDPHVGHGGVVHEGRYSSQTGLKGIPDITESLIVARDIELARYTGAPVHFCHVSAGR 237

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           SIALI+ AKA     T  ++ ++L LN++ +  +++  K+ PPLRSE +R + VE L  G
Sbjct: 238 SIALIRQAKAQGIPVTAEVTPHHLFLNDSAITTFDTNFKMNPPLRSEEDRQACVEGLLDG 297

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            +DII +DH P  +  K   F  A+FG IGLET L   LRL+  Q++SL  LI  L+ +P
Sbjct: 298 TLDIIATDHAPHAITDKEKDFDHAAFGVIGLETALPIVLRLYQQQKLSLSALIERLTWKP 357

Query: 364 AQIFNLPG--GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           AQI       G L  G  AD+ ++DL    T+  +  +S  KN+ F  +   G  V TY 
Sbjct: 358 AQILRRDHEIGDLSAGKWADLVIVDLERSTTISTEYFASKSKNSPFIGQTVKGLPVATYF 417

Query: 422 SGKQVYTL 429
            G  VY++
Sbjct: 418 RGNCVYSV 425


>gi|315500174|ref|YP_004088977.1| dihydroorotase, multifunctional complex type [Asticcacaulis
           excentricus CB 48]
 gi|315418186|gb|ADU14826.1| dihydroorotase, multifunctional complex type [Asticcacaulis
           excentricus CB 48]
          Length = 431

 Score =  234 bits (596), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 149/430 (34%), Positives = 239/430 (55%), Gaps = 11/430 (2%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALN-AKFPTSAL---IHDCTGLVAV 58
           +  L N R+IDP+ D D  G++I+  G+I    A+ L+ A  P+ +    + DC G V  
Sbjct: 6   AIALVNARLIDPASDYDGPGSLILTEGVI----AEVLHTAHLPSGSADMKVIDCDGKVVC 61

Query: 59  PGIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEE 117
           PG+ID RV  TG P  E  + + + S+ A AGG+TS+++ P      +DE   + + L  
Sbjct: 62  PGLIDLRVK-TGEPGAEPKETLKSASRAAAAGGVTSMVVQP-DTDPVIDEPAMVDFILRR 119

Query: 118 IRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHM 177
            R   L++VYP    T    GK+++E+ L+ E G V F      I +++VL   + YA+ 
Sbjct: 120 ARDIELVHVYPAGAATKGHNGKQMAEIGLMSESGAVYFTDVERPIINSKVLARVLSYANG 179

Query: 178 LNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS 237
            NA++A    + +L    V   G +A  +GL G+ +++E + L RDL + + TG      
Sbjct: 180 FNALIAHRPKEPWLSEGAVATSGEMAARMGLSGVSALAERIALERDLALVELTGARLLVD 239

Query: 238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMV 297
            I+   +I  I  AKA         SIN+L+ NE D+  Y +  ++ PPLR E +R+++V
Sbjct: 240 QITTAGAIKAIAQAKAKGLDVYASASINHLVFNEIDIGDYRTFYRLDPPLRCEDDRIALV 299

Query: 298 EALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIR 357
           EAL  G ID++VS+HTP   + K  PF+EA  G+IGL+T+L+A + L H ++I L  L+R
Sbjct: 300 EALADGLIDVVVSNHTPLPAEDKRRPFSEAEPGAIGLQTLLAALIGLHHDREIPLIDLLR 359

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            ++  PAQ+  L  G L  G  AD+ ++D++  + ++  D+ S  KN+ F+     GKV 
Sbjct: 360 TVTINPAQLIGLEAGRLSPGAPADLIVVDIDAPFALRESDILSKSKNSPFENRTLQGKVE 419

Query: 418 RTYISGKQVY 427
            T + G+ VY
Sbjct: 420 VTLVDGRIVY 429


>gi|294054285|ref|YP_003547943.1| dihydroorotase, multifunctional complex type [Coraliomargarita
           akajimensis DSM 45221]
 gi|293613618|gb|ADE53773.1| dihydroorotase, multifunctional complex type [Coraliomargarita
           akajimensis DSM 45221]
          Length = 431

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 130/423 (30%), Positives = 225/423 (53%), Gaps = 6/423 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP    DE+  +   +G+++    D L+ K   +A   +  G+V  PG++D  
Sbjct: 7   IRGGRVIDPVNQRDEITDLFAVDGVLV----DRLSDKQQAAAQKVEAQGMVVCPGLVDIH 62

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V        + ++I + S+ A AGG T+++ MP   S   D    I+  + ++  +SLI 
Sbjct: 63  VHFRDPGQTHKEDIKSGSEAAAAGGFTTVVCMP-NTSPVCDNAGTIQRMMNKVERESLIR 121

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           ++PT CLT  MEG+ ++    LQ  GIV+       + + +++  +++YAHM +  +   
Sbjct: 122 IHPTGCLTMGMEGERLAPTGQLQRAGIVAVTDDGKCVQNNEIMRRAVEYAHMFDLPIMDH 181

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D  L    V+NEG  +  LGL G P  +E + +AR++++A+ +G H H   +S   S+
Sbjct: 182 CQDAALTENAVMNEGEWSLKLGLHGWPKAAEDIIVARNIILARQSGAHIHMQHVSSAASV 241

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +++ AK      T   S +++   +  ++ Y++  K+ PPLR+  +R ++++ L  G +
Sbjct: 242 EMLRSAKKRGIPVTGEASPHHITFTDACLKDYDTNLKMNPPLRTAEDRAALIDGLCDGTL 301

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALSTRPA 364
           D I +DH P     K   F  A FG IGLE  L A+L  L+H  ++SL  +I  L+ + A
Sbjct: 302 DCIATDHAPHTPTEKDREFDYAPFGIIGLENSLGASLEALYHSGRMSLSAVIALLTHKGA 361

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           +I  L  GTL  G  ADI + D +  WTVK+ D  S  +N  +D +   G+V  T++ G+
Sbjct: 362 EICKLEAGTLDLGANADICIFDPDEAWTVKSADFYSKSRNCPWDGQQLRGRVKATFVGGQ 421

Query: 425 QVY 427
           QV+
Sbjct: 422 QVF 424


>gi|194290481|ref|YP_002006388.1| dihydroorotase [Cupriavidus taiwanensis LMG 19424]
 gi|193224316|emb|CAQ70327.1| DIHYDROOROTASE, Carbamoylaspartic dehydrase [Cupriavidus
           taiwanensis LMG 19424]
          Length = 427

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 144/422 (34%), Positives = 219/422 (51%), Gaps = 5/422 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+ + D    + +  G I+  G+    A F  + +I D  GL+  PG++D  
Sbjct: 5   IQGGRLIDPASNTDAAQDLYIAAGKIVGVGS--APADFTANKVI-DARGLIVCPGLVDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A AGG+TS++  P      LDE   ++      R  +  +
Sbjct: 62  ARLREPGYEYKATLESEVAAATAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARTLNQTH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G+ ++EM  L E G V F Q+   + +TQVLL +++YA      V L 
Sbjct: 121 VYPLGALTLGLKGETLTEMGQLTEAGCVGFSQAEAPVRNTQVLLRALQYAQTFGFTVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D FLG  GV   G +A+ LGL G+  I+ETV L     + + TG   H   +S    +
Sbjct: 181 PEDPFLGG-GVAASGAVASRLGLSGVSVIAETVRLHTIFELMRSTGARVHLCRLSSAAGL 239

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L++ AK    K TC ++I+++ L + D+  +NS  +  PPLRS  +R ++V AL  G I
Sbjct: 240 ELVRQAKREGLKVTCDVNIHHVSLTDMDIGYFNSQMRFSPPLRSPRDRDAIVAALADGTI 299

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D + SDHTP   D KLLPFAEAS G+ GLE +L   LR     ++ L + +  ++  PA+
Sbjct: 300 DALCSDHTPVDDDEKLLPFAEASPGATGLELLLPLTLRWASEHKVPLAQALARITAEPAR 359

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  L  GTL  G+AAD+ + D    W V+   + S  KN+ +      GKV  T + G+ 
Sbjct: 360 VIGLKAGTLAVGSAADVCVFDPKQVWKVERRSLKSQGKNSPWLGYEMEGKVRMTLVGGQV 419

Query: 426 VY 427
           VY
Sbjct: 420 VY 421


>gi|329122073|ref|ZP_08250681.1| dihydroorotase [Dialister micraerophilus DSM 19965]
 gi|327466880|gb|EGF12396.1| dihydroorotase [Dialister micraerophilus DSM 19965]
          Length = 431

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 128/425 (30%), Positives = 234/425 (55%), Gaps = 6/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
             ++ N  +++P++   E   ++VEN  I + G + ++      A I+D  G    PG+I
Sbjct: 4   KLLIKNGTLVNPAKGQHEKLDVLVENNRIKSIGKNLID----EDAKIYDVKGCFVTPGLI 59

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     E  ++I T ++ A AGG T +  M    S  +D    +K  L  I+  +
Sbjct: 60  DMHVHLREPGQEAKEDIYTGTQSAAAGGFTQVATMA-NTSPVIDNAALVKDLLYRIQESA 118

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            + V+    ++ N+EGK++SE+  + E G V+F      I ++  +  +M+Y +M   ++
Sbjct: 119 CVKVHVIGAVSKNLEGKQLSEIGDMVEAGAVAFSDDGSYIENSDFMRRAMEYVNMFGKMI 178

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  +   G +NEG ++  LG+ G PS++E + +ARD+L+++ TG H H + +S  
Sbjct: 179 IDHAEDKTMTEHGYMNEGKVSCELGITGRPSVAENIAVARDVLLSEMTGCHVHIAHLSSA 238

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S+ +I+ AKA     TC ++  +L   +  ++ + S  K+ PP+R++ +R +++EA+++
Sbjct: 239 KSVEIIRKAKAEGLPVTCEVTPQHLYFTDEYLKNFESSFKMAPPIRTDDDRKALIEAIKE 298

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALST 361
           G +D I++DH P   + K +PF  A  G  GLET L++ L  L+H  +I++ K++  +S 
Sbjct: 299 GIVDAIITDHAPHTSEEKDVPFKCAPNGIAGLETSLASVLTTLYHTGEITIDKVVEIMSV 358

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA++  + GG L+ G  ADI +ID +Y+WTV   D+ +    T ++     GK + T +
Sbjct: 359 NPAKLLEIEGGILEEGADADITVIDPDYKWTVTGKDLYTKAVFTPYEGIELQGKAILTIV 418

Query: 422 SGKQV 426
            GK V
Sbjct: 419 DGKVV 423


>gi|254488728|ref|ZP_05101933.1| dihydroorotase, multifunctional complex type [Roseobacter sp.
           GAI101]
 gi|214045597|gb|EEB86235.1| dihydroorotase, multifunctional complex type [Roseobacter sp.
           GAI101]
          Length = 425

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 140/420 (33%), Positives = 221/420 (52%), Gaps = 3/420 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N ++IDP       G + V+   I A   D   A  P  A I DC+G    PGI+D  V 
Sbjct: 6   NAKLIDPEARTVTQGTLRVDGDKIAAILPD--GAPIPGDATIVDCSGKYLAPGIVDLGVK 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           +    + + ++  +    A AGG+T+++  P      +D    +++        S ++V 
Sbjct: 64  VCEPGERHKESFRSAGLAAAAGGVTTMVTRP-DTEPAIDSPEVLEFVTRRANEASPVHVV 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P A LT    G+E++E+  L + G ++F      I DT+V   ++ YA  L A+V     
Sbjct: 123 PMAALTKGRAGREMTEISFLMDAGAIAFTDCDQVITDTKVFSRALTYARSLGALVIAHPQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           +  L        G  A+  GL  +  ++E + L RD+ + + TG  YHA  I+  +++  
Sbjct: 183 EPILSHGAAATSGKFASLRGLPAVSPMAERMGLDRDIALIEMTGARYHADQITTARALPA 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           +  AK +    T G+ I++L LN  DV  Y +  K+ PPLR E +R++++EA+  G IDI
Sbjct: 243 LARAKKNGLDITAGVGIHHLTLNALDVADYRTFFKLKPPLRDEDDRIAVIEAVASGLIDI 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S HTP+  ++K LPF EA+ G++GLET+L AALRL H + + +  L RALS  PA+  
Sbjct: 303 ICSMHTPQDEESKRLPFEEAASGAVGLETLLPAALRLVHSEMMDIATLWRALSFNPAKRL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LPGG L  G  AD+ L D    + +  + + S  +NT FD     GKV+ T++SG+ +Y
Sbjct: 363 GLPGGRLTPGAPADLVLFDDGAPFVMNRETLKSKSRNTPFDGMRMQGKVLETFVSGRSIY 422


>gi|89070216|ref|ZP_01157544.1| dihydroorotase, multifunctional complex type [Oceanicola granulosus
           HTCC2516]
 gi|89044232|gb|EAR50383.1| dihydroorotase, multifunctional complex type [Oceanicola granulosus
           HTCC2516]
          Length = 422

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 140/427 (32%), Positives = 229/427 (53%), Gaps = 6/427 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT  VL N R+IDP    +  G + + +G I A        + P  AL  DC G    PG
Sbjct: 1   MTDTVLANARLIDPEAGSERAGGLRIVDGRIAAL---IEGPEVPEGAL--DCRGACLAPG 55

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           I+D  V ++   + + ++  +  + A AGG+T+++  P   +  +D    +++       
Sbjct: 56  IVDLGVKVSEPGERHKESFASAGRAAAAGGVTTMVTRP-DTAPAIDTPETLEFVARRASA 114

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            S++ V P A LT    G+E++E+  L + G V+F      + DT+V   ++ YA  L+A
Sbjct: 115 DSVVRVLPMAALTKGRAGREMTEIGFLLDAGAVAFSDCDRVVADTKVYGRALAYARSLSA 174

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     +  L        G  A+  GL  +  ++E + L R++ +A+ TG   H   ++
Sbjct: 175 LVVAHAQEPRLSDGACATSGKFASLRGLPAVSPMAERMGLDREIGLAEMTGARLHIDQVT 234

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++  ++ AK +    T G+SI++L LNE DV  Y +  KV PPLR+E +R+++VEA+
Sbjct: 235 TARALPPLERAKRNGLDITAGVSIHHLTLNEFDVADYRTFFKVKPPLRAEDDRLAVVEAV 294

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G IDI+ S HTP+  ++K LPF EA+ G++ LET+L AA+RL H   ISL +L  A+S
Sbjct: 295 ASGLIDIVCSMHTPQDEESKRLPFEEAASGAVALETLLPAAMRLVHAGHISLPRLFAAMS 354

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             P++   L  G L  G  AD+ L D +  + +    + S  KNT FD     GKVV T+
Sbjct: 355 LNPSRRLGLETGRLAEGAPADLVLFDPDAPFLLDRFALKSKSKNTPFDGARMQGKVVGTW 414

Query: 421 ISGKQVY 427
           + G++V+
Sbjct: 415 VGGRRVH 421


>gi|53720299|ref|YP_109285.1| dihydroorotase [Burkholderia pseudomallei K96243]
 gi|53725977|ref|YP_103580.1| dihydroorotase [Burkholderia mallei ATCC 23344]
 gi|67643854|ref|ZP_00442597.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei GB8 horse 4]
 gi|76810147|ref|YP_334538.1| dihydroorotase [Burkholderia pseudomallei 1710b]
 gi|121601293|ref|YP_992260.1| dihydroorotase [Burkholderia mallei SAVP1]
 gi|124384504|ref|YP_001028702.1| dihydroorotase [Burkholderia mallei NCTC 10229]
 gi|126449866|ref|YP_001081392.1| dihydroorotase [Burkholderia mallei NCTC 10247]
 gi|126452005|ref|YP_001067382.1| dihydroorotase [Burkholderia pseudomallei 1106a]
 gi|167000839|ref|ZP_02266644.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei PRL-20]
 gi|167739857|ref|ZP_02412631.1| dihydroorotase [Burkholderia pseudomallei 14]
 gi|167817079|ref|ZP_02448759.1| dihydroorotase [Burkholderia pseudomallei 91]
 gi|167825489|ref|ZP_02456960.1| dihydroorotase [Burkholderia pseudomallei 9]
 gi|167846980|ref|ZP_02472488.1| dihydroorotase [Burkholderia pseudomallei B7210]
 gi|167895561|ref|ZP_02482963.1| dihydroorotase [Burkholderia pseudomallei 7894]
 gi|167903958|ref|ZP_02491163.1| dihydroorotase [Burkholderia pseudomallei NCTC 13177]
 gi|167912210|ref|ZP_02499301.1| dihydroorotase [Burkholderia pseudomallei 112]
 gi|217420965|ref|ZP_03452470.1| dihydroorotase [Burkholderia pseudomallei 576]
 gi|226193846|ref|ZP_03789448.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei Pakistan 9]
 gi|242315185|ref|ZP_04814201.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei 1106b]
 gi|254175664|ref|ZP_04882324.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei ATCC 10399]
 gi|254191756|ref|ZP_04898259.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254196072|ref|ZP_04902497.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei S13]
 gi|254202270|ref|ZP_04908633.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei FMH]
 gi|254207603|ref|ZP_04913953.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei JHU]
 gi|254261139|ref|ZP_04952193.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei 1710a]
 gi|254298976|ref|ZP_04966426.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei 406e]
 gi|254356495|ref|ZP_04972771.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei 2002721280]
 gi|52210713|emb|CAH36697.1| dihydroorotase-like protein [Burkholderia pseudomallei K96243]
 gi|52429400|gb|AAU49993.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei ATCC 23344]
 gi|76579600|gb|ABA49075.1| dihydroorotase-like protein [Burkholderia pseudomallei 1710b]
 gi|121230103|gb|ABM52621.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei SAVP1]
 gi|124292524|gb|ABN01793.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei NCTC 10229]
 gi|126225647|gb|ABN89187.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei 1106a]
 gi|126242736|gb|ABO05829.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei NCTC 10247]
 gi|147746517|gb|EDK53594.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei FMH]
 gi|147751497|gb|EDK58564.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei JHU]
 gi|148025492|gb|EDK83646.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei 2002721280]
 gi|157809143|gb|EDO86313.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei 406e]
 gi|157939427|gb|EDO95097.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160696708|gb|EDP86678.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei ATCC 10399]
 gi|169652816|gb|EDS85509.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei S13]
 gi|217396377|gb|EEC36394.1| dihydroorotase [Burkholderia pseudomallei 576]
 gi|225934151|gb|EEH30136.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei Pakistan 9]
 gi|238525301|gb|EEP88729.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei GB8 horse 4]
 gi|242138424|gb|EES24826.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei 1106b]
 gi|243063269|gb|EES45455.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia mallei PRL-20]
 gi|254219828|gb|EET09212.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei 1710a]
          Length = 425

 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 139/417 (33%), Positives = 215/417 (51%), Gaps = 4/417 (0%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+        + V  G + A GA    A F  +  I D TGL+  PG +D    L  
Sbjct: 10  LIDPAAGTQRQADVFVAAGKVAAIGA--APADFNAAKTI-DATGLIVAPGFVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    AVAGG+TS++  P      LDE   ++      R ++  +VYP  
Sbjct: 67  PGYEHKATLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNRNQAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+ + + DTQVLL +++YA      V L   D F
Sbjct: 126 ALTVGLKGQVITEMVELTEAGCIGFTQANVPVTDTQVLLRALQYASTYGYTVWLRPLDAF 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           L   GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL++ 
Sbjct: 186 LAKGGVAASGPVASRLGLSGVPVAAETIALHTLFELMRVTGARVHVARLSSAAGVALVRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     TC +  N+L L + D+  +++  ++ PPLR+E +R ++  AL  G ID I S
Sbjct: 246 AKAEGLPVTCDVGANHLHLIDVDIGYFDAQFRLDPPLRAERDREAIRAALADGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP 370
           DHTP   D KLLPFAEA+ G+ GLE +LS  ++      + L + + A+++ PA +  LP
Sbjct: 306 DHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWAREAGVPLARALAAITSAPADVLKLP 365

Query: 371 GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            G +  G  AD+ + D N  W V+   + S   NT F       +V  T ++G+  +
Sbjct: 366 AGRIGEGAPADLCVFDPNAHWRVEPRALKSQGHNTPFLGYELPARVCATLVAGQVAF 422


>gi|218461882|ref|ZP_03501973.1| dihydroorotase [Rhizobium etli Kim 5]
          Length = 200

 Score =  233 bits (593), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 113/200 (56%), Positives = 147/200 (73%)

Query: 230 TGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRS 289
           T G YHA++IS+PQS+  I+ A++   K T GISINNL LNEND+  Y +  K+ PPLR 
Sbjct: 1   TRGRYHAAMISVPQSVEAIELARSRGAKVTSGISINNLALNENDIGEYRTFFKLYPPLRP 60

Query: 290 ETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQ 349
           E +R++MV+AL +G IDIIVS H P+ +DTK LPF EA+ G++GLETML+AALRL HG Q
Sbjct: 61  EDDRVAMVDALARGAIDIIVSAHDPQDVDTKRLPFGEAADGAVGLETMLAAALRLHHGGQ 120

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
           +SL +LI A+STRPA+IF L  GTL+ G AADI LIDL+  W V  D + S  KNT F+ 
Sbjct: 121 VSLMRLIDAMSTRPAEIFGLDAGTLKPGAAADITLIDLDEPWLVAKDMLLSRSKNTPFED 180

Query: 410 EFFTGKVVRTYISGKQVYTL 429
             F+G+ V TY+SG+ V+TL
Sbjct: 181 ARFSGRAVATYVSGRLVHTL 200


>gi|313891698|ref|ZP_07825305.1| amidohydrolase family protein [Dialister microaerophilus UPII
           345-E]
 gi|313119976|gb|EFR43161.1| amidohydrolase family protein [Dialister microaerophilus UPII
           345-E]
          Length = 429

 Score =  233 bits (593), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 127/425 (29%), Positives = 235/425 (55%), Gaps = 6/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
             ++ N  +++P++   E   ++VEN  I + G + ++      A I+D  G    PG+I
Sbjct: 2   KLLIKNGTLVNPAKGQHEKLDVLVENNRIKSIGKNLID----EDAKIYDVKGCFVTPGLI 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     E  ++I T ++ A AGG T +  M    S  +D    +K  L  I+  +
Sbjct: 58  DMHVHLREPGQEAKEDIYTGTQSAAAGGFTQVATMA-NTSPVIDNAALVKDLLYRIQESA 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            + V+    ++ N+EGK++SE+  + + G V+F      I ++  +  +M+Y +M   ++
Sbjct: 117 CVKVHVIGAVSKNLEGKQLSEIGDMVQAGAVAFSDDGSYIENSDFMRRAMEYVNMFGKMI 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  +   G +NEG ++  LG+ G P+++E + +ARD+L+++ TG H H + +S  
Sbjct: 177 IDHAEDKTMTEHGYMNEGKVSCELGITGRPAVAENIAVARDVLLSEMTGCHVHIAHLSSA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S+ +I+ AKA     TC ++  +L   +  ++ + S  K+ PP+R++ +R +++EA+++
Sbjct: 237 KSVEIIRKAKAEGLPVTCEVTPQHLYFTDEYLKNFESSFKMAPPIRTDDDRKALIEAIKE 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALST 361
           G +D I++DH P   + K +PF  A  G  GLET L++ L  L+H  +I++ K++  +S 
Sbjct: 297 GIVDAIITDHAPHTSEEKDVPFKCAPNGIAGLETSLASVLTTLYHTGEITIDKVVEIMSV 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA++  + GG L+ G AADI +ID +Y+WTV   D+ +    T ++     GK + T +
Sbjct: 357 NPAKLLEIEGGILEEGAAADITVIDPDYKWTVTGKDLYTKAVFTPYEGIELRGKAILTIV 416

Query: 422 SGKQV 426
            GK V
Sbjct: 417 DGKVV 421


>gi|167920171|ref|ZP_02507262.1| dihydroorotase [Burkholderia pseudomallei BCC215]
          Length = 425

 Score =  232 bits (592), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 139/417 (33%), Positives = 215/417 (51%), Gaps = 4/417 (0%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+        + V  G + A GA    A F  +  I D TGL+  PG +D    L  
Sbjct: 10  LIDPAAGTQRQADVFVAAGKVAAIGA--APADFNAAKTI-DATGLIVAPGFVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    AVAGG+TS++  P      LDE   ++      R ++  +VYP  
Sbjct: 67  PGYEHKATLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNRNQAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+ + + DTQVLL +++YA      V L   D F
Sbjct: 126 ALTVGLKGQVITEMVELTEAGCIGFTQANVPVTDTQVLLRALQYASTYGYTVWLRPLDAF 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           L   GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL++ 
Sbjct: 186 LAKGGVAASGPVASRLGLSGVPVAAETIALHTLFELMRVTGARVHVARLSSAAGVALVRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     TC +  N+L L + D+  +++  ++ PPLR+E +R ++  AL  G ID I S
Sbjct: 246 AKAEGLPVTCDVGANHLHLIDVDIGYFDAQFRLDPPLRAERDREAIRAALADGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP 370
           DHTP   D KLLPFAEA+ G+ GLE +LS  ++      + L + + A+++ PA +  LP
Sbjct: 306 DHTPVDDDEKLLPFAEATPGATGLELLLSLIVKWAREAGVPLARALAAITSAPADVLKLP 365

Query: 371 GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            G +  G  AD+ + D N  W V+   + S   NT F       +V  T ++G+  +
Sbjct: 366 AGRIGEGAPADLCVFDPNAHWRVEPRALKSQGHNTPFLGYELPARVCATLVAGQVAF 422


>gi|114327471|ref|YP_744628.1| dihydroorotase [Granulibacter bethesdensis CGDNIH1]
 gi|114315645|gb|ABI61705.1| dihydroorotase [Granulibacter bethesdensis CGDNIH1]
          Length = 429

 Score =  232 bits (592), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 140/426 (32%), Positives = 222/426 (52%), Gaps = 4/426 (0%)

Query: 2   TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGI 61
           +  +L + R++DP   +D+ G+++V +G I   G    +   P      D  G V  PG+
Sbjct: 7   SDLLLTHVRLLDPQSGLDQPGSLLVRDGRIADFGP---SLGRPDGVEEIDGDGCVLCPGL 63

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           +D RV L     EY + I + ++ A AGGIT+II +P    S +D+   +          
Sbjct: 64  VDIRVGLGEPGHEYRETIASTAQAAAAGGITTIITLPDTRPS-IDDPALVHLLRSRGEET 122

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
             +++ P   +T    G+E++E+ LL E G V+F     +I   +++  ++ YA    A 
Sbjct: 123 GSLSILPYGAVTRGCRGEELAELGLLHEAGAVAFTDGTSAIASARMMRLALSYARGFGAK 182

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           +     D  L + G   EG +A  LGL GI   +E + +ARD+ +A  TGG  H   +S 
Sbjct: 183 IVQHPEDPSLAAGGAATEGELATRLGLPGISPAAEAIMIARDIRLAALTGGSVHFGHVST 242

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
            ++++LI+ AK      TC  +     LNE  +  + S  K+ PPLR+E +R+++   L+
Sbjct: 243 AEAVSLIRRAKNEGINVTCDTAPPYFDLNETAIGEWRSYAKLSPPLRAEQDRLAIAAGLK 302

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID I SDH PR  D K +PFA+AS G +GL T+L   L   HG  + L + I  L++
Sbjct: 303 DGTIDAIASDHQPRDADDKRVPFAQASPGGVGLVTLLGITLAQVHGNGLPLSQAIAMLTS 362

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           RPA +F L  GTL+ G  AD+ L      W V+A  M    +NT FD     G+V+ T+ 
Sbjct: 363 RPAGLFGLEAGTLRQGAPADLCLFHPERAWQVEAGKMPGKAQNTPFDGRPLEGRVIGTWK 422

Query: 422 SGKQVY 427
           +G++V+
Sbjct: 423 AGRRVF 428


>gi|88608169|ref|YP_506052.1| dihydroorotase, multifunctional complex type [Neorickettsia
           sennetsu str. Miyayama]
 gi|88600338|gb|ABD45806.1| dihydroorotase, multifunctional complex type [Neorickettsia
           sennetsu str. Miyayama]
          Length = 438

 Score =  232 bits (592), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 134/421 (31%), Positives = 228/421 (54%), Gaps = 4/421 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADAL-NAKFPTSALIHDCTGLVAVPGIIDARV 66
           + RI+DP   ++ +G ++V    I   G   L + +  +   + +C G + +PGIID  V
Sbjct: 18  DARIVDPESGLEILGDLVVHGRRIGDFGESLLSDVELKSFDEVVNCDGHILMPGIIDIHV 77

Query: 67  TLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
            L       +++I + +K A AGG+T+++  P      +D    + Y  ++ +    +NV
Sbjct: 78  HLRDPGQLQNEDIHSGTKSAAAGGVTTVVCQP-NTDPPIDTVETLAYIRDKAKRVGFVNV 136

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
              A +T    G ++++M  L + G V F    + + ++  +  +   A +L   VA   
Sbjct: 137 LCYASITG--RGGDLTDMFALHKAGAVGFTDDGLPVMNSLFMRQAFMNAALLKVPVAQHA 194

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIA 246
            D  L + G INEG I++ L + GI  ++E+V +ARD+L+ +  G HYH   +S  +++ 
Sbjct: 195 EDLDLSNGGCINEGAISHKLNVPGISHLAESVMVARDVLLLEQLGAHYHVLHVSTKKTVE 254

Query: 247 LIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDID 306
           +++ AK    + TC ++ ++L+L E  V+ YN+  K+ PPLR+E +R+ M+EAL+ G ID
Sbjct: 255 IVRAAKDKGMRVTCEVTPHHLLLTEEAVDGYNTAAKMNPPLRTEEDRLCMIEALKDGTID 314

Query: 307 IIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQI 366
            I SDH P +   K LP  EA+FG +GLET+L  +L L+H   + L  L+  L+  PA+I
Sbjct: 315 AIASDHAPHNEVYKELPLKEAAFGVVGLETILPLSLELYHSGALELHSLLAKLTCNPAKI 374

Query: 367 FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
                G ++ G  AD+ L+DLN +  ++     S  KN+ F      GKV+RT + G  V
Sbjct: 375 IGSEAGRIKVGAPADLVLLDLNSEVRIETRQFVSKSKNSPFGGRKTRGKVLRTIVGGDTV 434

Query: 427 Y 427
           Y
Sbjct: 435 Y 435


>gi|254445043|ref|ZP_05058519.1| Amidohydrolase family, putative [Verrucomicrobiae bacterium DG1235]
 gi|198259351|gb|EDY83659.1| Amidohydrolase family, putative [Verrucomicrobiae bacterium DG1235]
          Length = 439

 Score =  232 bits (592), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 143/423 (33%), Positives = 226/423 (53%), Gaps = 6/423 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           + N RIIDP  + DE+G + + +G I    A   + +   +A   D +GLV  PG++D  
Sbjct: 14  IKNGRIIDPKSNRDEIGDLYLVDGKI----ASKPSHEILDTATTVDASGLVVAPGLVDLH 69

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V       ++ + I + +  A AGG TS++ MP   S  +D    ++   +    + L+N
Sbjct: 70  VHFRVPGQKHKETIRSGTSAAAAGGFTSVVCMP-NTSPAVDNAGTVQLIKDIAAREGLVN 128

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           ++PT  +T   +G+ ++    L   GIV+       + DT ++  +++YAHM    V   
Sbjct: 129 IFPTGAITVGRKGEALAPTGSLSRTGIVAITDGGKCVQDTGLMRRAVEYAHMFGIPVIDH 188

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D+ L   GV+NEG ++  LGL G+   +E   +ARD++++ HT  H H   IS   +I
Sbjct: 189 CQDYSLSGDGVMNEGFVSTKLGLRGLHKAAEDTIVARDVILSTHTKAHIHLQHISSKTAI 248

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +I+ AKA     T   + +++ L + +VE +N+  K+ PPLR E +R+++++AL  G I
Sbjct: 249 DIIRRAKARGINITAEATPHHIALTDAEVESFNTNFKMNPPLREEEDRIALLDALGDGTI 308

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRPA 364
           D I + H P     K + F  A FG IGLET LS AL +L+H Q++SL   +  L++RPA
Sbjct: 309 DCIATGHAPHTDYEKDVEFDYAPFGVIGLETALSVALGQLYHTQRLSLSGTLSLLTSRPA 368

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            I NL  GTL  G  AD+ L D N  WT       S   N+ +      GKV  TY++G+
Sbjct: 369 DILNLDKGTLSEGADADLILFDPNEAWTPTEKGFHSKSANSPWIGRQLKGKVKSTYVAGR 428

Query: 425 QVY 427
           QVY
Sbjct: 429 QVY 431


>gi|312897593|ref|ZP_07757010.1| putative dihydroorotase [Megasphaera micronuciformis F0359]
 gi|310621226|gb|EFQ04769.1| putative dihydroorotase [Megasphaera micronuciformis F0359]
          Length = 429

 Score =  232 bits (592), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 222/425 (52%), Gaps = 6/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + V+ N R+I+P+   D++  I ++   I A G D         A I D TGLV  PG+I
Sbjct: 4   ALVVKNGRLINPATGEDKICDIRIDGTKITAIGPDV----DIQDADILDATGLVVTPGLI 59

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L        + I + +K A AGG T +  MP      +D    +     +I  + 
Sbjct: 60  DMHVHLRQPGQSAKETIESGTKAAAAGGFTRVATMP-NTKPVIDSAIIVDGLKYKIAAEG 118

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++ V     L+  +EGKE+S M  + + G+V+F      + +   +  +M+YA M   IV
Sbjct: 119 VVKVDIIGSLSKGLEGKELSSMGGMAKAGVVAFSDDGRYVQNCDFMRKAMEYAGMFGKIV 178

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G ++EG++++ LGL G P+++E + +ARD+L+A+ TG   H + IS  
Sbjct: 179 IDHCEDADLIEGGHMHEGVVSHELGLKGRPAVAEDIAVARDILLAEATGTAVHIAHISTK 238

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++ +++ AKA   K T   +  ++IL +  +  Y+   KV PPLRSE  R ++VE L  
Sbjct: 239 NAVQMVRQAKAKGLKVTAEATPQHMILTDEALRSYDPRFKVNPPLRSEEHRKAVVEGLVD 298

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALST 361
           G ID IV+DH P  ++ K   F+ A  G +GLET L   L  L+H   + L  LIR +++
Sbjct: 299 GTIDAIVTDHAPHTIEEKDCEFSLAPSGFVGLETSLGTVLTYLYHTGTVDLMTLIRTMTS 358

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA +  +  G +  G  AD+ ++DLN +WTV +D   S  K+T F+     GK V T +
Sbjct: 359 SPAALLGVDAGNVTVGKTADLTIMDLNKEWTVDSDKFYSKGKSTPFEDMILKGKAVATIV 418

Query: 422 SGKQV 426
            GK V
Sbjct: 419 DGKIV 423


>gi|189485750|ref|YP_001956691.1| dihydroorotase [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
 gi|238058377|sp|B1GYY7|PYRC_UNCTG RecName: Full=Dihydroorotase; Short=DHOase
 gi|170287709|dbj|BAG14230.1| dihydroorotase [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
          Length = 422

 Score =  232 bits (591), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 146/427 (34%), Positives = 230/427 (53%), Gaps = 12/427 (2%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSA-LIHDCTGLVAVPGIIDA 64
           + + +IIDP ++ D +G I VENG I++        KF   A  + D  G +AVPG+ID 
Sbjct: 5   IKDIKIIDPLQNRDLIGDIFVENGRIVS--------KFLGDADKVVDGRGKIAVPGLIDI 56

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
              L    +E  + I T ++ A  GGIT++  MP      +D    +++ L + + + L+
Sbjct: 57  HSHLREPGEERKETIYTGTRSAAKGGITTVFCMP-NTKPVIDNAPTVEFVLLKAQKEGLV 115

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           NV P  C T    G EISE+ +L++ GIV+     + I ++Q++  +++Y  M    V  
Sbjct: 116 NVLPIGCATKGSHGVEISEIGVLKKAGIVAVSDDGLPIANSQIMRRTLEYTKMFKLPVIS 175

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D  L   GV+NEG  +  LGL GIP  +E V ++RD+++A+ T G+ H + +S   S
Sbjct: 176 HGEDKELSKNGVMNEGKNSMILGLRGIPKQAEEVIISRDIMLAELTEGYLHIAHVSTAGS 235

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + LI+ AK  + K T     +   L ++ V+ YN+  K+ PPLR + +  ++ + L  G 
Sbjct: 236 VELIRQAKKKSIKVTAETCPHYFTLTDDIVKGYNTNTKMNPPLRRQEDVDAIKQGLADGT 295

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRP 363
           ID I +DH P   + K   F  A FG IG ET+LS  L  L     +SL K +  +++ P
Sbjct: 296 IDCIATDHAPHMEEEKNREFDLAPFGIIGFETILSLILNELVDSGVLSLSKALSKMTSNP 355

Query: 364 AQIFNLPG-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           A+IFNL G GTL+ G  ADI +ID+ Y +  K +++ S  KN+ F    F G  V T + 
Sbjct: 356 AKIFNLEGRGTLKEGNIADITIIDMKYSYEFKKENIVSKSKNSPFIGRKFKGGAVMTIVG 415

Query: 423 GKQVYTL 429
           G  V+ +
Sbjct: 416 GNIVWQV 422


>gi|167645481|ref|YP_001683144.1| dihydroorotase, multifunctional complex type [Caulobacter sp. K31]
 gi|167347911|gb|ABZ70646.1| dihydroorotase, multifunctional complex type [Caulobacter sp. K31]
          Length = 434

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 141/429 (32%), Positives = 220/429 (51%), Gaps = 3/429 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
             L N R++DP    D  G +IV  G+I          K      + DC G +  PG+ID
Sbjct: 8   LALINARLVDPESGYDGPGGVIVSEGVISDVAKGREFGKLSKDVRVIDCGGAMLAPGLID 67

Query: 64  ARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
            RV  TG P  E  + + + +K A AGG+TS ++ P      +D+ + + + L   R   
Sbjct: 68  LRVK-TGEPGAETKETLASAAKAAAAGGVTSFVVQP-DTDPAVDDPSVVDFILRRSRDID 125

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              +      T  + G++++E+ L++E G V    +   I D++V+   + YA   + ++
Sbjct: 126 AARILCAGAATKGLRGEQMAEIGLMREAGCVYVTDADKPIVDSKVMSRILTYARGFDTLL 185

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           A    D +L   G    G  A  +GL  I  ++E + L RD+ + + TGG      I+  
Sbjct: 186 AHRPLDPWLAKGGAAIGGEFAGRMGLPSISPMAERIMLERDVALLEATGGRLLVDQITSA 245

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           Q++  +  AKA   +    +SIN+L  NE D+  Y S  KV PPLR E +R +++EAL  
Sbjct: 246 QALETLARAKAKGLRIHASVSINHLSFNELDIGDYRSFAKVTPPLRGEDDRQALIEALAS 305

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G IDI+VS H P   + K LP+ EA+ G++GLET+L A L LFH +++ L  LIRA++  
Sbjct: 306 GLIDIVVSAHAPAPAEDKRLPYDEAAPGAVGLETLLPALLTLFHEERLPLVDLIRAVTLA 365

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA +  L  G L  G  AD+ L DL+    + A  + S  KN+ FD     G+V+ T + 
Sbjct: 366 PAALIGLQSGRLAPGAPADLVLCDLDAPLIIDAGKLLSKSKNSPFDGRRLQGQVLMTIVD 425

Query: 423 GKQVYTLES 431
           G+ V+  E 
Sbjct: 426 GRVVHRAEG 434


>gi|258592880|emb|CBE69189.1| dihydroorotase (DHOase) [NC10 bacterium 'Dutch sediment']
          Length = 446

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 143/443 (32%), Positives = 228/443 (51%), Gaps = 20/443 (4%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIIL--------------AAGADALNAKFPTSAL- 48
            ++   R+ID +  +D++  + +E+G I+              + G     AK   SAL 
Sbjct: 3   ILIRGGRVIDSASGVDDLLDLFIEDGKIIQIEKGVGNTEPLEASKGKGTKAAKHAESALA 62

Query: 49  ---IHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFL 105
              + D TGLV  PG+ID    L     E  + I + +  A  GG T+I  MP       
Sbjct: 63  VDRVMDATGLVVCPGLIDMHAHLRQPGREDKETIASGTMAAARGGFTTICCMP-NTDPVN 121

Query: 106 DEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDT 165
           D  T  ++ L+  + +  + V P   +T  ++G+E++E+  L E G V+       + + 
Sbjct: 122 DTRTVTEFILDTAKREGAVQVCPVGAITKGLKGEELAEIGELFEAGCVAISDDGRPVMNA 181

Query: 166 QVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLL 225
           +++  +M+YA M +  V   + D  L  RGV++EG+++  LGL GIPS SE V +ARDLL
Sbjct: 182 ELMRRAMEYAAMFDLPVIQHSEDLHLSGRGVVHEGLVSTELGLRGIPSASEAVMVARDLL 241

Query: 226 IAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLP 285
           +A+  G H H + +S  +S+ LI+ AKA   + +C ++ +++ L E  V  + +  K+ P
Sbjct: 242 LAELIGAHLHVAHVSAAESVRLIRDAKARGVRVSCEVTPHHVALTEEAVRGFLTNAKMNP 301

Query: 286 PLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RL 344
           PLRSE +R +++E L  G ID+I +DH P  +  K   F  A  G IGLET L+  L  L
Sbjct: 302 PLRSEADRQALLEGLRDGTIDVIATDHAPHTVQEKEREFDLAPNGVIGLETALAMTLTTL 361

Query: 345 FHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKN 404
                +SL + I  L++ PA+I  L  G +  G  AD+ + D N  WTV     +S  +N
Sbjct: 362 VAPGVLSLPQAIAKLTSEPARILKLRKGRIAKGADADLTIFDSNRDWTVDPATFASKSRN 421

Query: 405 TVFDKEFFTGKVVRTYISGKQVY 427
           T F     TG  V T + G+ V+
Sbjct: 422 TPFAGWRLTGAPVMTLVGGQVVW 444


>gi|134280157|ref|ZP_01766868.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei 305]
 gi|237813512|ref|YP_002897963.1| dihydroorotase (DHOase) [Burkholderia pseudomallei MSHR346]
 gi|254180911|ref|ZP_04887509.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei 1655]
 gi|134248164|gb|EBA48247.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei 305]
 gi|184211450|gb|EDU08493.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei 1655]
 gi|237503703|gb|ACQ96021.1| dihydroorotase (DHOase) [Burkholderia pseudomallei MSHR346]
          Length = 425

 Score =  231 bits (590), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 139/417 (33%), Positives = 214/417 (51%), Gaps = 4/417 (0%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP         + V  G + A GA    A F  +  I D TGL+  PG +D    L  
Sbjct: 10  LIDPVAGTQRQADVFVAAGKVAAIGA--APADFNAAKTI-DATGLIVAPGFVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    AVAGG+TS++  P      LDE   ++      R ++  +VYP  
Sbjct: 67  PGYEHKATLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNRNQAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+ + + DTQVLL +++YA      V L   D F
Sbjct: 126 ALTVGLKGQVITEMVELTEAGCIGFTQANVPVTDTQVLLRALQYASTYGYTVWLRPLDAF 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           L   GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL++ 
Sbjct: 186 LAKGGVAASGPVASRLGLSGVPVAAETIALHTLFELMRVTGARVHVARLSSAAGVALVRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     TC +  N+L L + D+  +++  ++ PPLR+E +R ++  AL  G ID I S
Sbjct: 246 AKAEGLPVTCDVGANHLHLIDVDIGYFDAQFRLDPPLRAERDREAIRAALADGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP 370
           DHTP   D KLLPFAEA+ G+ GLE +LS  ++      + L + + A+++ PA +  LP
Sbjct: 306 DHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWAREAGVPLARALAAITSAPADVLKLP 365

Query: 371 GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            G +  G  AD+ + D N  W V+   + S   NT F       +V  T ++G+  +
Sbjct: 366 AGRIGEGAPADLCVFDPNAHWRVEPRALKSQGHNTPFLGYELPARVCATLVAGQVAF 422


>gi|254995207|ref|ZP_05277397.1| dihydroorotase [Anaplasma marginale str. Mississippi]
          Length = 452

 Score =  231 bits (590), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 138/423 (32%), Positives = 218/423 (51%), Gaps = 8/423 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAK-FPTSA-LIHDCTGLVAVPGIIDAR 65
           N R+IDP  + D  G ++     I   G     A  F +SA  + DC G V +PGI+D  
Sbjct: 32  NARVIDPGSNTDAPGYVVTRGREISHFGFGEHKADDFQSSANEVIDCGGRVLMPGIVDIH 91

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L     E+ + I T S+ A AGG+T+++  P   S  +D     KY        S +N
Sbjct: 92  VHLREPGGEHKETIDTGSRSAAAGGVTTVVCQP-NTSPHIDSVMVAKYLKMRALESSCVN 150

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           +     +T       + +MR L+E G + F      + +   +  + + A  L  +VA  
Sbjct: 151 IEFYGSITKPC--GSLCDMRALKEAGALGFTDDGSPVMNALSMKRAFECASTLGVVVAQH 208

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDL-LIAQHTGGHYHASVISIPQS 244
             D  L   G INEG ++  LGL GI  +SE++ + RD+ L+ +  G  YH   +S  ++
Sbjct: 209 AEDCHLSDGGCINEGKVSQELGLKGISDLSESIMVGRDIELLREVPGARYHVLHVSTKKA 268

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           I LI+ AK      TC ++ ++  L E+ V  + ++ K+   LR+E +R+ MVE L  G 
Sbjct: 269 IDLIRSAKNEGLPVTCEVTPHHFALTEDAVREHGTMAKM--KLRTEEDRLCMVEGLVDGT 326

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I +DH P     K LP +  +FG +GLETML  +L L+H  ++ L +++  L+ +P+
Sbjct: 327 IDCIATDHAPHSCQDKALPISSCAFGVVGLETMLPLSLELYHSGKMGLLEVLSKLTDKPS 386

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            I  +P G +  G  AD+ L+DL+++WTV     +S  KN+ F      GK +RT ++GK
Sbjct: 387 DIVKIPRGRIAKGLVADLVLVDLDHEWTVDTTKFASKSKNSPFHGRTVKGKALRTVVAGK 446

Query: 425 QVY 427
            VY
Sbjct: 447 TVY 449


>gi|126439283|ref|YP_001060120.1| dihydroorotase [Burkholderia pseudomallei 668]
 gi|126218776|gb|ABN82282.1| dihydroorotase, multifunctional complex type [Burkholderia
           pseudomallei 668]
          Length = 425

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 139/417 (33%), Positives = 214/417 (51%), Gaps = 4/417 (0%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+        + V  G + A GA    A F  +  I D TGL+  PG +D    L  
Sbjct: 10  LIDPAAGTQRQADVFVAAGKVAAIGA--APADFNAAKTI-DATGLIVAPGFVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    AVAGG+TS++  P      LDE   ++      R ++  +VYP  
Sbjct: 67  PGYEHKATLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNRNQAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+ + + DTQVLL +++YA      V L   D F
Sbjct: 126 ALTVGLKGQVITEMVELTEAGCIGFTQANVPVTDTQVLLRALQYASTYGYTVWLRPLDAF 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           L   GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL++ 
Sbjct: 186 LAKGGVAASGPVASRLGLSGVPVAAETIALHTLFELMRVTGARVHVARLSSAAGVALVRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     TC +  N+L L + D+  +++  ++ PPLR+E +R ++  AL  G ID I S
Sbjct: 246 AKAEGLPVTCDVGANHLHLIDVDIGYFDAQFRLDPPLRAERDREAIRAALADGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP 370
           DHTP   D KLLPFAEA+ G+ GLE +LS  ++        L + + A+++ PA +  LP
Sbjct: 306 DHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWAREAGAPLARALAAITSAPADVLKLP 365

Query: 371 GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            G +  G  AD+ + D N  W V+   + S   NT F       +V  T ++G+  +
Sbjct: 366 AGRIGEGAPADLCVFDPNAHWRVEPRALKSQGHNTPFLGYELPARVCATLVAGQVAF 422


>gi|218961597|ref|YP_001741372.1| dihydroorotase (DHOase) [Candidatus Cloacamonas acidaminovorans]
 gi|167730254|emb|CAO81166.1| dihydroorotase (DHOase) [Candidatus Cloacamonas acidaminovorans]
          Length = 432

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 143/411 (34%), Positives = 217/411 (52%), Gaps = 8/411 (1%)

Query: 22  GAIIVENGIILAAGADALNAKFPTSAL--IHDCTGLVAVPGIIDARVTLTGSPDEYSKNI 79
           G I++E   I+       ++ + T  +  I D  G    PG ID    L      Y ++I
Sbjct: 19  GEILIERKKIVKISGGTASSSYLTDKVDKIIDAKGACVFPGFIDLHSHLRDPGQTYKEDI 78

Query: 80  TTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYPTACLTSNME 137
            T +K A  GG T++  MP       D    ++Y   ++R K      VY    +T    
Sbjct: 79  VTGTKAAAHGGFTAVCAMP-NTEPVTDNIASVEYI--QLRAKDYGSAKVYVIGAITKQSA 135

Query: 138 GKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVI 197
           G+EI+EM  ++  GIV+       + + +++L+ MKYA      V +   D+ L  +G I
Sbjct: 136 GEEIAEMATMKAGGIVAVSDDGKCVQNARLMLSCMKYASNFGLPVIIHPEDYSLAGKGQI 195

Query: 198 NEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTK 257
           + G +A  LGL GIP ++E V +ARD+++A+  G   H + IS  +SI L+K+AK     
Sbjct: 196 HSGKVATKLGLSGIPGLAEEVIIARDIMLAESAGAKLHIAHISTARSIELVKNAKDKGLP 255

Query: 258 ATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHM 317
            TC ++ ++L+LNE     +N+  K+ PPLRSE +R + V+AL++G ID I +DH+P   
Sbjct: 256 VTCEVTPHHLVLNEEANLTFNTNTKMKPPLRSEEDRRACVQALQEGIIDCIATDHSPHAD 315

Query: 318 DTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALSTRPAQIFNLPGGTLQT 376
             K   F  A FG IGLET      + L    QI L +LI AL+T PA+I NLPGG L  
Sbjct: 316 FEKEREFDLAPFGIIGLETAFPVLYKNLVQTGQIDLNRLIEALTTAPAKILNLPGGILAE 375

Query: 377 GTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           G  AD+ +IDL  +    A+++ S  KNT +  ++F G+V+ T   GK  Y
Sbjct: 376 GKTADLTVIDLEKETLFSAENILSKSKNTPWLNQWFPGRVMCTICDGKITY 426


>gi|291279237|ref|YP_003496072.1| dihydroorotase [Deferribacter desulfuricans SSM1]
 gi|290753939|dbj|BAI80316.1| dihydroorotase [Deferribacter desulfuricans SSM1]
          Length = 424

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 128/387 (33%), Positives = 215/387 (55%), Gaps = 2/387 (0%)

Query: 46  SALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFL 105
            A + DC+ L+AVPG+ID  V       EY ++I + SK AVAGG+T+ + M        
Sbjct: 39  DAEVIDCSNLIAVPGLIDMHVHFRDPGLEYKEDIESGSKAAVAGGVTTCLPMA-NTKPVN 97

Query: 106 DEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDT 165
           D  +  +Y +++ +   LI+++P A +T  M+G+E++EM  + E G ++F    + + ++
Sbjct: 98  DNSSITRYMVDKAKEVGLIDLFPVAAITKGMKGEELTEMGDILEAGAIAFSDDGLPVMNS 157

Query: 166 QVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLL 225
           +V+  +++YA    + +     D  L  +GVINEG I+   GL GIP  +E + +ARD+L
Sbjct: 158 EVMRRALEYASQFGSFIISHPEDKNLAGKGVINEGKISTLTGLKGIPDEAEEIMIARDIL 217

Query: 226 IAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLP 285
           +A+ T  H H + +S    + LIK AK+     T   + ++  L E+ +  Y++  K+ P
Sbjct: 218 LAKLTKAHMHLAHVSTKGGVELIKWAKSLGINVTAEAAPHHFSLTEDYLTDYDTNYKMNP 277

Query: 286 PLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF 345
           PLR+E ++ +++EAL+ G ID+I +DH P H D K + F  A+FG  GL+T++   L+L 
Sbjct: 278 PLRTEEDKEAIIEALKDGTIDVIATDHAPHHKDEKFVEFDNAAFGITGLQTLIPLTLKLV 337

Query: 346 HGQQISLKKLIRALSTRPAQIFNLPG-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKN 404
              +I +KK +   S +PAQI  L   G +     ADI LID+N ++        S   N
Sbjct: 338 EDGKIDMKKFVELTSYKPAQILKLNDRGYIAKRKKADITLIDINKEYIFDEKINKSKSTN 397

Query: 405 TVFDKEFFTGKVVRTYISGKQVYTLES 431
           + F  +   G  + T  +GK VY  ++
Sbjct: 398 SPFFGKKLKGATIYTIKNGKIVYKFQN 424


>gi|325981456|ref|YP_004293858.1| dihydroorotase, multifunctional complex type [Nitrosomonas sp.
           AL212]
 gi|325530975|gb|ADZ25696.1| dihydroorotase, multifunctional complex type [Nitrosomonas sp.
           AL212]
          Length = 424

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 139/422 (32%), Positives = 221/422 (52%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           + N R+IDP  DID V  I +  G ++  G     A+F  S +I D   LV  PG++D  
Sbjct: 5   IKNGRLIDPKNDIDSVQDIFIAKGKVVGIGKAP--AEFQASRII-DAQSLVVCPGLVDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L     EY   + +    AVAGG+TSI   P      LDE   ++      +  +  +
Sbjct: 62  VRLREPGLEYKATLESEMSAAVAGGVTSIACPP-DTDPPLDEPGLVEMLKHRAKNLNQAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G+ ++EM  L + G V F Q    + + +VL+ +M+YA   +  V L 
Sbjct: 121 VYPIGALTQGLKGERLTEMAELNDAGCVVFGQPEGLLPNLRVLMQAMRYASTFDFSVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             +  L   GV ++G +A  LGL+ IP  +ET+ ++  +L+ + TG   H   IS  + +
Sbjct: 181 PQEISLTGDGVAHDGEVATRLGLLTIPVCAETIAISNIILLTKETGVKVHLCRISSAEGV 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
           A+I+ AK      TC ++IN+L L++ D+  ++S   ++PPLR   +R ++ + L  G I
Sbjct: 241 AMIRAAKQQGLPITCDVTINHLHLSDMDIGFFDSNCHLMPPLRGSDDRDALRQGLLNGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I SDH P   D KLLPF ++  G+ G+E +L   L+      +SL +++  +++ PA 
Sbjct: 301 DAICSDHAPVDEDAKLLPFGQSEIGATGVELLLPLTLKWGAEMHLSLPRILAKITSDPAG 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I  +  G L  G+AADI + D +Y W V +  + S  KNT F      G +  T ++G  
Sbjct: 361 ILGIEAGHLSIGSAADICVFDPDYYWKVTSSAILSQGKNTPFMGMELPGGIKYTLVNGHI 420

Query: 426 VY 427
           VY
Sbjct: 421 VY 422


>gi|113868867|ref|YP_727356.1| dihydroorotase [Ralstonia eutropha H16]
 gi|113527643|emb|CAJ93988.1| Dihydroorotase [Ralstonia eutropha H16]
          Length = 449

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 144/422 (34%), Positives = 217/422 (51%), Gaps = 5/422 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+ + D    + +  G I+  G+    A F  +  I D +GL+  PG++D  
Sbjct: 27  IKGGRLIDPASNTDAAQDLYIAAGKIVGVGS--APADFTANKTI-DASGLIVCPGLVDLS 83

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A AGG+TS++  P      LDE   ++      R  +  +
Sbjct: 84  ARLREPGYEYKATLESEVAAATAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARTLNQTH 142

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G+ ++EM  L E G V F Q+   +H+TQVLL +++YA      V L 
Sbjct: 143 VYPLGALTLGLKGETLTEMSQLTEAGCVGFSQAEAPVHNTQVLLRALQYAKTFGFTVWLR 202

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D FLG  GV   G +A+ LGL G+  I+ETV L     + + TG   H   +S    +
Sbjct: 203 PEDPFLGG-GVAASGAVASRLGLSGVSVIAETVRLHTIFELMRSTGARVHLCRLSSAAGL 261

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L++ AK      TC ++I+++ L + D+  +NS  +  PPLRS  +R ++V AL  G I
Sbjct: 262 ELVRQAKREGLAVTCDVNIHHVSLTDMDIGYFNSQMRFSPPLRSPRDRDAIVAALADGTI 321

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D + SDHTP   D KLLPFAEAS G+ GLE +L   LR     ++ L   +  ++  PA+
Sbjct: 322 DALCSDHTPVDDDEKLLPFAEASPGATGLELLLPLTLRWAAEHKVPLALALGRITAEPAR 381

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  L  GTL  G+AAD+ + D    W V    + S  KN+ +      GKV  T + G+ 
Sbjct: 382 VIGLKAGTLAVGSAADVCVFDPRQVWKVDRRSIKSQGKNSPWLGYEMEGKVRMTLVGGQV 441

Query: 426 VY 427
           VY
Sbjct: 442 VY 443


>gi|289432885|ref|YP_003462758.1| dihydroorotase [Dehalococcoides sp. GT]
 gi|288946605|gb|ADC74302.1| dihydroorotase, multifunctional complex type [Dehalococcoides sp.
           GT]
          Length = 428

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 147/431 (34%), Positives = 225/431 (52%), Gaps = 15/431 (3%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N RIIDP+   D V  +++ENG++     D    K  T  +I D TG V  PG ID
Sbjct: 3   ILIKNGRIIDPASGTDNVADLLIENGLVTGISKDISPEK--TEKVI-DATGKVVCPGFID 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLG--MSSFLDEYTFIKYALEEIRVK 121
             V L     E  + I +  K A AGG TSI  MP     +  L    FIK    ++   
Sbjct: 60  LHVHLREPGFEGKETIESGCKAAAAGGFTSICPMPNTNPAADCLPVIDFIKNTATKV--- 116

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           SLI V P A +T   +G+E+S M  L E G+V F      +  + +LLN++ Y+   +  
Sbjct: 117 SLIRVLPIAAITKGRKGQELSPMGELAEAGVVGFSDDGDYVSGSSLLLNALLYSRTFDLP 176

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           +     D  L   G++NEG++A  LGL GI + +E + + RD+ +A+ +GG  H   IS 
Sbjct: 177 IMEHCEDACLAEGGLMNEGLLACRLGLKGITNATEEIAVNRDIALAKESGGRLHLCHIST 236

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
            +S+ L++ AKA   + +  ++ ++L L E +V  YN+  KV PPLR++T+  +++  L+
Sbjct: 237 ARSVELVRQAKAAGIRVSAEVTPHHLTLTEAEVNGYNTSAKVNPPLRTQTDIEALIAGLK 296

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID I +DH P   + KL  F  A+ G  GLET L++ + L H  ++SL  LI  L+ 
Sbjct: 297 DGTIDAIATDHAPHTRNDKLCEFGLAANGISGLETALASLMGLVHSGKLSLSLLIEKLTL 356

Query: 362 RPAQIF-----NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
            P Q+      N+  G L+ G+ AD+ + D + +WTV      S  KNT  +     G+V
Sbjct: 357 GPQQVLGEKYQNI--GNLKAGSCADVVIFDPDEEWTVDTAKFFSKGKNTPLEGRKLKGRV 414

Query: 417 VRTYISGKQVY 427
             T   G+ VY
Sbjct: 415 NTTIACGQIVY 425


>gi|167630177|ref|YP_001680676.1| dihydroorotase [Heliobacterium modesticaldum Ice1]
 gi|167592917|gb|ABZ84665.1| dihydroorotase [Heliobacterium modesticaldum Ice1]
          Length = 431

 Score =  229 bits (584), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 132/425 (31%), Positives = 217/425 (51%), Gaps = 4/425 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           +  +   R+IDP+  I+++  + +E GII  AG D  +     +  + +  G + VPG+I
Sbjct: 2   ALYIKGGRVIDPANGINKIADVKIEKGII--AGIDDYSGAITEADEVMEAAGKLVVPGLI 59

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E  + I T ++ A  GG T++  MP       D  T +++ +   +   
Sbjct: 60  DIHCHLREPGLEAKETIATGTRAAARGGFTALCAMP-NTKPVCDSQTGVEFVINRAKAAG 118

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+ VYP   +T   EG+E++EM  +   G V+F      +  + ++   ++YA M+  ++
Sbjct: 119 LVRVYPVGAITKGSEGQELAEMADMAACGAVAFSDDGKPVPRSDIMRLGLQYAQMVGKVI 178

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   GV++EG  +  LGL GIP+ SE + +ARD+L+A+  G   H + +S  
Sbjct: 179 ISHCEDPELAKDGVMHEGYWSTVLGLRGIPAASEAIMVARDILLAESVGAKLHIAHVSTA 238

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S+ LI+ A+      T  +  ++L L + DVE +N+  KV PPLR++ +R ++  AL  
Sbjct: 239 RSVELIRQAQWRGVNVTGEVCPHHLALTDADVEGFNTATKVNPPLRTDQDREALRSALND 298

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALST 361
           G + I+ +DH P   + K   +  A FG  GLET      R L     ++L   + A++ 
Sbjct: 299 GTLTILATDHAPHTAEEKACEYNYAPFGISGLETAWPLFWRELVESGVMTLPSFVAAMTV 358

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA+   LPGGTL TG AAD+ +ID  Y  TV  ++  S  KNT F  +      V T +
Sbjct: 359 APAKRLGLPGGTLSTGVAADVTIIDPEYTETVTLENWQSKGKNTPFVGQTLRSWPVATIV 418

Query: 422 SGKQV 426
            G+ V
Sbjct: 419 GGRVV 423


>gi|237746676|ref|ZP_04577156.1| dihydroorotase [Oxalobacter formigenes HOxBLS]
 gi|229378027|gb|EEO28118.1| dihydroorotase [Oxalobacter formigenes HOxBLS]
          Length = 430

 Score =  229 bits (584), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 139/427 (32%), Positives = 224/427 (52%), Gaps = 4/427 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R+IDP+  ID +  I +  G I A      +    T   I D + LV  PG +D
Sbjct: 3   LLIENGRLIDPANGIDGIRHIAIAEGKIFAIAEKDQSVPGFTPDRIIDASNLVVTPGFVD 62

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L     E+   + +  + AV+GG+TS++  P      LDE   ++        ++ 
Sbjct: 63  LAARLREPGYEHKATLESEMRAAVSGGVTSLVCPP-DTDPVLDEPGLVEMLKYRAAARNQ 121

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
            +VYP   LT  ++G++++EM  L + G + F  +   + DT++LL +++YAH       
Sbjct: 122 AHVYPLGALTIGLKGQKLTEMAELTDAGCIGFSHANEPVPDTEMLLRALQYAHSFGYCSW 181

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   D FL   G+ + G +A  LGL GIPSI+ET+ L     + + TG   H   +S  +
Sbjct: 182 LQPEDPFLAKNGMAHSGPVAAGLGLSGIPSIAETISLHTIFELMRVTGARVHLCRLSTAR 241

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
            I L++ AK      TC + I++L L E D++ +++  ++ PPLR+  +R ++ + L  G
Sbjct: 242 GIELVRQAKKEGLPVTCDVGIHHLHLTEEDIDYFDTNARLTPPLRTLADREAITQGLLDG 301

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA---LS 360
            ID I SDHTP   D KLLPF EA+ G+ GLE +LS  L+    ++ +   L+RA   ++
Sbjct: 302 TIDAICSDHTPVDDDEKLLPFGEATPGATGLELLLSLTLKWAAERKGNPDALVRAIAKIT 361

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           + PA+I  L  G L+ G  ADI + D +  WTV A  ++S  KNT F  +   G+V  T 
Sbjct: 362 SEPARILQLSCGNLKAGEKADICVFDPSVTWTVDASKLASQGKNTPFLGKAIPGRVRLTL 421

Query: 421 ISGKQVY 427
           + G+  +
Sbjct: 422 VEGRIAF 428


>gi|89900175|ref|YP_522646.1| amidohydrolase [Rhodoferax ferrireducens T118]
 gi|89344912|gb|ABD69115.1| dihydroorotase [Rhodoferax ferrireducens T118]
          Length = 435

 Score =  229 bits (584), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 142/436 (32%), Positives = 227/436 (52%), Gaps = 16/436 (3%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           +T+ ++   R+IDP+   DE+  + + NG +LA    A + + P    I D TG + +PG
Sbjct: 4   LTNILIKGGRVIDPASGFDEIVDVALANGTVLAIKNIATDFR-PDQ--IMDATGCIVMPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D  V L     E+   + +    A+AGG+TS++ +P      LDE   ++  +   R 
Sbjct: 61  LVDLAVRLREPGHEHEGMLESEMAAAMAGGVTSLVCLP-DTDPVLDEPGLVE--MLRFRA 117

Query: 121 KSL--INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
           + L    VYP   LT N+ G+ +SEM+ L E G V+F Q+ + + +TQV+  + +YA   
Sbjct: 118 EKLNQARVYPLGALTRNLAGESLSEMQELTEAGCVAFSQAEVPLPNTQVMQRAFQYASTF 177

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
              V L   D FLG +GV   G +A  LGL G+P  +ET+ L     + + TG   H   
Sbjct: 178 GYAVWLRPQDLFLG-QGVAASGALATRLGLSGVPVAAETIALHTIFELMRATGARVHLCR 236

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           +S    + L++ AK    K +C ISIN+L L + D+  ++S  ++ PPLR + +R ++  
Sbjct: 237 LSSAAGVDLVRQAKLDGLKVSCDISINSLHLTDADIGYFDSRARLNPPLRQQRDRDALRA 296

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
            L  G ID +VSDHTP   D K LPFAE+  G+ G+E +LS AL+      + L + +  
Sbjct: 297 GLLDGTIDALVSDHTPVDEDAKTLPFAESEPGATGVELLLSLALKWSQDSGVDLARALAV 356

Query: 359 LSTRPAQIFNLPGGTLQ-------TGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEF 411
           ++  PA +     G  Q        G AAD+ + D    WTV++D + S  K T F    
Sbjct: 357 VTQGPAAVLGASLGKRQASTGRLLAGGAADLCVFDPAAAWTVQSDTLRSQGKYTPFSGYE 416

Query: 412 FTGKVVRTYISGKQVY 427
             G+V  T ++G+  +
Sbjct: 417 LPGRVRCTIMAGRIAF 432


>gi|73748889|ref|YP_308128.1| dihydroorotase [Dehalococcoides sp. CBDB1]
 gi|73660605|emb|CAI83212.1| dihydroorotase, multifunctional complex type [Dehalococcoides sp.
           CBDB1]
          Length = 428

 Score =  229 bits (584), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 147/431 (34%), Positives = 224/431 (51%), Gaps = 15/431 (3%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N RIIDP+   D V  +++ENG++     D    K  T  +I D TG V  PG ID
Sbjct: 3   ILIKNGRIIDPASGTDNVADLLIENGLVTGISKDISPEK--TEKVI-DATGKVVCPGFID 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLG--MSSFLDEYTFIKYALEEIRVK 121
             V L     E  + I +  K A AGG TSI  MP     +  L    FIK    ++   
Sbjct: 60  LHVHLREPGFEGKETIESGCKAAAAGGFTSICPMPNTNPAADCLPVIDFIKNTATKV--- 116

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           SLI V P A +T   +G+E+S M  L E G+V F      +  + +LLN++ Y+   +  
Sbjct: 117 SLIRVLPIAAITKGRKGQELSPMGELAEAGVVGFSDDGDYVSGSSLLLNALLYSRTFDLP 176

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           +     D  L   G++NEG++A  LGL GI + +E + + RD+ +A+ +GG  H   IS 
Sbjct: 177 IMEHCEDACLAEGGLMNEGLLACRLGLKGITNATEEIAVNRDIALAKESGGRLHLCHIST 236

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
             S+ L++ AKA   + +  ++ ++L L E +V  YN+  KV PPLR++T+  +++  L+
Sbjct: 237 AGSVELVRQAKAAGIRVSAEVTPHHLTLTEAEVNGYNTSAKVNPPLRTQTDIEALIAGLK 296

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID I +DH P   + KL  F  A+ G  GLET L++ + L H  ++SL  LI  L+ 
Sbjct: 297 DGTIDAIATDHAPHTRNDKLCEFGLAANGISGLETALASLMGLVHSGKLSLSLLIEKLTL 356

Query: 362 RPAQIF-----NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
            P Q+      N+  G L+ G+ AD+ + D + +WTV      S  KNT  +     G+V
Sbjct: 357 GPQQVLGEKYQNI--GNLKAGSCADVVIFDPDEEWTVDTAKFFSKGKNTPLEGRKLKGRV 414

Query: 417 VRTYISGKQVY 427
             T   G+ VY
Sbjct: 415 NTTIACGQIVY 425


>gi|269797627|ref|YP_003311527.1| dihydroorotase [Veillonella parvula DSM 2008]
 gi|269094256|gb|ACZ24247.1| dihydroorotase, multifunctional complex type [Veillonella parvula
           DSM 2008]
          Length = 428

 Score =  229 bits (583), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 129/425 (30%), Positives = 232/425 (54%), Gaps = 6/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S ++ N  +++P++  +EV  I+V++G I A G + LNA+    A I+D TGL+  PG+I
Sbjct: 2   SLLIKNGTVVNPAKKQNEVADILVKDGKIAAIGQN-LNAE---GAEIYDATGLIVAPGLI 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E  ++  + ++ A AGG T ++ M    +  +D    ++   ++  +  
Sbjct: 58  DIHTHLREPGQEAKEDFHSGTQAAAAGGFTRVVTMA-NTNPVVDNAALVRGLQKQAELTG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++ V     ++  +EGKE+ EM  + E G+V+F      + +   +  +++Y+ M N +V
Sbjct: 117 VVKVEFIGAVSKGLEGKELVEMGDMAEAGVVAFSDDGHYVENAAFMRRALEYSSMFNKMV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G ++EGI++  LG++G P+++E + +ARD+L+++ TGGH H + +S  
Sbjct: 177 IDHAEDITLTKNGHMHEGIVSYELGVIGRPAVAEDLAVARDILLSEMTGGHIHIAHVSSK 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++ +++ AKA     TC ++  +L   +  +  YN   K+ PP+RSE  R +++E L+ 
Sbjct: 237 NTVDMVRRAKAKGLNVTCEVTSQHLSFTDEYLREYNPAFKMAPPIRSEDHRQALLEGLKD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALST 361
           G ID I++DH P   + K   F  A  G  GLET L+A +   +   ++S+ +++  +ST
Sbjct: 297 GTIDAIITDHAPHAYEEKDHEFCCAPNGFSGLETSLAAVITNAYSPDKLSIDQVVYYMST 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           RPA++ +L  G L+ G  ADI +     +WTV  +   +  K + FD    TGK   T +
Sbjct: 357 RPAELMHLDAGVLEVGKPADITVFSTTEKWTVDRNKFYTKGKVSPFDGMTVTGKAKLTVV 416

Query: 422 SGKQV 426
            GK V
Sbjct: 417 DGKIV 421


>gi|126727775|ref|ZP_01743605.1| Dihydroorotase and related cyclic amidohydrolase [Rhodobacterales
           bacterium HTCC2150]
 gi|126702902|gb|EBA02005.1| Dihydroorotase and related cyclic amidohydrolase [Rhodobacterales
           bacterium HTCC2150]
          Length = 428

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 134/427 (31%), Positives = 224/427 (52%), Gaps = 9/427 (2%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH-----DCTGLVAVPG 60
           L+N  +IDP  + + +G ++++ G I       +    P++A I      DC G    PG
Sbjct: 5   LHNAILIDPVAETETLGGMLIKGGKIAQV---FVGDNTPSTADIAKAESIDCQGKYLAPG 61

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           I+D  V +    + + ++  T  + A AGG+T+++  P   +  +D    +++       
Sbjct: 62  IVDIGVKVCEPGERHKESFRTAGRAAAAGGVTTMVTRP-DTTPTIDSPETLEFVTRRANE 120

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            S + + P A LT + +G+E+ E+  L + G  +F      + + +V    + YA  L A
Sbjct: 121 ASPVRMRPMAALTRDRDGREMVEIGFLSDAGAAAFTDCDHVVQNPKVFARCLTYAKSLGA 180

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     D    +   +  G  A   GL  +  I+E + L RDL + + +G  YHA  +S
Sbjct: 181 LVIAHPQDPSFSNGAAVTSGKFATLRGLPSVSPIAERMGLERDLALVEMSGAKYHADNLS 240

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S+  ++ AK      T G+++++L LNE DV  Y +  K+ PPLRSE +R +M++A+
Sbjct: 241 TAASLPALQRAKDAGLDVTAGVNVHHLTLNEFDVGDYRTFFKIKPPLRSEDDRQAMIDAV 300

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID+I S HTP+  ++K LP+ EA+ G++ LET+L A LRLFH   ++L +L RA+S
Sbjct: 301 ASGLIDVISSMHTPQDEESKRLPYEEAASGAVALETLLPAGLRLFHSGDLTLPELFRAMS 360

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+   L  GTL     AD+ L D +  + +    M S  KNT FD +   G+V+ TY
Sbjct: 361 LNPARRLGLDAGTLSKDAPADLVLFDAHAPFVLDRFTMHSKSKNTPFDGQRMQGRVIATY 420

Query: 421 ISGKQVY 427
           + G +V+
Sbjct: 421 VGGNKVW 427


>gi|83719997|ref|YP_442012.1| dihydroorotase [Burkholderia thailandensis E264]
 gi|167618951|ref|ZP_02387582.1| dihydroorotase [Burkholderia thailandensis Bt4]
 gi|257138195|ref|ZP_05586457.1| dihydroorotase [Burkholderia thailandensis E264]
 gi|83653822|gb|ABC37885.1| aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia thailandensis E264]
          Length = 425

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 137/417 (32%), Positives = 214/417 (51%), Gaps = 4/417 (0%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+        + V  G + A GA    A F  +  I D TG++  PG +D    L  
Sbjct: 10  LIDPAAGTQRQADVFVAAGKVAAIGA--APADFNAAKTI-DATGMIVAPGFVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    AVAGG+TS++  P      LDE   ++      R ++  +VYP  
Sbjct: 67  PGYEHKATLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNRNQAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+ + + DTQVLL +++YA      V L   D F
Sbjct: 126 ALTVGLKGQVITEMVELTEAGCIGFTQANVPVTDTQVLLRALQYASTYGYTVWLRPLDAF 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           L   GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL++ 
Sbjct: 186 LAKGGVAASGPVASRLGLSGVPVAAETIALHTLFELMRVTGARVHVARLSSAAGVALVRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     TC +  N+L L + D+  +++  ++ PPLR+E +R ++  AL  G ID I S
Sbjct: 246 AKAEGLPVTCDVGANHLHLIDVDIGYFDAQFRLDPPLRAERDREAIRAALADGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP 370
           DHTP   D KLLPFAEA+ G+ GLE +LS  ++      + L + +  +++ PA +  LP
Sbjct: 306 DHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWAREAGVPLARALATITSAPADVLKLP 365

Query: 371 GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            G +  G  AD+ + D N  W V+   + S   NT F       +V  T ++G+  +
Sbjct: 366 AGRVGEGAPADLCVFDPNAHWRVEPRALKSQGHNTPFLGYELPAQVRATLVAGQVAF 422


>gi|167580850|ref|ZP_02373724.1| dihydroorotase [Burkholderia thailandensis TXDOH]
          Length = 425

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 137/417 (32%), Positives = 214/417 (51%), Gaps = 4/417 (0%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+        + V  G + A GA    A F  +  I D TG++  PG +D    L  
Sbjct: 10  LIDPAAGTQRQADVFVAAGKVAAIGA--APADFNAAKTI-DATGMIVAPGFVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    AVAGG+TS++  P      LDE   ++      R ++  +VYP  
Sbjct: 67  PGYEHKATLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARNRNQAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+ + + DTQVLL +++YA      V L   D F
Sbjct: 126 ALTVGLKGQVITEMVELTEAGCIGFTQANVPVTDTQVLLRALQYASTYGYTVWLRPLDAF 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           L   GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL++ 
Sbjct: 186 LAKGGVAASGPVASRLGLSGVPVAAETIALHTLFELMRVTGARVHVARLSSAAGVALVRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     TC +  N+L L + D+  +++  ++ PPLR+E +R ++  AL  G ID I S
Sbjct: 246 AKAEGLPVTCDVGANHLHLIDVDIGYFDAQFRLDPPLRAERDREAIRAALADGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP 370
           DHTP   D KLLPFAEA+ G+ GLE +LS  ++      + L + +  +++ PA +  LP
Sbjct: 306 DHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWAQEAGVPLARALATITSAPADVLKLP 365

Query: 371 GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            G +  G  AD+ + D N  W V+   + S   NT F       +V  T ++G+  +
Sbjct: 366 AGRVGEGAPADLCVFDPNAHWRVEPRALKSQGHNTPFLGYELPAQVRATLVAGQVAF 422


>gi|282850074|ref|ZP_06259456.1| putative dihydroorotase [Veillonella parvula ATCC 17745]
 gi|294795155|ref|ZP_06760289.1| dihydroorotase, multifunctional complex type [Veillonella sp.
           3_1_44]
 gi|282580263|gb|EFB85664.1| putative dihydroorotase [Veillonella parvula ATCC 17745]
 gi|294453947|gb|EFG22322.1| dihydroorotase, multifunctional complex type [Veillonella sp.
           3_1_44]
          Length = 428

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 127/425 (29%), Positives = 234/425 (55%), Gaps = 6/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S ++ N  +++P++  +EV  ++V++G I A G + L+A+    A ++D TGL+  PG+I
Sbjct: 2   SLLIKNGTVVNPAKKQNEVADVLVKDGKIAAIGQN-LSAE---GAEVYDATGLIVAPGLI 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E  ++  + ++ A AGG T ++ M    +  +D    ++   ++  +  
Sbjct: 58  DIHTHLREPGQEAKEDFHSGTQAAAAGGFTRVVTMA-NTNPVVDNAALVRGLQKQAELTG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++ V     ++  +EGKE++EM  + E G+V+F      + +   +  +++Y+ M N +V
Sbjct: 117 VVKVEFIGAVSKGLEGKELAEMGDMAEAGVVAFSDDGHYVENAAFMRRALEYSSMFNKMV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G ++EGI++  LG++G P+++E + +ARD+L+++ TGGH H + +S  
Sbjct: 177 IDHAEDITLTKNGHMHEGIVSYELGVIGRPAVAEDLAVARDILLSEMTGGHIHIAHVSSK 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++ +++ AKA     TC ++  +L   +  +  YN   K+ PP+RSE  R +++E L+ 
Sbjct: 237 NTVDMVRRAKAKGLNVTCEVTSQHLSFTDEYLREYNPAFKMAPPIRSEDHRQALLEGLKD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHG-QQISLKKLIRALST 361
           G ID I++DH P   + K   F  A  G  GLET L+A +   +G  ++S+ +++  +ST
Sbjct: 297 GTIDAIITDHAPHAYEEKDHEFCCAPNGFSGLETSLAAVITNAYGPDKLSIDQVVYYMST 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           RPA++ +L  G L+ G  ADI +     +WTV  +   +  K + FD    TGK   T +
Sbjct: 357 RPAELMHLDAGVLEVGKPADITVFSTTEEWTVDRNKFYTKGKVSPFDGMTVTGKAKLTVV 416

Query: 422 SGKQV 426
            GK V
Sbjct: 417 DGKIV 421


>gi|110680599|ref|YP_683606.1| dihydroorotase, multifunctional complex type [Roseobacter
           denitrificans OCh 114]
 gi|109456715|gb|ABG32920.1| dihydroorotase, multifunctional complex type [Roseobacter
           denitrificans OCh 114]
          Length = 426

 Score =  228 bits (581), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 136/427 (31%), Positives = 222/427 (51%), Gaps = 5/427 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M    L N R++D       +G + +ENG I    +  L+          DC      PG
Sbjct: 2   MKPLNLVNARLVDSETGSISIGGLRIENGRI----SQRLDRDERPGGETVDCNLKHLAPG 57

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           I+D  V +    + + ++  +    A AGG+T+++  P   +  +D    +++       
Sbjct: 58  IVDIGVKVCEPGERHKESYRSAGLAAAAGGVTTMVTRP-DTTPAIDSPEALEFVTRRANQ 116

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            + +NV P A LT    G+E++E+  L + G V+F      + DT+VL  ++ YA  L A
Sbjct: 117 AAAVNVLPMAALTKGRAGREMTEIGFLMDAGAVAFTDCDRVVTDTKVLSRALSYARSLGA 176

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     D  L +      G  A+  GL  +  ++E + L RD+ + + TG  YHA  I+
Sbjct: 177 LVIAHPQDPGLSAGAAATSGKFASLRGLPAVSPMAERMALDRDIALVEMTGARYHADQIT 236

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++  ++ AK +    T G SI++L LN  DV  Y +  K+ PPLR ET+R+++ +A+
Sbjct: 237 CARALPALERAKQNGHDVTAGTSIHHLTLNALDVADYRTFFKLKPPLRDETDRLAVADAV 296

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID+I S HTP+  ++K LPF EA+ G++ LET+L AA+RL+H   I L  L RA+S
Sbjct: 297 RSGLIDVISSMHTPQDEESKRLPFEEAASGAVALETLLPAAMRLYHADLIDLPTLWRAMS 356

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+   L  G L  G  AD+ L D +  + +    + S  +NT FD     G+V+ TY
Sbjct: 357 LNPAKRLGLDSGRLAAGAPADLVLFDPDAPFLMDRTTLRSKSRNTPFDGARMQGRVLATY 416

Query: 421 ISGKQVY 427
           ++G++VY
Sbjct: 417 VAGQRVY 423


>gi|294793336|ref|ZP_06758481.1| dihydroorotase, multifunctional complex type [Veillonella sp.
           6_1_27]
 gi|294455767|gb|EFG24132.1| dihydroorotase, multifunctional complex type [Veillonella sp.
           6_1_27]
          Length = 428

 Score =  228 bits (581), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 127/425 (29%), Positives = 234/425 (55%), Gaps = 6/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S ++ N  +++P++  +EV  ++V++G I A G + L+A+    A ++D TGL+  PG+I
Sbjct: 2   SLLIKNGTVVNPAKKQNEVADVLVKDGKIAAIGQN-LSAE---GAEVYDATGLIVAPGLI 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E  ++  + ++ A AGG T ++ M    +  +D    ++   ++  +  
Sbjct: 58  DIHTHLREPGQEAKEDFHSGTQAAAAGGFTRVVTMA-NTNPVVDNAALVRGLQKQAELTG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++ V     ++  +EGKE++EM  + E G+V+F      + +   +  +++Y+ M N +V
Sbjct: 117 VVKVEFIGAVSKGLEGKELAEMGDMAEAGVVAFSDDGHYVENAAFMRRALEYSSMFNKMV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G ++EGI++  LG++G P+++E + +ARD+L+++ TGGH H + +S  
Sbjct: 177 IDHAEDITLTKNGHMHEGIVSYELGVIGRPAVAEDLAVARDILLSEMTGGHIHIAHVSSK 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++ +++ AKA     TC ++  +L   +  +  YN   K+ PP+RSE  R +++E L+ 
Sbjct: 237 NTVDMVRRAKAKGLNVTCEVTSQHLSFTDEYLREYNPAFKMAPPIRSEDHRQALLEGLKD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHG-QQISLKKLIRALST 361
           G ID I++DH P   + K   F  A  G  GLET L+A +   +G  ++S+ +++  +ST
Sbjct: 297 GTIDAIITDHAPHAYEEKDHEFCCAPNGFSGLETSLAAVITNAYGPDKLSIDQVVYYMST 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           RPA++ +L  G L+ G  ADI +     +WTV  +   +  K + FD    TGK   T +
Sbjct: 357 RPAELMHLDAGVLEVGKPADITVFSTTEKWTVDRNKFYTKGKVSPFDGMTVTGKAKLTVV 416

Query: 422 SGKQV 426
            GK V
Sbjct: 417 DGKIV 421


>gi|291615386|ref|YP_003525543.1| dihydroorotase, multifunctional complex type [Sideroxydans
           lithotrophicus ES-1]
 gi|291585498|gb|ADE13156.1| dihydroorotase, multifunctional complex type [Sideroxydans
           lithotrophicus ES-1]
          Length = 424

 Score =  228 bits (581), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 135/424 (31%), Positives = 217/424 (51%), Gaps = 4/424 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           + N R+IDP   ID    + + +  I A G       F    +I D  GL+ +PG++D  
Sbjct: 5   IKNGRLIDPHNKIDATQDVFIADKRIAAIGKAPQG--FAAEQVI-DAGGLIVMPGLVDVA 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A+AGG+TS+   P      LDE   ++      R+ +   
Sbjct: 62  ARLREPGYEYKATLESEMDAAMAGGVTSLSCPP-DTDPPLDEPGLVEMLKHRARLLNQAR 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V+P   LT  ++G E++EM  L E G  +F Q+   + DT+VL+ +M+YA      V L 
Sbjct: 121 VFPVGALTYGLKGAELTEMIELAEAGCKAFSQADALLTDTRVLMRAMQYAATFGYRVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D FL   GV ++G +A  LGL  IP ++ET+ LA  L +A+ TG   H   IS  + +
Sbjct: 181 PQDAFLAKDGVAHDGEVATRLGLPAIPVVAETIALATMLQLARETGVKLHVCRISSAEGV 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +++ AK      TC +S+N++ L+E D+  +++  +++PPLR+  ++ ++   L  G I
Sbjct: 241 DMVRAAKRQGLAVTCDVSMNHVHLSEMDIGFFDANCRLMPPLRNLRDKAALRAGLLDGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I S+H+P   D K LPFAEA  G+ G+E +L   L+    +++ L   +  ++  PAQ
Sbjct: 301 DAICSNHSPVDEDAKQLPFAEAEAGATGMELLLPLVLKWAEQEKVPLLDALARVTINPAQ 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  +  G L  G  AD+ + D    W V+   + S  KNT F+     GK   T + GK 
Sbjct: 361 LLGVKTGHLSVGAHADVCVFDPAITWKVEPAALKSQGKNTPFNGYTMQGKARHTIVEGKV 420

Query: 426 VYTL 429
            Y+L
Sbjct: 421 AYSL 424


>gi|294341154|emb|CAZ89555.1| putative Dihydroorotase-like protein (Aspartate
           carbamoyltransferase 44 kDa Non-catalytic chain) PyrC'
           [Thiomonas sp. 3As]
          Length = 434

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 140/430 (32%), Positives = 218/430 (50%), Gaps = 6/430 (1%)

Query: 2   TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGI 61
           T  ++   R+IDP R +D  G I +    I+A G  A     P   L  D  GL+ +PG+
Sbjct: 4   TQLLIRGGRLIDPLRGLDTEGDIAISGERIVAVG-KAPEGFTPDQTL--DARGLLVLPGL 60

Query: 62  IDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ID    L G P  E+   + T  + A+AGG+T ++  P      LDE + ++      R 
Sbjct: 61  IDLCARL-GEPGYEHEGMLETELRAALAGGVTRVVCSP-DTDPVLDEPSLVEMLRWRARR 118

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
                VYP   LT  ++G+ +SEM  L     + F Q+   + DT+VL ++M+YA     
Sbjct: 119 IKSARVYPLGALTKGLKGESLSEMAELTRASCIGFSQADTPMTDTKVLYSAMQYASTFGY 178

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V L   D  L   G+   G  A  LGL G+P+++ETV L     + + TG   H S +S
Sbjct: 179 KVWLRAQDASLSRGGIAASGAYAQRLGLSGVPAMAETVALYTLFELMRATGCAVHVSKLS 238

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
               +AL++ AKA     TC +SINNL+L + D+  +++  ++ PPLR   +R ++  AL
Sbjct: 239 SAAGVALVRQAKAEGLPLTCDVSINNLMLTDLDIGYFDARARLDPPLRQSRDRDALRAAL 298

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID + SDHTP   D K   FA+A+ G+ GLE +LS AL+      + L + +  + 
Sbjct: 299 ADGTIDALCSDHTPISADDKTQTFADAAPGATGLELLLSTALQFAADSGLPLVQALGCVG 358

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
            R AQ   LP  TL+ G AA++ L+D   +W    D + S  ++T   ++   G+     
Sbjct: 359 HRAAQAAGLPPATLEAGAAAELILVDPQARWRALPDALQSQSRHTPLAEQELPGRTRHAV 418

Query: 421 ISGKQVYTLE 430
           I G+ V++ +
Sbjct: 419 IDGRVVWSAQ 428


>gi|219670029|ref|YP_002460464.1| dihydroorotase [Desulfitobacterium hafniense DCB-2]
 gi|219540289|gb|ACL22028.1| dihydroorotase, multifunctional complex type [Desulfitobacterium
           hafniense DCB-2]
          Length = 434

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 136/434 (31%), Positives = 227/434 (52%), Gaps = 9/434 (2%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFP-----TSALIHDCTGLVAV 58
           + + N +++DP++ +  V  +++  G +L        A+       T     D  G    
Sbjct: 2   WWIKNAQVVDPAQGLSGVYDVLIGEGKVLQLKKGLTEAEVKGECGETGWQEIDAAGSYLF 61

Query: 59  PGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           PG+ID    L     E  ++I + S+ AV GG T+I+ MP   +  LD+   ++Y + + 
Sbjct: 62  PGLIDVHTHLREPGREDKEDIASGSRAAVRGGFTTILAMP-NTTPILDQKALVEYVVNQG 120

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
           +   L  V+P A +T    GKE+ EM  L   G   F      +   +++  +++YA + 
Sbjct: 121 KKVGLAKVHPIAAITKGQAGKELVEMVELAAAGAAGFSDDGRGVQQGEMMRLALEYAKLT 180

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
           +  V     D  L  +GV++ GI++  LGL GIPS SE+V +ARD+L+A+ +GG  H + 
Sbjct: 181 SCPVISHCEDESLAHKGVMHRGIVSTRLGLKGIPSSSESVMVARDILLAEESGGKLHLAH 240

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEM--YNSLRKVLPPLRSETERMSM 296
           IS  +S+ALI+  K      T  ++ ++L+  +  V    Y +  KV PPLR E +R ++
Sbjct: 241 ISAKESVALIREGKKRGVDVTAEVNPHHLLFTDEAVARTPYGTSYKVNPPLRREEDRQAL 300

Query: 297 VEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKL 355
           +E L  G +D++ +DH P   + K  PF +A FG  GLET L+A  + L     + ++ L
Sbjct: 301 IEGLLDGTLDMLATDHAPHTWEEKTNPFDQAPFGISGLETALAAVWQELVTTGILPIELL 360

Query: 356 IRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK 415
           I+A S  PAQ F LPGGTL+ G  AD+ L D  +   +  + ++S  KNT F  +   G 
Sbjct: 361 IKAWSMNPAQRFQLPGGTLKVGGPADLILFDPEHTELIDTEYLASKGKNTPFLGQRLQGF 420

Query: 416 VVRTYISGKQVYTL 429
            V+ ++ G+ V+ +
Sbjct: 421 PVKVWVDGRLVHEI 434


>gi|89091929|ref|ZP_01164884.1| dihydroorotase, multifunctional complex type [Oceanospirillum sp.
           MED92]
 gi|89083664|gb|EAR62881.1| dihydroorotase, multifunctional complex type [Oceanospirillum sp.
           MED92]
          Length = 426

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 136/428 (31%), Positives = 213/428 (49%), Gaps = 4/428 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++   R+IDP+  +D V  + + +G ILA G    N  F    +I D +  V  PG I
Sbjct: 2   NILIQGGRVIDPANQLDNVTNLYISDGKILAVGEAPDN--FSADQII-DASNKVVCPGFI 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D              +I T S  AVAGG+T++ + P   +  +D     +   +      
Sbjct: 59  DLSAHTCEPGPSQKGSIKTESDAAVAGGVTTL-MTPPTTAPVIDTSAVAELIKDRCEEAG 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            + + P   LT  ++G++++ M  L   G V+F      + ++ +L+  ++YA   + +V
Sbjct: 118 KMQILPMGALTKGLDGEQLAPMAALASSGCVAFSNCRKPVANSLILMRCLEYAATHDLLV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G +++G     LGL GIP  +ET+ +AR LL+A+ TG   H   +S  
Sbjct: 178 VFQAQDEALAKGGSMHDGSTCTRLGLNGIPESAETIEVARCLLMAEQTGVRAHFGQLSCE 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S+ +I  A+      T  +SI NL+L + +V  +N+   ++PPLRS+ +R  +++ L  
Sbjct: 238 RSVRMISEARERGLPVTADVSIQNLLLTDENVNGFNNDFHLIPPLRSQLDRAGLIQGLLS 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G I  I SDH P     K  PFA+   G IGLET+LS  L L     + L +LI  L++ 
Sbjct: 298 GTIQAICSDHQPHERAAKEAPFADTESGMIGLETLLSLTLILVEQNMLELPQLIEKLTSA 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+I  L  GTL  G  A+IA+ D   +W + A+   S  KNT F      G+V  T   
Sbjct: 358 PAEILGLETGTLTVGKPANIAIFDQEMEWALNAETCHSRGKNTPFMDYPLKGRVCTTLFK 417

Query: 423 GKQVYTLE 430
           GK VY LE
Sbjct: 418 GKVVYQLE 425


>gi|302344074|ref|YP_003808603.1| dihydroorotase, multifunctional complex type [Desulfarculus baarsii
           DSM 2075]
 gi|301640687|gb|ADK86009.1| dihydroorotase, multifunctional complex type [Desulfarculus baarsii
           DSM 2075]
          Length = 434

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 144/428 (33%), Positives = 220/428 (51%), Gaps = 5/428 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L N R++ P+  +DEVG +++  G I A G D +NA     A + DC GL+  PG+ID
Sbjct: 9   LLLKNGRLLCPAGGLDEVGDLLMAGGRIAAVGGD-INAP---GARVIDCAGLIVAPGLID 64

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     EY ++I + ++ A AGG T++  MP   S   D     +  L        
Sbjct: 65  IHVHLREPGQEYKEDIASGARAAAAGGFTAVACMP-NTSPTNDCKAVTELILRRAAAAGQ 123

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             VYP   +T  + G+ +SEM  L++ G  +       + D+++L  +M+YA  L  +V 
Sbjct: 124 ARVYPIGAITVGLGGEMLSEMADLRDAGCPAVSDDGRPVADSRLLRRAMEYASGLGLVVV 183

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             + D  L + G ++EG  A  LGL GIP+ +E + + RD+ +A   G   H + +S   
Sbjct: 184 CHSEDMRLSAGGAMHEGPTATRLGLAGIPAEAEALAIERDIALAALAGARVHIAHVSCAG 243

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+A ++ AK      +     + L L + DV  Y++ RK+ PPLRS  +  ++ + L  G
Sbjct: 244 SVAAVRRAKEAGQNVSAETCPHYLTLCDEDVGDYDTHRKMNPPLRSRDDVAAVRQGLADG 303

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID++ +DH P     KL+ F +A FG  GLET L   L L     +SLK+LI A+S  P
Sbjct: 304 TIDVLATDHAPHSSLEKLVEFDKALFGVTGLETALGVGLELVDEGALSLKRLIEAMSAAP 363

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+  NLPGG L+    AD+ +ID    W V+   M S  +NT F      G+ V T   G
Sbjct: 364 ARALNLPGGALKLNEPADVTVIDAARPWVVEPARMLSKSRNTPFAGRRLPGRAVLTIRDG 423

Query: 424 KQVYTLES 431
           + +Y LE 
Sbjct: 424 RVIYQLEG 431


>gi|167841042|ref|ZP_02467726.1| dihydroorotase [Burkholderia thailandensis MSMB43]
          Length = 425

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 137/419 (32%), Positives = 218/419 (52%), Gaps = 8/419 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           ++DP+     +  + V  G + A GA    A F  +  I D TG++  PG +D    L  
Sbjct: 10  LVDPAAGTQRLADVFVSAGKVAAIGA--APADFNAAKTI-DATGMIVAPGFVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYP 128
              E+   + +    AVAGG+TS++  P      LDE   ++  + + R ++L   +VYP
Sbjct: 67  PGYEHKATLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQAHVYP 123

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  ++G+ I+EM  L E G + F Q+ + + DTQVLL +++YA      V L   D
Sbjct: 124 LGALTVGLKGQVITEMAELTEAGCIGFTQANVPVTDTQVLLRALQYASTYGYAVWLRPLD 183

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
            FL   GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL+
Sbjct: 184 AFLAKGGVAASGPVASRLGLSGVPVAAETIALHTLFELMRVTGARVHVARLSSAAGVALV 243

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     TC +  N+L L + D+  +++  ++ PPLR+E +R ++  AL  G ID I
Sbjct: 244 RAAKAEGLPVTCDVGANHLHLIDVDIGYFDAQFRLDPPLRAERDREAIRAALADGTIDAI 303

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            SDHTP   D KLLPFAEA+ G+ GLE +LS  ++      + L + +  +++ PA +  
Sbjct: 304 CSDHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWAREAGVPLARALATITSAPADVLK 363

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           LP G L  G  AD+ + D +  W V+   + S   NT F       +V  T ++G+  +
Sbjct: 364 LPAGRLGEGAPADLCVFDPDAHWRVEPRVLKSQGHNTPFLGYELPAQVCATLVAGQVAF 422


>gi|77919213|ref|YP_357028.1| dihydrooratase [Pelobacter carbinolicus DSM 2380]
 gi|123574146|sp|Q3A449|PYRC_PELCD RecName: Full=Dihydroorotase; Short=DHOase
 gi|77545296|gb|ABA88858.1| dihydroorotase [Pelobacter carbinolicus DSM 2380]
          Length = 425

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 131/426 (30%), Positives = 218/426 (51%), Gaps = 5/426 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R++DP+  IDE   +++E+  I   G D   A     A   D  G + VPG+ID
Sbjct: 3   ILITNGRVLDPAHGIDEKFDVLIEDNRIAQVGTDIQTA----DAEKIDAAGCLVVPGLID 58

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     EY ++I + ++ A AGG T++  MP   S   D     +Y L +      
Sbjct: 59  IHVHLRDPGFEYKEDIESGTRAAAAGGFTAVACMP-NTSPVNDNKATTQYILHKAAQAGH 117

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             VYP   +T  ++G+ ++E+  +++ G V+       +   +++  +++YA   +  + 
Sbjct: 118 AKVYPVGAITKGLKGESLAELGDMKQAGCVAVTDDGHPVSHGEIMRRALEYARSFDLPIV 177

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             + D  L   GV+N+G +A  LGL GIP ++E   +ARD+++A++T    H + +S   
Sbjct: 178 SHSEDLSLVGDGVMNDGFVATELGLRGIPWVAEVSAVARDVMLAEYTNARLHVAHVSTRG 237

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           ++ +I+ AKA   + T   + +   L E+ V  Y++  K+ PPLR+  +  ++ E L  G
Sbjct: 238 AVEIIRAAKARGARVTAETAPHYFTLTEDAVRGYDTHAKMNPPLRTSDDLEAIREGLADG 297

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            + +I +DH P H D K + F  A  G IGLET L   LRL     +SL   I  L++ P
Sbjct: 298 TLSVIATDHAPHHPDEKNVEFNLALNGIIGLETALPLTLRLVEEGALSLSDAIACLTSGP 357

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A   +LPGGTL+ G  AD+ +ID   +WT+      S  +NT F      G+ + T + G
Sbjct: 358 AAALSLPGGTLEVGRPADVTIIDPEIKWTLDPQAGQSRSRNTPFGDWKLKGRAICTIVDG 417

Query: 424 KQVYTL 429
           +  Y L
Sbjct: 418 RITYRL 423


>gi|296136978|ref|YP_003644220.1| amidohydrolase [Thiomonas intermedia K12]
 gi|295797100|gb|ADG31890.1| amidohydrolase [Thiomonas intermedia K12]
          Length = 434

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 140/430 (32%), Positives = 218/430 (50%), Gaps = 6/430 (1%)

Query: 2   TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGI 61
           T  ++   R+IDP R +D  G + +    I+A G  A     P   L  D  GL+ +PG+
Sbjct: 4   TQLLIRGGRLIDPLRGLDTEGDVAISGERIVAVG-KAPEGFTPEQTL--DARGLLVLPGL 60

Query: 62  IDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ID    L G P  E+   + T  + A+AGG+T ++  P      LDE + ++      R 
Sbjct: 61  IDLCARL-GEPGYEHEGMLETELRAALAGGVTRVVCSP-DTDPVLDEPSLVEMLRWRARR 118

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
                VYP   LT  ++G+ +SEM  L     + F Q+   + DT+VL ++M+YA     
Sbjct: 119 IKSARVYPLGALTKGLKGESLSEMAELTRASCIGFSQADTPMTDTKVLYSAMQYASTFGY 178

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V L   D  L   G+   G  A  LGL G+P+++ETV L     + + TG   H S +S
Sbjct: 179 KVWLRAQDASLSRGGIAASGAYAQRLGLSGVPAMAETVALHTLFELMRATGCAVHVSKLS 238

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
               +AL++ AKA     TC +SINNL+L + D+  +++  ++ PPLR   +R ++  AL
Sbjct: 239 SAAGVALVRQAKAEGLPLTCDVSINNLMLTDLDIGYFDARARLDPPLRQSRDRDALRVAL 298

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID + SDHTP   D K   FA+A+ G+ GLE +LS AL+      + L K +  + 
Sbjct: 299 ADGTIDALCSDHTPISADDKTQTFADAAPGATGLELLLSVALQFAADSGLPLVKALGCVG 358

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
            R AQ   LP  TL+ G AA++ L+D   +W    D + S  ++T   ++   G+     
Sbjct: 359 HRAAQAAGLPPATLEAGAAAELILVDPQARWRALPDALQSQSRHTPLAEQELPGRTRHAV 418

Query: 421 ISGKQVYTLE 430
           I G+ V++ +
Sbjct: 419 IDGRVVWSAQ 428


>gi|238019705|ref|ZP_04600131.1| hypothetical protein VEIDISOL_01580 [Veillonella dispar ATCC 17748]
 gi|237863746|gb|EEP65036.1| hypothetical protein VEIDISOL_01580 [Veillonella dispar ATCC 17748]
          Length = 426

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 126/424 (29%), Positives = 232/424 (54%), Gaps = 6/424 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N  +++P++  +EV  ++V++G I A G + L+A+    A ++D TGL+  PG+ID
Sbjct: 1   MLIKNGTVVNPAKKQNEVADVLVKDGKIAAIGQN-LSAE---GAEVYDATGLIVAPGLID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L     E  ++  + ++ A AGG T ++ M    +  +D    ++   ++  +  +
Sbjct: 57  IHTHLREPGQEAKEDFHSGTQAAAAGGFTRVVTMA-NTNPVVDNAALVRGLQKQAELTGV 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V     ++  +EGKE++EM  + E G+V+F      + +   +  +++Y+ M N +V 
Sbjct: 116 VKVEFIGAVSKGLEGKELAEMGDMAEAGVVAFSDDGHYVENAAFMRRALEYSSMFNKMVI 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  L   G ++EGI++  LG++G P+++E + +ARD+L+++ TGGH H + +S   
Sbjct: 176 DHAEDITLTKNGHMHEGIVSYELGVIGRPAVAEDLAVARDILLSEMTGGHIHIAHVSSKN 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           ++ +++ AKA     TC ++  +L   +  +  YN   K+ PP+RSE  R +++E L+ G
Sbjct: 236 TVDMVRRAKAKGLNVTCEVTSQHLSFTDEYLREYNPAFKMAPPIRSEDHRQALLEGLKDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHG-QQISLKKLIRALSTR 362
            ID I++DH P   + K   F  A  G  GLET L+A +   +G  ++S+ +++  +STR
Sbjct: 296 TIDAIITDHAPHAYEEKDHEFCCAPNGFSGLETSLAAVITNAYGPDKLSIDQVVYYMSTR 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA++  L  G L+ G  ADI +     +WTV  +   +  K + FD    TGK   T + 
Sbjct: 356 PAELMRLDAGVLEVGKPADITVFSTTEEWTVDRNKFYTKGKVSPFDGMTVTGKAKLTVVD 415

Query: 423 GKQV 426
           GK V
Sbjct: 416 GKVV 419


>gi|290968207|ref|ZP_06559750.1| putative dihydroorotase [Megasphaera genomosp. type_1 str. 28L]
 gi|290781689|gb|EFD94274.1| putative dihydroorotase [Megasphaera genomosp. type_1 str. 28L]
          Length = 429

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 139/426 (32%), Positives = 226/426 (53%), Gaps = 8/426 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGAD-ALNAKFPTSALIHDCTGLVAVPGI 61
           + ++ N R+++P++  DE+  I +E+GII A G   +L A         D +GL   PG+
Sbjct: 2   TLLVKNGRVVNPAKKQDELCDIYIEDGIIRAMGPHLSLQADDTL-----DASGLTVTPGL 56

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           ID  V L        + + + +  A AGG T +  MP   S  +D           I  +
Sbjct: 57  IDMHVHLRQPGQSGKETLDSGTAAAAAGGFTRVATMP-NTSPVIDSALIADGLRYHIEKE 115

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           S + V     ++  MEG+E++ M  + + G+ +F      + +   +  +M+Y+ ML  +
Sbjct: 116 SHVKVEIIGAVSKGMEGRELAAMGGMVKAGVAAFSDDGHYVENCDFMRKAMEYSSMLKKV 175

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           +     D  L + GV++EG ++  LGL G P+++E + +ARD+L+AQ TG   H + IS 
Sbjct: 176 IIDHCEDTHLIADGVMHEGAVSAALGLKGRPAVAEDIAVARDILLAQATGCAVHIAHIST 235

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
             ++A+++ AKA     T   + +++I  +  +  Y++  KV PPLRSE  R +++  L+
Sbjct: 236 KNAVAMVRRAKAAGIPVTAEATPHHVIFTDEALRTYDTRFKVNPPLRSEEHRAAVLAGLQ 295

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALS 360
            G ID IV+DH P   D K   F  A  G +GLET + A L  L+H  ++ L  ++ A+S
Sbjct: 296 DGTIDAIVTDHAPHSWDEKDREFNAAPSGFVGLETCVGAVLTHLYHTGRMDLTAIVEAMS 355

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
            RPA I  +PGG L  G AAD+ L+DL  +WTV+A +  S  K + FD   F GK   T 
Sbjct: 356 VRPAAILQVPGGVLAEGCAADLTLLDLQAEWTVQAKNFYSQSKLSPFDGMVFKGKPAATI 415

Query: 421 ISGKQV 426
           + G+ V
Sbjct: 416 VDGRIV 421


>gi|221213799|ref|ZP_03586773.1| dihydroorotase, multifunctional complex type [Burkholderia
           multivorans CGD1]
 gi|221166588|gb|EED99060.1| dihydroorotase, multifunctional complex type [Burkholderia
           multivorans CGD1]
          Length = 428

 Score =  227 bits (578), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 140/420 (33%), Positives = 219/420 (52%), Gaps = 7/420 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILA-AGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLT 69
           +IDP    +    + +  G I A A A    A F     I D TGL+  PG++D    L 
Sbjct: 10  LIDPVAGSERQADVFISGGKIDAIAEAGRAPAGFAADKTI-DATGLIVAPGLVDLCARLR 68

Query: 70  GSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVY 127
               E+   + +    AVAGG+T+++  P      LDE   ++  + + R ++L   NV+
Sbjct: 69  EPGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQANVH 125

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   
Sbjct: 126 PLGALTVGLKGEVITEMVALTESGCVGFTHANVPLRDTQVLLRALQYASTYGYTTWLRPL 185

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL
Sbjct: 186 DAFIGKGGVAASGPVASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLAL 245

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           ++ AKA     TC + +N+L L + D+  ++S  ++ PPLRSE +R ++  AL  G ID 
Sbjct: 246 VRAAKAEGLPVTCDVGVNHLHLIDVDIGYFDSQFRLDPPLRSERDREAIRAALADGTIDA 305

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I SDHTP   D KLLPF EA+ G+ GLE +LS  ++     +  L + +R +++ PA + 
Sbjct: 306 ICSDHTPVDDDEKLLPFGEATPGATGLELLLSLTVKWADETRTPLAQALRRITSAPADVL 365

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           NLP G L  G+AAD+ + D +  W V+   + S   N+ F        V  T ++G+  +
Sbjct: 366 NLPAGRLTEGSAADLCVFDPHAHWRVEPRALKSQGHNSPFLGYELPACVCATLVAGQVAF 425


>gi|270308370|ref|YP_003330428.1| dihydroorotase [Dehalococcoides sp. VS]
 gi|270154262|gb|ACZ62100.1| dihydroorotase [Dehalococcoides sp. VS]
          Length = 436

 Score =  226 bits (576), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 140/429 (32%), Positives = 219/429 (51%), Gaps = 11/429 (2%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSAL--IHDCTGLVAVPGI 61
            ++ N RIIDP+   D+V  +++ENG++       +N+  P+     + D  G V  PG 
Sbjct: 12  ILIKNGRIIDPASKTDKVADLLLENGLVAG-----INSNIPSDKADEVIDAEGKVVCPGF 66

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           ID  V L     E  + I +  K A AGG T+I  MP   +   D    I +        
Sbjct: 67  IDLHVHLREPGFEGKETIESGCKAAAAGGFTTICPMP-NTNPAADNLPVIDFVKNTAAKV 125

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           S I V P A +T   +G+E+S M  L E G+  F      + ++ +LL+++ Y+   +  
Sbjct: 126 SPIRVLPIAAITKGRKGQELSPMGELAEAGVAGFSDDGDYVSNSSMLLHALLYSRTFDLP 185

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V     D  L   GV+NEG++A  LGL GIP  +E + L+RD+ +A+ +GG  H   IS 
Sbjct: 186 VMEHCEDACLAEGGVMNEGLLACRLGLKGIPDAAEEIALSRDIALAKESGGRLHLCHIST 245

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
             S+ L++ AKA   + +  I+ ++L L E++V  YN+  KV PPLR++++  +++  L+
Sbjct: 246 AGSVELVRRAKATGIQVSAEITPHHLTLTESEVSGYNTSAKVNPPLRTQSDIEALITGLK 305

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID I +DH P   + KL  F  A+ G  GLET  ++ + L H   ISL  LI  L+ 
Sbjct: 306 DGTIDAIATDHAPHTANDKLCEFGLAANGISGLETAFASLMGLVHSGSISLNLLIEKLTL 365

Query: 362 RPAQIFNLPG---GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
            P Q+        G L+ G++AD+ + D + +WTV      S  KNT  +     G+V  
Sbjct: 366 GPQQVLGEKHKDIGNLKPGSSADVVIFDPDEEWTVDTARFFSKGKNTPLEGRRLKGRVKT 425

Query: 419 TYISGKQVY 427
           T   G+  Y
Sbjct: 426 TIACGRIAY 434


>gi|152994579|ref|YP_001339414.1| dihydroorotase [Marinomonas sp. MWYL1]
 gi|150835503|gb|ABR69479.1| dihydroorotase, multifunctional complex type [Marinomonas sp.
           MWYL1]
          Length = 425

 Score =  226 bits (576), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 131/422 (31%), Positives = 219/422 (51%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           + N R+IDPS+DID V  + V+N  I+A G      +    A + D +G   +PG++D  
Sbjct: 5   IQNGRLIDPSQDIDAVTDLFVDNQKIVAIGEAPEGFE---DAEVVDASGQWILPGLVDLA 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V+L         NI T  + AV+GG+T+++  P      +D         ++     + N
Sbjct: 62  VSLREPGLTQKGNIATEGRAAVSGGVTTLVCPP-DTRPIVDTAAVAALIQDKADDAGMAN 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V+P   LT  +EG ++S M  L + G ++       +  T+VL  +++YA   + +V   
Sbjct: 121 VFPLGALTQGLEGAQLSNMVALTDAGCIALSNHRHPMASTKVLSRALEYAATHDLLVVFH 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             +  L   G  +EG+++   GL GIP  +ET+ L RDLL+ + TG   H + +S  +S+
Sbjct: 181 PDESSLSEGGCAHEGLMSTMHGLAGIPEEAETIALMRDLLLVEKTGVRAHFARLSCAKSV 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +I  AKA     T  ++++NL+LN+  +  +N    VLPPLRS+ +R++++E ++ G I
Sbjct: 241 EMIADAKASGLDVTADVAVHNLLLNDQVLSRFNGHFHVLPPLRSDEDRLTLIEGIKAGVI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
             I SDH P     K+ PFA    G   +E +L  A++L     +    ++  L++ PA 
Sbjct: 301 SAICSDHQPHEKMAKIAPFAATEPGMANVEILLPLAMQLMDEGDLDFSTVLTCLTSGPAA 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
            F L  G+L  G+ AD  L D   +WT   +   +   N+ +    F G+V+ TYISG++
Sbjct: 361 CFGLEAGSLSVGSFADFILFDSTARWTWSYEGRKTKGHNSPYFGGEFVGRVMSTYISGQR 420

Query: 426 VY 427
           VY
Sbjct: 421 VY 422


>gi|189219574|ref|YP_001940215.1| dihydroorotase [Methylacidiphilum infernorum V4]
 gi|189186432|gb|ACD83617.1| Dihydroorotase [Methylacidiphilum infernorum V4]
          Length = 437

 Score =  226 bits (575), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 134/432 (31%), Positives = 232/432 (53%), Gaps = 10/432 (2%)

Query: 2   TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGI 61
           T F + + RIIDP    DE+  I V +G ++       + ++       +  GLV  PG+
Sbjct: 6   TGFHITSGRIIDPLSRRDEIADIYVFDGRVVNPAELQPDVRWTRI----EARGLVVAPGL 61

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMP--LGMSSFLDEYTFIKYALEEIR 119
           ID  V L    +   + I T +  A AGGIT+++ MP  L  +   D  T+I    E+  
Sbjct: 62  IDMHVHLREPGETRKETIRTGTMAAAAGGITTVVAMPNTLPPADNPDTITWIGKKAEK-- 119

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
            ++L+ VYPT C+T    G+++S  + L + G ++       + +++++  +M+YA +L+
Sbjct: 120 -EALVRVYPTGCITEGRRGEKLSPFQSLVQAGAIALSDDGNCVQNSRIMYLAMEYASVLD 178

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
             +     D  L   GV+NEG  +  LGL G PSI+E + ++RD+L+ + T    H   +
Sbjct: 179 VPILDHCEDTTLSDGGVMNEGYWSTLLGLPGWPSIAEELMVSRDILLCEKTQARIHLQHL 238

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           +   S+ L++ AK      +  +  ++L L ++ +  Y++  K+ PPLR + +R +++EA
Sbjct: 239 TTEGSVRLLREAKKRGLPVSAEVCPHHLALTDSSLRNYDTRFKMNPPLRGQKDREALIEA 298

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRA 358
           +  G I++I SDH P     K + F +A FG +GLET+LS  L+ L+  +++ L  L   
Sbjct: 299 VVDGTIEVIASDHAPHTQFEKEVEFDKAPFGVVGLETLLSVCLQELYFSKKMDLLDLFSR 358

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           L+  P+++  LP  +L  G+ AD+ L+DL  +W V ++   S  KNT F+   F GKVV 
Sbjct: 359 LTLGPSRVLGLPQPSLSYGSVADLILLDLEEEWKVDSNQFLSKGKNTPFEGLTFKGKVVL 418

Query: 419 TYISGKQVYTLE 430
           T + G+  +  E
Sbjct: 419 TMVDGQIAWQRE 430


>gi|332530316|ref|ZP_08406262.1| dihydroorotase [Hylemonella gracilis ATCC 19624]
 gi|332040302|gb|EGI76682.1| dihydroorotase [Hylemonella gracilis ATCC 19624]
          Length = 435

 Score =  226 bits (575), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 144/437 (32%), Positives = 226/437 (51%), Gaps = 20/437 (4%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++   R+IDP+   D +  + +  G I+  G+  ++A F    +I D  GLV  PG++D
Sbjct: 3   LLIQGGRVIDPASKTDRIADVAIAAGRIVGLGS--VSADFSPDRVI-DARGLVVAPGLVD 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+   + +    AVAGG+TS+   P      LDE   ++  + + R + L
Sbjct: 60  LAVRLREPGHEHEGMLESEMAAAVAGGVTSLACPP-DTDPVLDEPGLVE--MLKFRAEKL 116

Query: 124 --INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
               V+P   LT  ++G+ ++EM  L E G V+F Q+ +++ +TQVL  ++ YA      
Sbjct: 117 HQARVFPIGALTRGLQGESLTEMAELTEAGCVAFGQADVALLNTQVLQRALLYAATFGYT 176

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V L  +DH LG +GV   G +A  LGL G+P  +ET+ L     + ++TG   H   IS 
Sbjct: 177 VWLRPNDHHLG-QGVAASGALATRLGLSGVPVAAETIALHTIFELVRNTGCRVHLCRISS 235

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
              +AL++ AKA     +C +S+N+L L + D+  ++   ++ PPLR  T+R ++  AL 
Sbjct: 236 AAGVALVRQAKAEGLPVSCDVSVNSLHLCDTDIGYFDRRARLTPPLRQSTDRDALRAALA 295

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR----LFHGQQISLKKLIR 357
            G ID +VSDHTP   D K+LPFA A  G+ G+E +LS AL+    L       L + + 
Sbjct: 296 DGTIDALVSDHTPVDEDAKMLPFASAEPGATGVELLLSLALKWGETLGKPGSDGLSRALA 355

Query: 358 ALSTRPAQIFNLPGGTLQT-------GTAADIALIDLNYQWTVKADDMSSIHKNTVFDKE 410
            LS+ PA++     GTLQ        G  AD+ + D    WTV  + + S  K+T F   
Sbjct: 356 VLSSEPARVLGGALGTLQASIGKLSVGGVADLCIFDPAAAWTVTPEALRSQGKHTPFAGY 415

Query: 411 FFTGKVVRTYISGKQVY 427
              G+V  T + G+  Y
Sbjct: 416 ELPGRVRCTVVGGQLAY 432


>gi|291287323|ref|YP_003504139.1| dihydroorotase, multifunctional complex type [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290884483|gb|ADD68183.1| dihydroorotase, multifunctional complex type [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 424

 Score =  226 bits (575), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 141/426 (33%), Positives = 225/426 (52%), Gaps = 8/426 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           +L N +I++  + I+  G I+++  II  A  +A +++     +  DC G   +PGIID 
Sbjct: 4   LLKNCKIVNHDKTIE--GNILIDGEII--ASLEASDSEKADKVI--DCKGHYTIPGIIDM 57

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V L     EY ++I + S  AVAGG+T I  M    S   D     K+ +++ +   + 
Sbjct: 58  HVHLRDPGFEYKEDIASGSHAAVAGGVTGICPMA-NTSPINDNNAITKFMIDKGKECGIC 116

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           +++P   +T  M G+E++EM  + E G + F    + +   +V   + +YA    + V  
Sbjct: 117 DIFPIGAMTKRMAGEELTEMGDMTEAGAIGFSDDGLPVASAEVFRRAAEYASQFGSFVIS 176

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D  L   GVIN+G IA   GL  IP+ SE V +ARD+L+A+ TG H H   IS   +
Sbjct: 177 HAEDKSLTGAGVINDGEIATITGLRSIPAESEEVMVARDILMAKLTGAHVHICHISSKGT 236

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + LI+ AKA     TC ++ ++  L E ++  Y++  K+ PPLRS+ +  +M++ L+KGD
Sbjct: 237 LELIRWAKAQGINVTCEVTPHHFTLTERELLSYDTNYKMNPPLRSDADVEAMLDGLKKGD 296

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID IV+DH P H+D K + F  A FG IGL+T+L  +L+L     +S+  L+R +S  PA
Sbjct: 297 IDCIVTDHAPHHIDEKKVEFDLAMFGIIGLQTLLPLSLKLVERNIMSMNDLVRVMSYNPA 356

Query: 365 Q-IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           + I     G +  G  ADI +ID N ++        S   NT F  +   G  + T  +G
Sbjct: 357 KLIRKTDRGEIAEGKRADIVIIDENKEYVFDEKMNKSKSMNTPFLGKTLKGAALYTIKNG 416

Query: 424 KQVYTL 429
             V+  
Sbjct: 417 NVVFEF 422


>gi|116873272|ref|YP_850053.1| dihydroorotase [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|123461217|sp|A0AJU2|PYRC_LISW6 RecName: Full=Dihydroorotase; Short=DHOase
 gi|116742150|emb|CAK21274.1| dihydroorotase [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 426

 Score =  226 bits (575), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 140/425 (32%), Positives = 227/425 (53%), Gaps = 7/425 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N +I++ S ++ E   ++++NG +    AD++     TS    D TG +  PG ID
Sbjct: 2   YVLKNGQILNESGEL-ENKDVLIQNGKVNLI-ADSIEV---TSGEEFDATGKLIAPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T +K A  GG T+I  MP       D    ++    +I+  + 
Sbjct: 57  VHVHLREPGGEHKETILTGTKAAARGGYTTICSMP-NTKPVPDSKEVMERLQAKIKETAE 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +   L+E G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDFEALKEAGAFAFTDDGVGVQLAGTMYEAMKRAAALDMAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++GI A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGIFAEREGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E  +   +   K+ PPLRS+ +R +++E L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEAIPGNDGQWKMNPPLRSKADRAALLEGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F    + +LK+LI  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEQAAFGIVGLETAFPLLYTHFVQTNEWTLKQLIDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ F LP G L+ GT ADI ++DL  + T+  D   S  KNT F  E   G  V T++ 
Sbjct: 356 PAECFKLPYGKLEEGTTADIVVLDLEKEATIDPDTFYSKGKNTPFVGETCIGWPVATFVE 415

Query: 423 GKQVY 427
           G  VY
Sbjct: 416 GTLVY 420


>gi|221201081|ref|ZP_03574121.1| dihydroorotase, multifunctional complex type [Burkholderia
           multivorans CGD2M]
 gi|221206467|ref|ZP_03579480.1| dihydroorotase, multifunctional complex type [Burkholderia
           multivorans CGD2]
 gi|221173776|gb|EEE06210.1| dihydroorotase, multifunctional complex type [Burkholderia
           multivorans CGD2]
 gi|221178931|gb|EEE11338.1| dihydroorotase, multifunctional complex type [Burkholderia
           multivorans CGD2M]
          Length = 428

 Score =  226 bits (575), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 140/420 (33%), Positives = 219/420 (52%), Gaps = 7/420 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILA-AGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLT 69
           +IDP    +    + + +G I A A A    A F     I D TGL+  PG++D    L 
Sbjct: 10  LIDPVAGSERQADVFISDGKIDAIAEAGRAPAGFAADKTI-DATGLIVAPGLVDLCARLR 68

Query: 70  GSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVY 127
               E+   + +    AVAGG+T+++  P      LDE   ++  + + R ++L   NV+
Sbjct: 69  EPGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQANVH 125

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   
Sbjct: 126 PLGALTVGLKGEVITEMVALTESGCVGFTHANVPLRDTQVLLRALQYASTYGYTTWLRPL 185

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL
Sbjct: 186 DAFIGKGGVAASGPVASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLAL 245

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           ++ AKA     TC + +N+L L + D+  ++S  ++ PPLRSE +R ++  AL  G ID 
Sbjct: 246 VRAAKAEGLPVTCDVGVNHLHLIDVDIGYFDSQFRLDPPLRSERDREAIRAALADGTIDA 305

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I SDHTP   D KLLPF EA+ G+ GLE +LS  ++     +  L + +R +++ PA + 
Sbjct: 306 ICSDHTPVDDDEKLLPFGEATPGATGLELLLSLTVKWADETRTPLAQALRRITSAPADVL 365

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           NLP G L  G+AAD+ + D    W V+   + S   N+ F        V  T ++G+  +
Sbjct: 366 NLPAGRLTEGSAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPACVRATLVAGQVAF 425


>gi|310821287|ref|YP_003953645.1| dihydroorotase, multifunctional complex type [Stigmatella
           aurantiaca DW4/3-1]
 gi|309394359|gb|ADO71818.1| Dihydroorotase, multifunctional complex type [Stigmatella
           aurantiaca DW4/3-1]
          Length = 433

 Score =  225 bits (574), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 131/424 (30%), Positives = 220/424 (51%), Gaps = 6/424 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           + +  R+IDP   +D V  ++V +G+I       L+      A + +  G   +PG ID 
Sbjct: 6   LFSRGRVIDPRNYVDSVRDVLVRDGVIAEVSEAPLSVP---GAQVVEAQGHWVLPGFIDL 62

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFI-KYALEEIRVKSL 123
            V L    +E  + I T  + AVAGG T ++ MP   +  +++ + + +  L   R  +L
Sbjct: 63  HVHLREPGEEGKETILTGCQAAVAGGFTGVVAMP--NTKLVNDSSLVTELVLSRARAANL 120

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
            +VYP   +T  ++G+E++EM  L   G V        + +  ++  +++YA + +  V 
Sbjct: 121 CHVYPAGAITKGLKGEEMAEMGELVSAGCVCITDDGRPVMNAGLMRRALQYARLFDLPVM 180

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           +   D  L  +G + EG  A  LGL+ IP  +E   +ARDL++ + TGG  H + +S   
Sbjct: 181 VHEEDLTLSGKGAMTEGPTATRLGLLPIPPSAEVAMVARDLVLLEETGGRLHIAHVSCEG 240

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ L++ AK      T  ++ ++  L++  V  Y++  K+ PPLR   +  ++ EAL  G
Sbjct: 241 SVRLLREAKRRGLHVTSEVTPHHFTLDDAAVGEYDTHAKMNPPLRLRRDVEALREALADG 300

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            I+ I +DH P  +  K + F +   G +GLET L   L L H   +S ++ +  L+  P
Sbjct: 301 TIEAIATDHAPHGVLDKQVEFDKGINGVVGLETALGLTLALVHEGVLSARRAVEVLTDGP 360

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+ F LPGG L+ G  ADIAL+D   +WTV A    S  +NT F      G+VV+T++ G
Sbjct: 361 AKAFGLPGGHLKPGAPADIALVDPEAKWTVDAGRFFSKSRNTPFHGRSLKGRVVQTWVGG 420

Query: 424 KQVY 427
           + V+
Sbjct: 421 RCVF 424


>gi|115380674|ref|ZP_01467599.1| dihydroorotase [Stigmatella aurantiaca DW4/3-1]
 gi|115362321|gb|EAU61631.1| dihydroorotase [Stigmatella aurantiaca DW4/3-1]
          Length = 433

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 131/424 (30%), Positives = 220/424 (51%), Gaps = 6/424 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           + +  R+IDP   +D V  ++V +G+I       L+      A + +  G   +PG ID 
Sbjct: 8   LFSRGRVIDPRNYVDSVRDVLVRDGVIAEVSEAPLSVP---GAQVVEAQGHWVLPGFIDL 64

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFI-KYALEEIRVKSL 123
            V L    +E  + I T  + AVAGG T ++ MP   +  +++ + + +  L   R  +L
Sbjct: 65  HVHLREPGEEGKETILTGCQAAVAGGFTGVVAMP--NTKLVNDSSLVTELVLSRARAANL 122

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
            +VYP   +T  ++G+E++EM  L   G V        + +  ++  +++YA + +  V 
Sbjct: 123 CHVYPAGAITKGLKGEEMAEMGELVSAGCVCITDDGRPVMNAGLMRRALQYARLFDLPVM 182

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           +   D  L  +G + EG  A  LGL+ IP  +E   +ARDL++ + TGG  H + +S   
Sbjct: 183 VHEEDLTLSGKGAMTEGPTATRLGLLPIPPSAEVAMVARDLVLLEETGGRLHIAHVSCEG 242

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ L++ AK      T  ++ ++  L++  V  Y++  K+ PPLR   +  ++ EAL  G
Sbjct: 243 SVRLLREAKRRGLHVTSEVTPHHFTLDDAAVGEYDTHAKMNPPLRLRRDVEALREALADG 302

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            I+ I +DH P  +  K + F +   G +GLET L   L L H   +S ++ +  L+  P
Sbjct: 303 TIEAIATDHAPHGVLDKQVEFDKGINGVVGLETALGLTLALVHEGVLSARRAVEVLTDGP 362

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+ F LPGG L+ G  ADIAL+D   +WTV A    S  +NT F      G+VV+T++ G
Sbjct: 363 AKAFGLPGGHLKPGAPADIALVDPEAKWTVDAGRFFSKSRNTPFHGRSLKGRVVQTWVGG 422

Query: 424 KQVY 427
           + V+
Sbjct: 423 RCVF 426


>gi|152981059|ref|YP_001354636.1| dihydroorotase, multifunctional complex type [Janthinobacterium sp.
           Marseille]
 gi|151281136|gb|ABR89546.1| dihydroorotase, multifunctional complex type [Janthinobacterium sp.
           Marseille]
          Length = 427

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 150/427 (35%), Positives = 230/427 (53%), Gaps = 19/427 (4%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFP---TSALIHDCTGLVAVPGII 62
           + N  ++DP+  ID       +  + +AAG  A   K P   T++ + D +GL+  PG++
Sbjct: 5   IKNGHLVDPANGID------AQQDVYIAAGKIAGIGKAPEGFTASKVIDASGLIVAPGLV 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E+   + +  + AV GG+TS++  P      LDE   ++  + + R KS
Sbjct: 59  DLSARLREPGYEHKATLESEMQAAVQGGVTSLVCPP-DTEPVLDEPGLVE--MLKHRAKS 115

Query: 123 L--INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           L   +VYP   LT+ ++G+ ++EM  L E G + F Q+   I DT VLL +M+YA     
Sbjct: 116 LNQAHVYPLGALTAGLKGESLTEMAELSEAGCIGFSQADNPILDTTVLLRAMQYAKTFEY 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V L   D  LG  GV + G +A+ LGL G+P ++ETV L   L + + TG   H   +S
Sbjct: 176 TVWLRPQDPHLGRTGVAHSGPVASRLGLSGVPVMAETVALHTILELVRVTGTRVHLCRMS 235

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
               + L++ AK      +C +  +++ L END+  ++S  ++ PPLRS+ +R ++  AL
Sbjct: 236 TAAGLELVRAAKKEGLPVSCDVGAHHVHLTENDIGFFDSNARLTPPLRSQRDRDAIRNAL 295

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR----LFHGQQISLKKLI 356
             G ID I SDHTP   D KLLPF EAS G+ GLE +LS AL+       G+Q  + + +
Sbjct: 296 LDGTIDAICSDHTPVDDDEKLLPFGEASPGATGLELLLSLALKWAEDCVDGKQ-QVARAV 354

Query: 357 RALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
             ++T  A+I  LP G L  G+ ADI L D N +WTV A  ++S  K+T F      G+V
Sbjct: 355 AKVTTDAARIVGLPSGQLSVGSVADICLFDPNERWTVAAKVLASQGKHTPFLGYELAGQV 414

Query: 417 VRTYISG 423
             T ++G
Sbjct: 415 KTTIVAG 421


>gi|167570972|ref|ZP_02363846.1| dihydroorotase [Burkholderia oklahomensis C6786]
          Length = 425

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 139/419 (33%), Positives = 215/419 (51%), Gaps = 8/419 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+   +    + V  G + A G     A F  +  I D TG++  PG +D    L  
Sbjct: 10  LIDPAAGTERQADVFVAAGKVAAIGT--APADFNAAKTI-DATGMIVAPGFVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYP 128
              E+   + +    AVAGG+TS++  P      LDE   ++  + + R  +L   +VYP
Sbjct: 67  PGYEHKATLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVE--MLKFRAHNLHQAHVYP 123

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  ++G+ I+EM  L E G + F Q+   + DTQVLL +++YA      V L   D
Sbjct: 124 LGALTVGLKGQTITEMVELTEAGCIGFTQADSPVADTQVLLRALQYASTYGYTVWLRPVD 183

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
            FL   GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL+
Sbjct: 184 AFLAKGGVAASGPVASRLGLSGVPVAAETIALHTLFELMRVTGSRVHVARLSSAAGVALV 243

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     TC +  N+L L + D+  +++  ++ PPLR+E +R ++  AL  G ID I
Sbjct: 244 RAAKAEGLPVTCDVGANHLHLIDVDIGYFDAQFRLDPPLRTERDREAIRAALADGTIDAI 303

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            SDHTP   D KLLPFAEA+ GS GLE +LS  ++      + L + +  +S+ PA +  
Sbjct: 304 CSDHTPVDDDEKLLPFAEATPGSTGLELLLSLTVKWAREAGVPLVRALAKISSAPAGVLQ 363

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           LP G +  G  AD+ + D N  W V+   + S   NT F       +V  T ++G+  +
Sbjct: 364 LPAGRVDEGAPADLCVFDPNAHWRVEPRVLKSQGHNTPFLGYELPAQVCATLVAGQVAF 422


>gi|303231614|ref|ZP_07318338.1| putative dihydroorotase [Veillonella atypica ACS-049-V-Sch6]
 gi|302513731|gb|EFL55749.1| putative dihydroorotase [Veillonella atypica ACS-049-V-Sch6]
          Length = 428

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 123/422 (29%), Positives = 228/422 (54%), Gaps = 6/422 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S ++ N  +++P++   EV  ++V++G I A G + L+A     A ++D TGL+  PG+I
Sbjct: 2   SLLIKNGTVVNPAKQQHEVADVLVKDGKIAAIGQN-LSAD---GAEVYDATGLIVAPGLI 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E  ++  + ++ A AGG T ++ M    +  +D    ++   ++  +  
Sbjct: 58  DIHTHLREPGQEAKEDFHSGTQAAAAGGFTRVVTMA-NTTPVVDNAALVRGLKKQAELTG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++ V     ++ N+EGKE++E+  + E G+V++      +     +  +++Y+ M N +V
Sbjct: 117 VVKVEFIGAVSKNLEGKELAELGDMAEAGVVAYSDDGHYVESAAFMRRALEYSSMFNKMV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G ++EG ++  +G++G P+++E + +ARD+L+A+ TGGH H + +S  
Sbjct: 177 IDHAEDISLTKNGHMHEGFVSYEMGVIGRPAVAEDLAVARDILLAEMTGGHIHIAHVSSK 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++ +++ AKA     TC ++  +L   +  +  YN   K+ PP+RSE  R +++E L+ 
Sbjct: 237 NTVDMVRRAKAKGVNVTCEVTSQHLSFTDEYLREYNPAFKMAPPIRSEDHRQALLEGLKD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHG-QQISLKKLIRALST 361
           G ID I++DH P   + K   F  A  G  GLET L+  +   +G  ++S+ +++  +ST
Sbjct: 297 GTIDAIITDHAPHAFEEKDHEFCCAPNGFSGLETSLAGVITNAYGPDKLSIDQVVYYMST 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           RPA++ +L  G L+ G  ADI +     QWTV  +   +  K + FD    TGK   T +
Sbjct: 357 RPAELMHLDAGVLEVGKPADITVFSTTEQWTVDRNKFYTKGKVSPFDGMIVTGKAKLTVV 416

Query: 422 SG 423
            G
Sbjct: 417 DG 418


>gi|303230168|ref|ZP_07316936.1| amidohydrolase family protein [Veillonella atypica ACS-134-V-Col7a]
 gi|302515094|gb|EFL57068.1| amidohydrolase family protein [Veillonella atypica ACS-134-V-Col7a]
          Length = 428

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 123/422 (29%), Positives = 228/422 (54%), Gaps = 6/422 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S ++ N  +++P++   EV  ++V++G I A G + L+A     A ++D TGL+  PG+I
Sbjct: 2   SLLIKNGTVVNPAKQQHEVADVLVKDGRIAAIGQN-LSAD---GAEVYDATGLIVAPGLI 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E  ++  + ++ A AGG T ++ M    +  +D    ++   ++  +  
Sbjct: 58  DIHTHLREPGQEAKEDFHSGTQAAAAGGFTRVVTMA-NTTPVVDNAALVRGLKKQAELTG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++ V     ++ N+EGKE++E+  + E G+V++      +     +  +++Y+ M N +V
Sbjct: 117 VVKVEFIGAVSKNLEGKELAELGDMAEAGVVAYSDDGHYVESAAFMRRALEYSSMFNKMV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G ++EG ++  +G++G P+++E + +ARD+L+A+ TGGH H + +S  
Sbjct: 177 IDHAEDISLTKNGHMHEGFVSYEMGVIGRPAVAEDLAVARDILLAEMTGGHIHIAHVSSK 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++ +++ AKA     TC ++  +L   +  +  YN   K+ PP+RSE  R +++E L+ 
Sbjct: 237 NTVDMVRRAKAKGVNVTCEVTSQHLSFTDEYLREYNPAFKMAPPIRSEDHRQALLEGLKD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHG-QQISLKKLIRALST 361
           G ID I++DH P   + K   F  A  G  GLET L+  +   +G  ++S+ +++  +ST
Sbjct: 297 GTIDAIITDHAPHAFEEKDHEFCCAPNGFSGLETSLAGVITNAYGPDKLSIDQVVYYMST 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           RPA++ +L  G L+ G  ADI +     QWTV  +   +  K + FD    TGK   T +
Sbjct: 357 RPAELMHLDAGVLEVGKPADITVFSTTEQWTVDRNKFYTKGKVSPFDGMIVTGKAKLTVV 416

Query: 422 SG 423
            G
Sbjct: 417 DG 418


>gi|167563833|ref|ZP_02356749.1| dihydroorotase [Burkholderia oklahomensis EO147]
          Length = 425

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 140/419 (33%), Positives = 215/419 (51%), Gaps = 8/419 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+   +    + V  G + A G     A F  +  I D TG++  PG +D    L  
Sbjct: 10  LIDPAAGTERQADVFVAAGKVAAIGT--APADFNAAKTI-DATGMIVAPGFVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYP 128
              E+   + +    AVAGG+TS++  P      LDE   ++  + + R  +L   +VYP
Sbjct: 67  PGYEHKATLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVE--MLKFRAHNLHQAHVYP 123

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  ++G+ I+EM  L E G + F Q+   + DTQVLL +++YA      V L   D
Sbjct: 124 LGALTVGLKGQIITEMVELTEAGCIGFTQADSPVADTQVLLRALQYASTYGYTVWLRPVD 183

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
            FL   GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    IAL+
Sbjct: 184 AFLAKGGVAASGPVASRLGLSGVPVAAETIALHTLFELMRVTGSRVHVARLSSAAGIALV 243

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     TC +  N+L L + D+  +++  ++ PPLR+E +R ++  AL  G ID I
Sbjct: 244 RAAKAEGLPVTCDVGANHLHLIDVDIGYFDAQFRLDPPLRTERDREAIRAALADGTIDAI 303

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            SDHTP   D KLLPFAEA+ GS GLE +LS  ++      + L + +  +S+ PA +  
Sbjct: 304 CSDHTPVDDDEKLLPFAEATPGSTGLELLLSLTVKWAREAGVPLVRALAKISSAPAGVLQ 363

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           LP G +  G  AD+ + D N  W V+   + S   NT F       +V  T ++G+  +
Sbjct: 364 LPAGRVDEGAPADLCVFDPNAHWRVEPRVLKSQGHNTPFLGYELPAQVCATLVAGQVAF 422


>gi|116624589|ref|YP_826745.1| dihydroorotase [Candidatus Solibacter usitatus Ellin6076]
 gi|122252827|sp|Q01V55|PYRC_SOLUE RecName: Full=Dihydroorotase; Short=DHOase
 gi|116227751|gb|ABJ86460.1| dihydroorotase [Candidatus Solibacter usitatus Ellin6076]
          Length = 430

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 132/428 (30%), Positives = 220/428 (51%), Gaps = 6/428 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V+ N R+IDP+ + D V  + + +G I     +  + K    A + D TG++  PG ID 
Sbjct: 4   VIRNGRVIDPASNTDRVADVFIVDGRIAGVAPNLSSPK----AEVFDATGMIVAPGFIDM 59

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V L     E+++ I + S+ A AGG TSI  MP       D      Y +E+ R K+ +
Sbjct: 60  HVHLREPGFEHAETIESGSRAAAAGGFTSICCMP-NTKPVNDSAMVTSYIVEQARSKAAV 118

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           NV+P   +T    G+E++ +  ++  G V+     + + + +V+  +M++A   +  +  
Sbjct: 119 NVFPIGAITKGSAGEELAAIGAMKAAGAVAISDDGLPVMNARVMRRAMEFARSYDLPIIQ 178

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D  L + G ++EG  +   GL GIP+ SE V +ARDL++AQ TG  YH + IS   +
Sbjct: 179 HCEDLNLSAGGDMHEGANSVRWGLRGIPAASEDVMVARDLVLAQLTGARYHVAHISTRNA 238

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           +A++++ ++H    TC  + ++  L + D+  Y+S  K+ PPLRS   R +++E L  G 
Sbjct: 239 VAMVEYGRSHGLPVTCETTPHHFGLADADMAPYDSNYKMKPPLRSCGHRDAIIEGLIAGT 298

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRP 363
           I  I +DH P     K+  F    FG IGLET L+ AL  L    +I+L +LI   +T P
Sbjct: 299 ISAIATDHAPHPGSEKMQEFERCPFGIIGLETALALALEELVAPGKITLARLIELFTTGP 358

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
             +  L  GTL  G   D+ +     +WT   +  +S  +N+ F    F G  + T ++G
Sbjct: 359 ESVMRLGRGTLTPGAPGDVTVFSPTVEWTYDVNQSASRSRNSPFHARTFHGGPMATIVNG 418

Query: 424 KQVYTLES 431
              ++ +S
Sbjct: 419 GLKWSRQS 426


>gi|57234049|ref|YP_181913.1| dihydroorotase [Dehalococcoides ethenogenes 195]
 gi|57224497|gb|AAW39554.1| dihydroorotase, multifunctional complex type [Dehalococcoides
           ethenogenes 195]
          Length = 427

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 139/431 (32%), Positives = 220/431 (51%), Gaps = 15/431 (3%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSAL--IHDCTGLVAVPGI 61
            ++ N RIIDP+   D+V  +++ENG++       +N+  P+     + D  G V  PG 
Sbjct: 3   ILIKNGRIIDPAGGTDKVADLLLENGLVAG-----INSNIPSDKADEVIDAEGKVVCPGF 57

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           ID  V L     E  + I +  K A AGG T+I  MP   +   D    I +        
Sbjct: 58  IDLHVHLREPGFEGKETIESGCKAAAAGGFTTICPMP-NTNPAADNLPVIDFVRNTAAKV 116

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           S I V P A +T   +G+E+S M  L E G+  F      + ++ +LL+++ Y+      
Sbjct: 117 SPIRVLPIAAITKGRKGQELSPMGELAEAGVAGFSDDGDYVSNSSMLLHALLYSRTFGLP 176

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V     +  L   GV+NEG++A  LGL GIP  +E + L+RD+ +A+ +GG  H   IS 
Sbjct: 177 VMEHCEEPCLAEGGVMNEGLLACRLGLKGIPDAAEEIALSRDIALAKESGGQLHLCHIST 236

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
             S+ L++ AKA   + +  ++ ++L L E +V  YN+  KV PPLR++++  ++++ L+
Sbjct: 237 AGSVELVRRAKAAGIQVSAEVTPHHLTLTEAEVSGYNTNAKVNPPLRTQSDIEALIKGLK 296

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID I +DH P   + KL  F  A+ G  GLET  ++ + L H   ISL  LI  L+ 
Sbjct: 297 DGTIDAIATDHAPHTANDKLCEFGLAANGISGLETAFASLMGLVHSGSISLSLLIEKLTA 356

Query: 362 RPAQIF-----NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
            P Q+      N+  G L+ G++AD+ + D + +WTV      S  KNT  +     G+V
Sbjct: 357 GPRQVLGEKHKNI--GNLKPGSSADVVIFDPDEEWTVDTARFFSKGKNTPLEGRRLKGRV 414

Query: 417 VRTYISGKQVY 427
             T   G+  Y
Sbjct: 415 KTTIACGRIAY 425


>gi|260654635|ref|ZP_05860125.1| dihydroorotase, multifunctional complex type [Jonquetella anthropi
           E3_33 E1]
 gi|260630651|gb|EEX48845.1| dihydroorotase, multifunctional complex type [Jonquetella anthropi
           E3_33 E1]
          Length = 437

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 130/424 (30%), Positives = 217/424 (51%), Gaps = 11/424 (2%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH---DCTGLVAVPGIIDA 64
           N R++DPS+ +D  GA++ E+G+IL +G+     + P     H   DC G V  PG+ID 
Sbjct: 7   NCRLVDPSQGLDGPGALLAEDGVILWSGS-----QIPEGTEAHRTIDCGGCVLAPGLIDL 61

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V        + + + T  + A AGG T+++ M    +  +D    +++ L+  +     
Sbjct: 62  HVHFREPGQTHKETLATGCQAAAAGGYTAVVTM-ANTTPPIDSSEMVRWTLQNAQPLD-C 119

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
            ++P A +T  M+G+E+++ R L E G        + +    V   + K A  L   V++
Sbjct: 120 RIFPAAAVTRGMKGQELTDFRALAEAGASCLTDDGLMVARNDVAFAAFKEAAALGLAVSI 179

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
                 LG    +N+G ++   GL G+P   E   +ARD+++A+  G H H   +S  + 
Sbjct: 180 HPETPGLGGDRSVNQGDVSRRFGLEGVPPAGEETGIARDIVLAEAAGAHLHVQHVSTARG 239

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           +ALI  AK+     T   + +++ L E+ V    +  K+ PPLR+E +R+++   L  G 
Sbjct: 240 VALIAWAKSRGAHVTAEATPHHISLTEDRVLRCGANAKMSPPLRTEADRLAVETGLLDGT 299

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRP 363
           +D+I +DH P   + K    A+A  G +GLET L+  L  L    + SL  LI  +S RP
Sbjct: 300 LDVIATDHAPHSPEEKAQGLAKAPNGIVGLETALAVCLTELSASPRFSLPLLIDRMSCRP 359

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A +  LPGGTL++G+ AD+ + D   +WTV A    S  +NT +D E   G+V  T + G
Sbjct: 360 AAVLGLPGGTLKSGSPADLVVFDPKERWTVDASRFRSKGRNTPWDGETLIGRVKLTVLGG 419

Query: 424 KQVY 427
           +  +
Sbjct: 420 RFTW 423


>gi|171322536|ref|ZP_02911326.1| dihydroorotase, multifunctional complex type [Burkholderia
           ambifaria MEX-5]
 gi|171092129|gb|EDT37540.1| dihydroorotase, multifunctional complex type [Burkholderia
           ambifaria MEX-5]
          Length = 425

 Score =  224 bits (570), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 137/419 (32%), Positives = 216/419 (51%), Gaps = 8/419 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP    +    + V +G I A G   + A F     I D +GL+  PG++D    L  
Sbjct: 10  LIDPVAGTERQADVFVADGKIAALGT--VPAGFNAEKTI-DASGLIVAPGLVDLCARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYP 128
              E+   + +    AVAGG+T+++  P      LDE   ++  + + R ++L   NV+P
Sbjct: 67  PGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQANVHP 123

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   D
Sbjct: 124 LGALTVGLKGEVITEMVALTESGCVGFTHANVPVRDTQVLLRALQYASTYGYTTWLRPLD 183

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
            F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL+
Sbjct: 184 AFIGRGGVAASGALASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLALV 243

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     TC + +N+L L + D+  ++S  ++ PPLR E +R ++  AL  G ID+I
Sbjct: 244 REAKAEGLPVTCDVGVNHLHLIDIDIGYFDSQFRLDPPLRGERDREAIRAALADGTIDVI 303

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            SDHTP   D KLLPFAEA+ G+ GLE +LS  ++        L + +R ++  PA +  
Sbjct: 304 CSDHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWADETNTPLAQALRRITAAPADVLQ 363

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           LP G +  G AAD+ + D    W V+   + S   N+ F        V  T ++G+  +
Sbjct: 364 LPAGRVAEGAAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPACVRATLVAGQVAF 422


>gi|294012697|ref|YP_003546157.1| dihydroorotase [Sphingobium japonicum UT26S]
 gi|292676027|dbj|BAI97545.1| dihydroorotase [Sphingobium japonicum UT26S]
          Length = 407

 Score =  224 bits (570), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 141/423 (33%), Positives = 211/423 (49%), Gaps = 19/423 (4%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT   + N ++ DPS      G I++E+  ILA+G    +   P  A   D  GLV  PG
Sbjct: 1   MTRLAIANGKLADPSGKDLTPGVILIEDDRILASG----DVAIPPDAETIDANGLVVAPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +ID  V  T  P  +             GGIT   LMP   SS LD+   I+ A      
Sbjct: 57  LIDLGVFATDKPAFHF------------GGITRAALMP-DQSSPLDDAGLIRQATRA--G 101

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           K    V+P A  T  ++G E++E+ ++Q  G  +       I D+ V++  + YA  L  
Sbjct: 102 KPDFWVHPIAAATRGLKGAELAEIGMMQAAGAKAVGTGRQWIADSGVMMRVLSYASGLGL 161

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V     D  L  + V   G  A  LGL   P+ +E + +ARD+++A+ TG   H  +++
Sbjct: 162 TVITHAEDAGLAGKAVATSGETATRLGLPHAPACAEAMAIARDIMLARATGAAIHFRLVT 221

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
                 LI+ AKA   K TCGIS   L L++N V  + +  ++ PPLRSE +R + + A+
Sbjct: 222 TRAGFDLIRAAKAEGLKVTCGISPAYLFLSDNAVTDFRTFARLSPPLRSEDDRKASIAAV 281

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G +D+I S H PR  + K LPFA+A+ G  G ET+L+ +L L     ++L +L+  LS
Sbjct: 282 ADGTVDVITSSHDPRGPEDKRLPFADAAPGMAGAETLLALSLNLVRDGHVTLNRLMTLLS 341

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+I  +  G    G+AAD+  ID +  W V +  M++   NT FD+    G+V R  
Sbjct: 342 ANPARILGVDAGGFAPGSAADLIFIDPDAPWIVDSGKMAAQAGNTPFDRMPVQGRVRRIM 401

Query: 421 ISG 423
             G
Sbjct: 402 KGG 404


>gi|327398678|ref|YP_004339547.1| dihydroorotase, multifunctional complex type [Hippea maritima DSM
           10411]
 gi|327181307|gb|AEA33488.1| dihydroorotase, multifunctional complex type [Hippea maritima DSM
           10411]
          Length = 426

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 140/427 (32%), Positives = 221/427 (51%), Gaps = 6/427 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V+ N  +I PS D +    + + +G+I   G D             D TGLV  PG +D 
Sbjct: 4   VIRNGYVIAPSNDFEGFADVSIVDGVIEMVG-DVEGVSIDEEI---DATGLVVAPGFVDI 59

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
              L      Y + I T  + AV GG T+I  MP   +  +D    ++Y   +     + 
Sbjct: 60  HAHLRDPGFTYKETIETGMRAAVKGGFTAICCMP-NTNPTIDNIQTVEYIKSKAANVGIC 118

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           +VYP   +T   +G+E+++M  L+E G V+F      + + +VL  ++ YA  LN  + L
Sbjct: 119 DVYPIGTITKGEKGEELTDMMSLKEAGCVAFSDDGRPVMNAEVLRKALIYAEDLNVPLTL 178

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D  +   GV+NEG IA  LGL GIP++SE+  +ARD+ IA+ T  H H   +S  +S
Sbjct: 179 HEEDLNISGDGVVNEGKIAFELGLKGIPNVSESSIIARDVEIAKSTNTHLHICHVSTKES 238

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           I ++K AK  + + T  ++ ++L L + +++ YN+  KV PPLRS+ +  ++  A   G 
Sbjct: 239 IDVLKKAKMDSGRITFEVTPHHLSLTDEEIKDYNTFAKVNPPLRSKEDVKAVHGAFSLGL 298

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAA-LRLFHGQQISLKKLIRALSTRP 363
           +D I +DH P   D+K      A+FG  G ET  +     L     +SL   I  ++ +P
Sbjct: 299 VDAIATDHAPHDEDSKRCTIQNAAFGISGFETAFAVVNTYLVETGVVSLADAIALMTVKP 358

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+IF+L  GTL  G++A+I LID N +W V  +   S  KNT +  +   G +V+T+  G
Sbjct: 359 ARIFHLDTGTLNEGSSANIVLIDKNREWVVDRNKFVSKGKNTPYHDKKLKGAIVKTFYKG 418

Query: 424 KQVYTLE 430
             VY+ E
Sbjct: 419 MIVYSEE 425


>gi|257095141|ref|YP_003168782.1| dihydroorotase [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257047665|gb|ACV36853.1| dihydroorotase, multifunctional complex type [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 418

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 147/422 (34%), Positives = 218/422 (51%), Gaps = 13/422 (3%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           + N R+IDP+  +D+   + V +G I A G     A F     I D +GL+  PG++D  
Sbjct: 8   IRNGRLIDPAGGLDQQIDLFVADGRIAAIGQPP--AGFSADRQI-DASGLIVCPGLVDLS 64

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L G   E         K AVAGG+TS+   P      LDE   ++  +       L  
Sbjct: 65  ARLGGIESEL--------KAAVAGGVTSLACPP-DTKPPLDEAGLVERLVRRSETLGLAR 115

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  + G++++EM  L   G ++F Q+   I DTQ+LL +M+YA   +  V L 
Sbjct: 116 VYPIGALTQELAGQKLAEMNGLARAGCIAFSQAKHPIIDTQLLLRAMQYAATFDYAVRLR 175

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             DHFL   GV ++G +A+ LGL GIP  +ETV +A  L +A  TG   H S +S    +
Sbjct: 176 PQDHFLAREGVAHDGEVASRLGLTGIPVSAETVAIATALHLAGETGVRLHLSRLSSGAGV 235

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            LI+ A+      TC +SI++L L+E D+  ++S  +  PPLRS  +R ++  A   G +
Sbjct: 236 DLIRTARQSGVLVTCDVSIHHLHLSETDIGYFDSNSRFDPPLRSAADREALRTAASDG-L 294

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
             I SDHTP   D K LPFAEA  G+ GLE +L   L      ++ L   +  +++ PA 
Sbjct: 295 AAICSDHTPLDADGKQLPFAEALPGASGLELLLPLTLLWATQAKLPLIGALARITSDPAS 354

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I  +  G+L  G+AAD+ + D +  W V  + + S  KNT F      G+V  T + G+ 
Sbjct: 355 ILGIAAGSLSIGSAADVCIFDADEAWHVTPEALRSQGKNTPFLGRDVNGRVRMTLVGGRI 414

Query: 426 VY 427
           V+
Sbjct: 415 VF 416


>gi|134294914|ref|YP_001118649.1| dihydroorotase [Burkholderia vietnamiensis G4]
 gi|134138071|gb|ABO53814.1| dihydroorotase [Burkholderia vietnamiensis G4]
          Length = 425

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 137/417 (32%), Positives = 209/417 (50%), Gaps = 4/417 (0%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           ++DP+   +    + V +G I A G     A F     I D +GL+  PG++D    L  
Sbjct: 10  VVDPAAGTERQADVFVADGKIAALGT--APAGFNADNTI-DASGLIVAPGLVDLCARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    AVAGG+T+++  P      LDE   ++      R     NV+P  
Sbjct: 67  PGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVEMLKFRARNLKQANVHPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   D F
Sbjct: 126 ALTVGLKGEVITEMVALTESGCVGFTHANVPVRDTQVLLRALQYASTYGYTTWLRPQDAF 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           +G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL++ 
Sbjct: 186 IGRGGVAASGALASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLALVRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     TC +S N+L L + D+  ++S  ++ PPLR E +R ++  AL  G ID I S
Sbjct: 246 AKAEGLPVTCDVSANHLHLIDVDIGYFDSQFRLDPPLRGERDREAIRAALADGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP 370
           DHTP   D KLLPFAEA+ G+ GLE +LS  ++        L + +R ++  PA +  LP
Sbjct: 306 DHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWADETNTPLAQALRRITAAPADVLQLP 365

Query: 371 GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            G L  G AAD+ + D    W V+   + S   N+ F        V  T ++G   +
Sbjct: 366 AGRLAEGGAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPACVRATLVAGHVAF 422


>gi|307297141|ref|ZP_07576955.1| amidohydrolase [Sphingobium chlorophenolicum L-1]
 gi|306877445|gb|EFN08675.1| amidohydrolase [Sphingobium chlorophenolicum L-1]
          Length = 407

 Score =  223 bits (569), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 141/424 (33%), Positives = 212/424 (50%), Gaps = 19/424 (4%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT   + N ++ DP+      G I++E+  ILA+G    +   P  A   D  GLV  PG
Sbjct: 1   MTRLAITNGKLADPTGKDLIPGVILIEDDRILASG----DVAIPQDAETIDANGLVVAPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +ID  V  T  P  +             GGIT   LMP   SS LD+   I+ A      
Sbjct: 57  LIDLGVFATDKPAFHF------------GGITRAALMP-DQSSPLDDAGLIRQATRA--G 101

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           K    V+P A  T  ++G E++E+ ++Q  G  +       I D+ V++  + YA  L  
Sbjct: 102 KPDFWVHPIAAATRGLKGAELAEIGMMQAAGAKAVGTGRQWIADSGVMMRVLSYASGLGL 161

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V     D  L  R V   G  A  LGL   P+ +E + +ARD+++A+ TG   H  +++
Sbjct: 162 TVITHAEDSGLAGRAVATSGETATRLGLPHAPACAEAMAIARDIMLARATGAAIHFRLVT 221

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
                 LI+ AKA   K TCGIS   L L++N V  + +  ++ PPLRSE +R + + A+
Sbjct: 222 TKAGFDLIRAAKAEGLKVTCGISPAYLFLSDNAVTDFRTFARLSPPLRSEDDRKASIAAV 281

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G +D+I S H PR  + K LPFA+A+ G  G ET+L+ +L L     +SL +L+  LS
Sbjct: 282 ADGTVDVITSSHDPRGPEDKRLPFADAAPGMAGAETLLALSLNLVRDGHLSLNRLMTLLS 341

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+I  +  G    G+AAD+  ID +  W V ++ M++   NT F +    G+V R  
Sbjct: 342 ANPARILGVDAGGFAPGSAADLIFIDPDAPWIVDSEKMAAQAGNTPFHRAPVQGRVRRIM 401

Query: 421 ISGK 424
             G+
Sbjct: 402 KGGE 405


>gi|167586355|ref|ZP_02378743.1| dihydroorotase [Burkholderia ubonensis Bu]
          Length = 424

 Score =  223 bits (568), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 139/419 (33%), Positives = 215/419 (51%), Gaps = 8/419 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP    +    + V  G I + G     A F  +  I D TG++  PG++D    L  
Sbjct: 10  LIDPVAGTERQADVFVAAGKIASVGT--APADFNAAKTI-DATGMIVAPGLVDLCARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYP 128
              E+   + +    AVAGG+TS++  P      LDE   ++  + + R  +L   NVYP
Sbjct: 67  PGYEHKATLQSEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVE--MLKFRASNLRQANVYP 123

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   D
Sbjct: 124 LGALTVGLKGEVITEMVALTESGCVGFTHANVPVRDTQVLLRALQYASTYGFTTWLRPLD 183

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
            F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL+
Sbjct: 184 AFIGRGGVAASGPLASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLALV 243

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     TC +S N+L L + D+  ++S  ++ PPLRSE +R ++  AL  G ID I
Sbjct: 244 RAAKAEGLPVTCDVSANHLHLIDVDIGYFDSQFRLDPPLRSERDREAIRAALADGTIDAI 303

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            SDHTP   D KLLPF EA+ G+ GLE +LS  ++        L + +R +++ PA +  
Sbjct: 304 CSDHTPVDDDEKLLPFGEATPGATGLELLLSLTVKWADETGTPLAQALRRITSAPADVLK 363

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           LP G +  G AAD+ + D    W V+   + S   N+ F       +V  T ++G+  +
Sbjct: 364 LPAGRVTEGGAADLCVFDPRAHWRVEPRGLKSQGHNSPFLGYELPARVRATLVAGQIAF 422


>gi|300309810|ref|YP_003773902.1| dihydroorotase [Herbaspirillum seropedicae SmR1]
 gi|300072595|gb|ADJ61994.1| dihydroorotase protein [Herbaspirillum seropedicae SmR1]
          Length = 428

 Score =  223 bits (568), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 144/423 (34%), Positives = 222/423 (52%), Gaps = 10/423 (2%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           + N R+IDP+  ID    + V  G I+  G     A F  +  I D TGLV  PG++D  
Sbjct: 5   IKNGRLIDPANGIDAQQDVYVAAGKIVGVGQ--APADFVANKTI-DATGLVVAPGLVDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +  + A+ GG+TS++  P      LDE   ++      R  +  +
Sbjct: 62  ARLREPGYEYKATLESEMQAAIQGGVTSLVCPP-DTDPVLDEPGLVEMLKHRARSLNQAH 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT+ ++GK ++EM  L + G + F Q+   I DT VLL++++YA   N  V L 
Sbjct: 121 VYPLGALTAGLKGKALTEMAELTDAGCIGFSQAEEPITDTTVLLSALQYAKTFNYTVWLR 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D  LG  G+ + G  A+ LGL G+P +SET+ L     + + TG   H   +S    +
Sbjct: 181 PQDPHLGRSGIAHSGPAASRLGLSGVPVMSETIALYTLFELMRATGARVHLCRMSSAAGL 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L++ AK+     TC + ++++ L + D+  ++S  ++ PPLRS+ +R ++  AL  G I
Sbjct: 241 ELVRQAKSEGLPVTCDVGVHHIHLCDLDIGFFDSNARMTPPLRSQRDREAIRTALLDGTI 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-----HGQQISLKKLIRALS 360
           D + SDHTP   D KLLPF EAS G+ GLE +LS +L+        G+++ L K I  ++
Sbjct: 301 DAVCSDHTPVDDDEKLLPFGEASPGATGLELLLSLSLKWALETEGEGKEV-LSKAISKVT 359

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
            R A++  L  G L  G+ AD+ L D N  W V+   ++S  K+T F      G V  T 
Sbjct: 360 HRAAKVAGLKAGNLAVGSVADLCLFDPNAMWKVQGAALASQGKHTPFLGYELPGVVKATI 419

Query: 421 ISG 423
           +SG
Sbjct: 420 VSG 422


>gi|149177848|ref|ZP_01856447.1| dihydroorotase, multifunctional complex type [Planctomyces maris
           DSM 8797]
 gi|148843338|gb|EDL57702.1| dihydroorotase, multifunctional complex type [Planctomyces maris
           DSM 8797]
          Length = 426

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 143/432 (33%), Positives = 229/432 (53%), Gaps = 7/432 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M S ++ N RIIDPS+D+D++G +++ENG I       L     T+    D TGL+  PG
Sbjct: 1   MKSILIKNGRIIDPSQDLDQLGNLLIENGKITG-----LCEATVTADETIDATGLIVSPG 55

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
            ID  V+L     E  + I + +  A+AGG+TS+  +P   S  +D+ +  ++ L +   
Sbjct: 56  FIDIHVSLCEPGFEEDETIESGTAAALAGGVTSLGCLP-NTSPVVDDRSSAEFILLQAER 114

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +  +VYP   +T N EGKE++E+  L     V F  +   I + Q++  +++Y  M + 
Sbjct: 115 AANCHVYPLGAITKNHEGKELAEIGQLVAGKAVGFTDADRPIDNAQIMRCALEYTRMFDR 174

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +        L  +G ++EG  +  LGL GIPS +E + + RD+ +A+ T G  H   IS
Sbjct: 175 PILNRPQVAELTDKGQMHEGFYSTVLGLKGIPSAAEEIMVNRDIALAELTRGRIHLMCIS 234

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S++ I+ AKA   + +  ++ ++L L +  +E Y+   KVLPPLRS+    +++E L
Sbjct: 235 TQNSVSQIRRAKAAGIRVSADVTPHHLTLTDQMLENYDPNFKVLPPLRSQEHIDALIEGL 294

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRAL 359
           + G ID I SDHTP   + K      A FG IGLET+L   L+ L     +S  +LI  L
Sbjct: 295 KDGTIDAICSDHTPHAAEKKTDEILGADFGIIGLETLLPVCLQSLITPGHLSWPELIGKL 354

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           +  PAQI  L  GTL  G  ADI LI+ + ++ ++   + S   NT F  +   G+    
Sbjct: 355 TRGPAQILGLEKGTLAEGADADITLINPDIRYILEPALLKSSSHNTPFLGKELQGRAEVV 414

Query: 420 YISGKQVYTLES 431
            +SG+  +  E+
Sbjct: 415 IVSGEIRFRAEN 426


>gi|114319507|ref|YP_741190.1| dihydroorotase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225901|gb|ABI55700.1| dihydroorotase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 426

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 146/432 (33%), Positives = 219/432 (50%), Gaps = 15/432 (3%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSAL----IHDCTGLV 56
           MT++ +   R++DP+ D DEV  + + +G I A GA       P S      I   TGLV
Sbjct: 1   MTAWSITGARVVDPASDRDEVVDLHIADGRIAALGA-------PPSGWQPEHILQATGLV 53

Query: 57  AVPGIIDARVTLTGSPDEYSK-NITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYAL 115
           A PG+ID     T  P +  K NI + ++ A AGGIT++I  P       D  + ++   
Sbjct: 54  ACPGLIDL-AARTREPGQARKANIASEARAAAAGGITTLICPP-DTRPVTDTPSVVELIR 111

Query: 116 EEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYA 175
                     V P   LT N++G ++SEM  L E G          I D+ VL  +++YA
Sbjct: 112 NRSAAAGGARVLPLGALTRNLDGGQLSEMVALSEAGCPGLSDGGRPIADSLVLRRALEYA 171

Query: 176 HMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYH 235
              +  V L   +  L ++G+ +EG +A  +GL GIP  +ET  L R L +A+  G   H
Sbjct: 172 ATFDLPVHLTPEEPIL-AQGLAHEGQLATRMGLPGIPVAAETAGLGRMLALAEEIGARVH 230

Query: 236 ASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMS 295
              +S  + + LI  A+ +    T   +I+ L L E D+  Y S   V PPLRS  +R +
Sbjct: 231 FGRLSSRRGLELILAAQRNGQPVTADAAIHQLFLTEMDIYGYQSQAHVRPPLRSTGDRDA 290

Query: 296 MVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKL 355
           +  AL  G++ ++ SDH P   D K  PFAE+  G  GL+++L+  LRL     + L + 
Sbjct: 291 LRRALAAGELPVLCSDHQPHDPDAKRCPFAESEPGISGLDSLLALVLRLADELNLPLTRA 350

Query: 356 IRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK 415
           +  +++ PA++ +LPGG L  G  ADI L D +  W  KA DM S  +N+ F    FTG+
Sbjct: 351 LAPVTSGPARVLDLPGGRLTEGAPADICLFDPDEVWWFKASDMHSRGENSPFTGWEFTGR 410

Query: 416 VVRTYISGKQVY 427
              T + G +VY
Sbjct: 411 ARYTIVDGLRVY 422


>gi|313894671|ref|ZP_07828234.1| amidohydrolase family protein [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313440861|gb|EFR59290.1| amidohydrolase family protein [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 429

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 124/423 (29%), Positives = 230/423 (54%), Gaps = 6/423 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S ++ N  +++P++  +EV  ++V++G I A G + L+A     A ++D TGL+  PG+I
Sbjct: 2   SLLIKNGTVVNPAKKQNEVADVLVKDGKIAAIGQN-LSAD---GAEVYDATGLIVAPGLI 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E  ++  + ++ A AGG T ++ M    +  +D    ++    +  +  
Sbjct: 58  DIHTHLREPGQEAKEDFHSGTQAAAAGGFTRVVTMA-NTNPVVDNAMLVRGLQRQAELTG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++ V     ++  +EGKE++E+  + E G+V+F      + +   +  +++Y+ M N +V
Sbjct: 117 VVKVEFIGAVSKGLEGKELAELGDMAEAGVVAFSDDGHYVENAAFMRRALEYSSMFNKMV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G ++EGI++  LG+ G P+++E + +ARD+L+++ TGGH H + +S  
Sbjct: 177 IDHAEDITLTKNGHMHEGIVSYELGVSGRPAVAEDLAVARDILLSEMTGGHIHIAHVSSK 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++ +++ AKA     TC ++  +L   +  +  YN   K+ PP+RSE  R +++E L+ 
Sbjct: 237 NTVDMVRRAKAKGLNVTCEVTSQHLSFTDEYLREYNPAFKMAPPIRSEDHRQALLEGLKD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHG-QQISLKKLIRALST 361
           G ID I++DH P   + K   F  A  G  GLET L+A +   +G  ++S+ +++  +ST
Sbjct: 297 GTIDAIITDHAPHAFEEKDHEFCCAPNGFSGLETSLAAVITNAYGPDKLSIDQVVYNMST 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           RPA++  L  G L+ G  ADI +     +WTV  +   +  K + FD    TGK   T +
Sbjct: 357 RPAELMRLDAGVLEVGKPADITVFSTTEEWTVDRNKFYTKGKVSPFDGMTVTGKAKLTVV 416

Query: 422 SGK 424
           +G+
Sbjct: 417 NGE 419


>gi|300115251|ref|YP_003761826.1| dihydroorotase [Nitrosococcus watsonii C-113]
 gi|299541188|gb|ADJ29505.1| dihydroorotase, multifunctional complex type [Nitrosococcus
           watsonii C-113]
          Length = 429

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 132/423 (31%), Positives = 216/423 (51%), Gaps = 4/423 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           ++   R+IDP   ID +  + +  G ++A G+   + +   +    D    +  PG+ID 
Sbjct: 4   LIRGGRLIDPYNGIDGLQDLYLAEGRVIAIGSAPEDFRVEQTI---DAQDQIVCPGLIDL 60

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
           +  L     E    I T +  A  GGIT++   P  ++  +D    +             
Sbjct: 61  QARLREPGQEQKGTIATETLAAAKGGITTLCCPPDTLA-IIDTPAVVDLIAHREAQYQRT 119

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
            + P   LT  ++G +++EM +LQE G V      M I ++QV+  +M+YA  L   + L
Sbjct: 120 RILPLGALTQGLQGLQLAEMGILQEAGCVGVSNGLMPITNSQVMRQAMEYAATLGITLFL 179

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D +LG  G  +EGI++  LGL GIP  +ETV LARDLL+ + TG   H   +S  ++
Sbjct: 180 YPRDPWLGIEGCCHEGIVSARLGLAGIPETAETVSLARDLLLIEQTGVQAHFCHLSSARA 239

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + +++ A+      +  ++  +L L E+D+  ++S   V+PPLR+  +R ++ E L +G 
Sbjct: 240 VRMVRQAQTEGLPISADVTAYHLHLTEHDIGEFDSQCHVIPPLRTLRDRDALHEGLREGT 299

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
              I SDH P  +D KL  F     G  GLET+L  +LRL     ++L ++I  L+ +PA
Sbjct: 300 FSAICSDHQPHEVDAKLGAFPITEPGISGLETLLPLSLRLTQDDILTLPEVIAYLTCQPA 359

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           Q+  + GG L  G  ADI + D +  W  K ++M+S  KNT F    F G+V  T + G+
Sbjct: 360 QVLGIEGGHLAPGQRADICIFDPHCHWIFKPEEMASQGKNTPFGGWEFQGRVTYTLLEGR 419

Query: 425 QVY 427
            V+
Sbjct: 420 VVF 422


>gi|161525689|ref|YP_001580701.1| dihydroorotase [Burkholderia multivorans ATCC 17616]
 gi|189349589|ref|YP_001945217.1| dihydroorotase [Burkholderia multivorans ATCC 17616]
 gi|160343118|gb|ABX16204.1| dihydroorotase, multifunctional complex type [Burkholderia
           multivorans ATCC 17616]
 gi|189333611|dbj|BAG42681.1| dihydroorotase [Burkholderia multivorans ATCC 17616]
          Length = 428

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 139/420 (33%), Positives = 217/420 (51%), Gaps = 7/420 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILA-AGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLT 69
           +IDP    +    + +  G I A A A    A F     I D TG +  PG++D    L 
Sbjct: 10  LIDPVAGSERQADVFISGGKIDAIAEAGRAPAGFAADKTI-DATGQIVAPGLVDLCARLR 68

Query: 70  GSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVY 127
               E+   + +    AVAGG+T+++  P      LDE   ++  + + R ++L   NV+
Sbjct: 69  EPGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQANVH 125

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   
Sbjct: 126 PLGALTVGLKGEVITEMVALTESGCVGFTHANVPLRDTQVLLRALQYASTYGYTTWLRPL 185

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL
Sbjct: 186 DAFIGKGGVAASGPVASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLAL 245

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           ++ AKA     TC + +N+L L + D+  ++S  ++ PPLRSE +R ++  AL  G ID 
Sbjct: 246 VRAAKAEGLPVTCDVGVNHLHLIDVDIGYFDSQFRLDPPLRSERDREAIRAALADGTIDA 305

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I SDHTP   D KLLPF EA+ G+ GLE +LS  ++     +  L + +R +++ PA + 
Sbjct: 306 ICSDHTPVDDDEKLLPFGEATPGATGLELLLSLTVKWADETRTPLAQALRRITSAPADVL 365

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           NLP G L  G+AAD+ + D    W V+   + S   N+ F        V  T ++G+  +
Sbjct: 366 NLPAGRLTEGSAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPACVRATLVAGQVAF 425


>gi|89895607|ref|YP_519094.1| hypothetical protein DSY2861 [Desulfitobacterium hafniense Y51]
 gi|89335055|dbj|BAE84650.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 434

 Score =  222 bits (566), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 133/434 (30%), Positives = 225/434 (51%), Gaps = 9/434 (2%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH-----DCTGLVAV 58
           + + N +++DP++ +     +++  G +L        A+             D  G    
Sbjct: 2   WWIKNAQVVDPAQGLSGSYDVLIGEGKVLQLKKGLTEAEVKGECGEAEWQEIDAAGNYLF 61

Query: 59  PGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           PG+ID    L     E  ++I + S+ AV GG T+I+ MP   +  LD+   ++Y + + 
Sbjct: 62  PGLIDVHTHLREPGREDKEDIASGSRAAVRGGFTTILAMP-NTTPILDQKALVEYVVNQG 120

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
           +   L  ++P A +T    GKE+ EM  L   G   F      +   +++  +++YA + 
Sbjct: 121 KKVGLAKIHPIAAITKGQAGKELVEMVELAAAGAAGFSDDGRGVQQGEMMRLALEYAKLT 180

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
           +  V     D  L  +GV++ GI++  LGL GIPS SE+V +ARD+L+A+ +GG  H + 
Sbjct: 181 SCPVISHCEDESLAHKGVMHRGIVSTRLGLRGIPSSSESVMVARDILLAEESGGKLHLAH 240

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEM--YNSLRKVLPPLRSETERMSM 296
           IS  +S+ALI+  K      T  ++ ++L+  +  V    Y +  KV PPLR+E +R ++
Sbjct: 241 ISAKESVALIREGKKRGVDVTAEVNPHHLLFTDEAVARTPYGTSYKVNPPLRTEEDRQAL 300

Query: 297 VEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKL 355
           +E L  G +D++ +DH P   + K  PF EA FG  GLET L+A  + L     + ++ L
Sbjct: 301 LEGLLDGTLDMLATDHAPHTWEEKTNPFDEAPFGISGLETALAAVWQELVTTGILPVELL 360

Query: 356 IRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK 415
           I+A S  PAQ F LPGGTL+ G  AD+ L D  +   +  + ++S  KNT F  +   G 
Sbjct: 361 IKAWSMNPAQRFQLPGGTLKVGAPADLILFDPEHTELIDTEYLASKGKNTPFLGQRLQGF 420

Query: 416 VVRTYISGKQVYTL 429
             + ++ G+ V+ +
Sbjct: 421 PSKVWVEGRLVHEI 434


>gi|288817978|ref|YP_003432325.1| dihydroorotase [Hydrogenobacter thermophilus TK-6]
 gi|288787377|dbj|BAI69124.1| dihydroorotase [Hydrogenobacter thermophilus TK-6]
 gi|308751576|gb|ADO45059.1| dihydroorotase, multifunctional complex type [Hydrogenobacter
           thermophilus TK-6]
          Length = 424

 Score =  222 bits (566), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 138/428 (32%), Positives = 222/428 (51%), Gaps = 8/428 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M+  ++   RIIDPS+ +D VG I++E G I   G +     F     I D  GLV  P 
Sbjct: 1   MSKLLIKRGRIIDPSQKLDTVGDILIEKGRIKTVGENL----FELETQIIDAKGLVVCPA 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
            +D    L    + Y ++I + S+ AVAGG T+++ MP      +D     +Y +++ R 
Sbjct: 57  FVDLHAHLRDPGETYKEDIESASRCAVAGGFTTVVCMP-NTKPPVDSPHVAQYIIDKARR 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             L  V P+  LT   EGKE+S+   L++ G ++       + D +++  +++ A  L  
Sbjct: 116 VGLCQVIPSGTLTKGREGKELSDFYALKQAGCLTLTDDGSPLMDARLMQRALELAGQLGL 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     D  L + G INEG +++ LG+   P+ +E + +ARDL+++  TG   H   +S
Sbjct: 176 LVMNHCEDDSL-AYGHINEGYVSSLLGVSSRPAEAEDILVARDLILSYKTGSPIHIQHLS 234

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S+ LI++ K    + +C ++  +L+ +E ++    +  KV PPLR E +R++++EA+
Sbjct: 235 SALSVELIRYFKEKGARVSCEVNPYHLLFSERELLKSGANAKVNPPLRREEDRLALLEAV 294

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
           + G ID I +DH P H   +     +A  G IGL+T L  AL L     ISL ++I  +S
Sbjct: 295 KDGTIDCIATDHAP-HAGWEKGQIEKAKAGMIGLQTALPLALELVRQGHISLMRMIDLMS 353

Query: 361 TRPAQIFNLPG-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
            +PA I  L G  TL+ G+ A+I + D    WT+      S  +NT        GKVV T
Sbjct: 354 CKPASILGLEGCATLKVGSKANITIFDPEKVWTLNESTNLSRSRNTPLWNRELRGKVVYT 413

Query: 420 YISGKQVY 427
              GK VY
Sbjct: 414 IFEGKVVY 421


>gi|125973469|ref|YP_001037379.1| dihydroorotase [Clostridium thermocellum ATCC 27405]
 gi|171769987|sp|A3DE07|PYRC_CLOTH RecName: Full=Dihydroorotase; Short=DHOase
 gi|125713694|gb|ABN52186.1| dihydroorotase [Clostridium thermocellum ATCC 27405]
          Length = 426

 Score =  222 bits (566), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 128/424 (30%), Positives = 223/424 (52%), Gaps = 6/424 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++    ++DP  + + +  I+VE+GII   G D    +     +I+   G + +PG++D
Sbjct: 1   MLIKGGHVVDPKTNTNGIMDILVEDGIITEIGKDI---EISNGDIIY-AEGKLVLPGLVD 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           A   L     EY ++I T +  A  GG TSI  MP       D    +KY + + +    
Sbjct: 57  AHCHLRDPGFEYKEDIETGTMSAAMGGFTSIACMP-NTDPVCDNKAVVKYIINKAKQDGY 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NVYP   ++   +G+E+SE+  L+  G V+       +  + ++  +++Y+ M +  V 
Sbjct: 116 VNVYPIGAISKGQKGEELSEIGELKFAGAVAISDDGKPVKSSSLMKRALEYSSMFDIAVI 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  L   GV+NEG  +  +GL GIPS +E + +ARD++++++T    H + +S   
Sbjct: 176 SHCEDLDLADGGVMNEGYWSTVMGLKGIPSAAEEIMVARDIILSEYTKVPIHIAHVSTEL 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ LI++AK    K TC    +  +L +   + +N+L KV PPLR+  +  +++E L+ G
Sbjct: 236 SVELIRNAKKRGVKVTCETCPHYFVLTDEACKDFNTLAKVNPPLRTRRDVEAVIEGLKDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALSTR 362
            IDII +DH P H D K + F  A+ G +G ET L  A+  L     +++ +L+  +   
Sbjct: 296 TIDIIATDHAPHHADEKNVEFNLAANGMVGFETALPLAITYLVKPGHLTISQLVEKMCVN 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           P+++  +  GTL+TG +ADI ++DLN ++ V  +   S  KN+ F      G V  T ++
Sbjct: 356 PSKLLGINKGTLETGRSADITIVDLNEEFVVDVNKFKSKSKNSPFHGFKLNGSVYYTLVN 415

Query: 423 GKQV 426
           G  V
Sbjct: 416 GNVV 419


>gi|83643448|ref|YP_431883.1| dihydroorotase-like protein [Hahella chejuensis KCTC 2396]
 gi|83631491|gb|ABC27458.1| Dihydroorotase and related cyclic amidoHydrolase [Hahella
           chejuensis KCTC 2396]
          Length = 431

 Score =  222 bits (565), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 135/422 (31%), Positives = 211/422 (50%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   RIIDPS+ +D V  + + +G ++A GA    A F    +I D  G    PG++D  
Sbjct: 7   IKGGRIIDPSQSLDAVSDLYIADGEVVAIGA--APADFQADMVI-DAAGSWVTPGLVDLC 63

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     E+  NI + S  AV GG T++   P   S   D         ++        
Sbjct: 64  AYLREPGYEHKANIASESLAAVKGGFTTLCCPP-ATSPVNDTAAVTNLIYDQALTAGKAK 122

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           + P   +T  + G+++SEM  L+E G V          D QV+   ++YA   +  V + 
Sbjct: 123 ILPIGAMTKGLAGEQLSEMHALREAGCVGVSNLRYPFRDNQVMKRCLEYACSQDITVFVC 182

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D+ L   G ++EG  +  LGL GIP+I+ET+ +A+ L++ + T    H   +S  +S+
Sbjct: 183 PEDYALAKDGCVHEGATSGLLGLSGIPAIAETMAVAQWLILVEETEARIHLGQLSCAKSV 242

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L+  AK    K TC +++ NLI  +  ++ +N    V PPLR E +R +++  + +G I
Sbjct: 243 ELVADAKRRGLKVTCDVALANLIYTDAVIKDFNPAFHVRPPLRREEDRKALLNGVNEGVI 302

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D I S H P     KL PFAE   G   +ET+L   L L    ++ L+  +RAL++ PAQ
Sbjct: 303 DAICSHHQPHESAAKLAPFAETRSGMSVIETVLPQILALTTAGELRLEAAMRALTSGPAQ 362

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  L  G+LQ G+AAD+ALID   +W V   D+ S  KN  +      G   +T + G+ 
Sbjct: 363 VLELSMGSLQIGSAADVALIDPTARWLVTETDLVSKGKNCPWLDTEVVGLAYKTIVEGRV 422

Query: 426 VY 427
           VY
Sbjct: 423 VY 424


>gi|313623245|gb|EFR93493.1| dihydroorotase [Listeria innocua FSL J1-023]
          Length = 426

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 138/425 (32%), Positives = 226/425 (53%), Gaps = 7/425 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N ++++ S ++ E   ++++NG +    AD++     TS   +D TG +  PG ID
Sbjct: 2   YVLKNGQVLNESGEL-ENKDVLIQNGKVNLI-ADSIEV---TSGEEYDATGKLIAPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T +K A  GG T+I  MP       D    +     +I+  + 
Sbjct: 57  VHVHLREPGGEHKETILTGTKAAARGGYTTICSMP-NTKPVPDSKEVMDRIQAKIKETAE 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +   L+E G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDFEALKEAGAFAFTDDGVGVQLAGTMYEAMKRAAALDMAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++GI A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGIFAEKEGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E D+   +   K+ PPLRS+ +R +++E L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEDIPGNDGNWKMNPPLRSKEDRAALLEGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F    + +LK+LI  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEQAAFGIVGLETAFPLLYTHFVKTNEWTLKQLIDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ F LP G L+ G  ADI ++DL  + T+      S  KNT F  E   G  V T+  
Sbjct: 356 PAECFKLPYGKLEEGAVADIVVLDLEKEATIDPATFYSKGKNTPFVGETCIGWPVATFAE 415

Query: 423 GKQVY 427
           G+ VY
Sbjct: 416 GELVY 420


>gi|115350795|ref|YP_772634.1| dihydroorotase [Burkholderia ambifaria AMMD]
 gi|115280783|gb|ABI86300.1| dihydroorotase [Burkholderia ambifaria AMMD]
          Length = 428

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 138/420 (32%), Positives = 215/420 (51%), Gaps = 7/420 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILA-AGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLT 69
           +IDP    +    + V +G I A A A    A F     I D +GL+  PG++D    L 
Sbjct: 10  LIDPVAGTERQADVFVADGKIAALAPAGTAPAGFNAEKTI-DASGLIVAPGLVDLCARLR 68

Query: 70  GSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVY 127
               E+   + +    AVAGG+T+++  P      LDE   ++  + + R ++L   NV+
Sbjct: 69  EPGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQANVH 125

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   
Sbjct: 126 PLGALTVGLKGEVITEMVALTESGCVGFTHANVPVRDTQVLLRALQYASTYGYTTWLRPL 185

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL
Sbjct: 186 DAFIGRGGVAASGALASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLAL 245

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           ++ AKA     TC + +N+L L + D+  ++S  ++ PPLR E +R ++  AL  G ID 
Sbjct: 246 VREAKAEGLPVTCDVGVNHLHLIDIDIGYFDSQFRLDPPLRGERDREAIRAALADGTIDA 305

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I SDHTP   D KLLPFAEA+ G+ GLE +LS  ++        L + +R ++  PA + 
Sbjct: 306 ICSDHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWADETNTPLAQALRRITAAPADVL 365

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G +  G AAD+ + D    W V+   + S   N+ F        V  T ++G+  +
Sbjct: 366 QLPAGRVAEGAAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPACVRATLVAGQVAF 425


>gi|256005366|ref|ZP_05430331.1| dihydroorotase, multifunctional complex type [Clostridium
           thermocellum DSM 2360]
 gi|281417670|ref|ZP_06248690.1| dihydroorotase, multifunctional complex type [Clostridium
           thermocellum JW20]
 gi|255990685|gb|EEU00802.1| dihydroorotase, multifunctional complex type [Clostridium
           thermocellum DSM 2360]
 gi|281409072|gb|EFB39330.1| dihydroorotase, multifunctional complex type [Clostridium
           thermocellum JW20]
 gi|316940294|gb|ADU74328.1| dihydroorotase, multifunctional complex type [Clostridium
           thermocellum DSM 1313]
          Length = 428

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 128/417 (30%), Positives = 221/417 (52%), Gaps = 6/417 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           ++DP  + + +  I+VE+GII   G D    +     +I+   G + +PG++DA   L  
Sbjct: 10  VVDPKTNTNGIMDILVEDGIITEIGKDI---EISNGDIIY-AEGKLVLPGLVDAHCHLRD 65

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              EY ++I T +  A  GG TSI  MP       D    +KY + + +    +NVYP  
Sbjct: 66  PGFEYKEDIETGTMSAAMGGFTSIACMP-NTDPVCDNKAVVKYIINKAKQDGYVNVYPIG 124

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            ++   +G+E+SE+  L+  G V+       +  + ++  +++Y+ M +  V     D  
Sbjct: 125 AISKGQKGEELSEIGELKFAGAVAISDDGKPVKSSSLMKRALEYSSMFDIAVISHCEDLD 184

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           L   GV+NEG  +  +GL GIPS +E + +ARD++++++T    H + +S   S+ LI++
Sbjct: 185 LADGGVMNEGYWSTVMGLKGIPSAAEEIMVARDIILSEYTKVPIHIAHVSTELSVELIRN 244

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AK    K TC    +  +L +   + +N+L KV PPLR+  +  +++E L+ G IDII +
Sbjct: 245 AKKRGVKVTCETCPHYFVLTDEACKDFNTLAKVNPPLRTRRDVEAVIEGLKDGTIDIIAT 304

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALSTRPAQIFNL 369
           DH P H D K + F  A+ G +G ET L  A+  L     +++ +L+  +   P+++  +
Sbjct: 305 DHAPHHADEKNVEFNLAANGMVGFETALPLAITYLVKPGHLTISQLVEKMCVNPSKLLGI 364

Query: 370 PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
             GTL+TG +ADI ++DLN ++ V  +   S  KN+ F      G V  T ++G  V
Sbjct: 365 NKGTLETGRSADITIVDLNEEFVVDVNKFKSKSKNSPFHGFKLNGSVYYTLVNGNVV 421


>gi|319790301|ref|YP_004151934.1| dihydroorotase, multifunctional complex type [Thermovibrio
           ammonificans HB-1]
 gi|317114803|gb|ADU97293.1| dihydroorotase, multifunctional complex type [Thermovibrio
           ammonificans HB-1]
          Length = 427

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 133/418 (31%), Positives = 224/418 (53%), Gaps = 5/418 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           ++DPS  ++    I++E   ++    +   A+   +  + D  GL+  PG ID    L  
Sbjct: 12  VVDPSLGLNGRADILIEGSTVVKVEKEIPKAE---AEEVLDVGGLIVAPGFIDLHSHLRE 68

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+ ++I + S  AVAGGITS+  M        D     +Y +E      L +V+P  
Sbjct: 69  PGQEWKEDIESGSHAAVAGGITSVCCM-ANTDPVNDNPVVTRYIVERAEEVGLCDVFPVG 127

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            +T  ++G+E++E+ L+ + GIV+      +  D++VL N+M YA  L   V   + D  
Sbjct: 128 AITKGLKGEELAEIGLMVKAGIVAISDDGETPKDSKVLRNAMDYARSLGIPVFTHSEDKT 187

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           L   G +NEG +++ LG+ G+P  +E +   RDL++A+ TG H H   +S   ++  I+ 
Sbjct: 188 LSEGGHMNEGELSSLLGIPGMPPEAEEIGTVRDLIVAKLTGVHIHVCHVSTEGALKAIEA 247

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AK    + +C I+ ++  L E  V  +++  K+ PPLRS+ +  +  EAL+ G  D+I +
Sbjct: 248 AKREGVRVSCEITPHHFTLTEEAVREFDTNAKMCPPLRSKRDVEACREALKNGVADVIAT 307

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP 370
           DH P   D KL+ F +A FG IG +TML  +L L     +SL++++R LS  PA+I N  
Sbjct: 308 DHAPHSEDEKLVEFCKAPFGIIGFQTMLPLSLELVRKGYLSLEEMVRKLSLNPAKIINRN 367

Query: 371 G-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
             GTL+ G  A++A+ D +  +T+  +++ S   NT F  +   G+V  T  +GK V+
Sbjct: 368 DIGTLKPGARANVAIFDPDETFTLTREEIRSKSVNTPFLNKTLRGRVKFTVYNGKIVF 425


>gi|82703597|ref|YP_413163.1| dihydroorotase [Nitrosospira multiformis ATCC 25196]
 gi|82411662|gb|ABB75771.1| dihydroorotase [Nitrosospira multiformis ATCC 25196]
          Length = 424

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 140/425 (32%), Positives = 216/425 (50%), Gaps = 4/425 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           +  + N R+IDP    D V  I +++G I + GA  +   F     I +  GL+  PG++
Sbjct: 2   NIAIRNGRVIDPKNSFDRVTDIYIQSGKIASLGA--VPPGFEARREI-NAQGLIVCPGLV 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     EY   + +    AVAGG+TS+   P      LDE   ++      R ++
Sbjct: 59  DLSARLREPGLEYKATLESEMGAAVAGGVTSLACPP-DTDPVLDEPGLVEMLKYRARSRN 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              VYP   LT  + G+ ++EM  L   G V+F QS   + + +VL+ +M+YA      +
Sbjct: 118 QTRVYPIGALTRGLRGEWLTEMAELHSAGCVAFGQSDRPLPNNRVLMQAMQYASTFGFCL 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
            L   D  L   GV ++G +A  LGL  IP  +ETV L+  +L+A+ TG   H   IS  
Sbjct: 178 WLRPQDVNLADGGVAHDGEVATRLGLAPIPVCAETVALSHIILMAKETGARVHLCRISSA 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           + + + + A+      TC ++ N++ L+E D+  ++S   ++PPLRS  +R ++   L  
Sbjct: 238 EGVTMTRAARKQGLSITCDVAANHVHLSEMDIGFFDSNCHLVPPLRSLGDRDALRAGLLD 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID I SDH P   D KLLPFAEA  G+ GLE +L   L+     ++ L   +  ++  
Sbjct: 298 GTIDAICSDHAPVDEDAKLLPFAEAEAGATGLELLLPLTLKWAAETKLPLVVALSKITRE 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+I  +  G L  G  AD+ + D ++ WT++A  + S  KNT F      GKV  T I+
Sbjct: 358 PARILGVEAGHLTPGGNADLCIFDPDHYWTIEAPTLKSQGKNTPFLGWELQGKVKYTLIN 417

Query: 423 GKQVY 427
           G  VY
Sbjct: 418 GNVVY 422


>gi|302877383|ref|YP_003845947.1| dihydroorotase, multifunctional complex type [Gallionella
           capsiferriformans ES-2]
 gi|302580172|gb|ADL54183.1| dihydroorotase, multifunctional complex type [Gallionella
           capsiferriformans ES-2]
          Length = 424

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 145/424 (34%), Positives = 218/424 (51%), Gaps = 8/424 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           + N R+IDP  +ID    + + +  I A G     A F    +I D TGL+  PG+ID  
Sbjct: 5   IKNGRLIDPRNNIDAQLDLFITDKCIAAIGR--APAGFKPDEVI-DATGLIVCPGLIDLA 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL-- 123
             L     EY   + +    AVAGGITS+   P      LDE   ++  + + R K+L  
Sbjct: 62  ARLREPGFEYMATLESEMNAAVAGGITSLACPP-DTDPPLDEPGLVE--MLKHRAKNLHQ 118

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             +YP A LT+ + GKE++EM  L + G V+F Q+   + DT+V++ +M+YA      V 
Sbjct: 119 ARLYPVAALTTGLMGKELTEMAELVDAGCVAFSQADAPLTDTRVMMRAMQYAATFGFSVW 178

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   D FL   GV ++G +A   GL  IP  +ET+ L+  L +A+ TG   H   IS   
Sbjct: 179 LRPQDSFLSKDGVAHDGEVATRCGLPAIPVCAETIALSTMLTLAKETGVKLHICRISSAA 238

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
            + +I+ A+      +C ++ N++ L+E D+  ++   ++ PPLRS  +R ++   L  G
Sbjct: 239 GVEMIRAARQQGLSVSCDVTANHVHLSEMDIGFFDPNCRLTPPLRSLRDRAALRAGLLDG 298

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID I S+H P   D K LPFAEA  G+ GLE +L   L+     ++ L   +  ++ +P
Sbjct: 299 TIDAICSNHAPVDEDAKQLPFAEAESGATGLELLLPLVLKWAEQDKVGLADALSRVTLQP 358

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           AQI  L  G L  G  AD+ + D +  W V+A  + S  KNT F      G V  T + G
Sbjct: 359 AQILGLDAGHLSIGALADVCVFDADAYWKVEAAALKSQGKNTPFTGMEVQGLVRYTLVDG 418

Query: 424 KQVY 427
           K VY
Sbjct: 419 KIVY 422


>gi|121595861|ref|YP_987757.1| dihydroorotase [Acidovorax sp. JS42]
 gi|222112062|ref|YP_002554326.1| amidohydrolase [Acidovorax ebreus TPSY]
 gi|120607941|gb|ABM43681.1| dihydroorotase [Acidovorax sp. JS42]
 gi|221731506|gb|ACM34326.1| amidohydrolase [Acidovorax ebreus TPSY]
          Length = 431

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 137/433 (31%), Positives = 225/433 (51%), Gaps = 16/433 (3%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R+IDP+  +D+V  + +  G I+A   D     F  + +I D +G + +PG++D
Sbjct: 3   ILIQNGRVIDPASGLDKVCNVALAAGRIIAV--DREPQGFTPTRVI-DASGCLVLPGLVD 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L     E+   + +    AVAGG+TS++  P      LDE   ++  + + R + L
Sbjct: 60  LAARLREPGHEHEGMLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVQ--MLKFRAEKL 116

Query: 124 --INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
               ++P   +T  + G+ ++EM  L E G V F Q+ + +  TQVL  +++YA      
Sbjct: 117 HQARLFPLGAVTRGLAGEVLTEMAELTESGCVGFSQAEVPLTSTQVLQRALQYAATYGYT 176

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V L   +  LG +GV   G +A  LGL G+P  +ET+ L     + + TG   H   +S 
Sbjct: 177 VWLRPQELHLG-KGVAASGPLATRLGLSGVPVAAETIALHTIFELLKTTGARVHLCRLSS 235

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
              + L++ AKA     +C +SIN+L+L + D+  ++S  ++ PPLR + +R ++  AL 
Sbjct: 236 SAGVDLVRQAKAAGLPVSCDVSINSLMLTDADIGYFDSRARLTPPLRQQRDRDALAAALL 295

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID +VSDHTP   D K LPFAEA  G+ GLE +LS AL+        L++ +  ++ 
Sbjct: 296 DGTIDALVSDHTPVDEDAKALPFAEAEPGATGLELLLSVALKWSQEGGAPLQRALAVVTA 355

Query: 362 RPAQIFNLPGGTLQT-------GTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTG 414
            PA++     GTLQ        G   D+ ++D    WTV+AD ++S  K+T F      G
Sbjct: 356 EPARVLGTSLGTLQASVGRIIEGGVGDLCVLDPAAHWTVQADALASQGKHTPFSTYELPG 415

Query: 415 KVVRTYISGKQVY 427
           +V  T + G+  +
Sbjct: 416 RVRCTLVGGQVAF 428


>gi|319764290|ref|YP_004128227.1| amidohydrolase [Alicycliphilus denitrificans BC]
 gi|317118851|gb|ADV01340.1| amidohydrolase [Alicycliphilus denitrificans BC]
          Length = 431

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 140/434 (32%), Positives = 227/434 (52%), Gaps = 18/434 (4%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R+IDP+  +D+V  + +  G I+A   D     F  S +I D  G + +PG++D
Sbjct: 3   ILIQNGRVIDPASGLDKVCNVALAAGRIIAV--DREPKDFTPSRVI-DAGGCLVLPGLVD 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFI---KYALEEIRV 120
               L     E+ + + +    AVAGG+TS++  P      LDE   +   K+  E++  
Sbjct: 60  LAARLREPGHEHERMLESEMSAAVAGGVTSLVCPP-DTDPVLDEQGLVEMLKFRAEKLHQ 118

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             L   +P   LT  + G+ ++EM  L E G V F Q+ +++  TQVL  +++YA     
Sbjct: 119 ARL---FPLGALTRGLAGEVLTEMAELTESGCVGFSQADVALASTQVLQRALQYAATYGY 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V L   +  LG +GV   G +A  +GL GIP  +ET+ L     + +  GG  H   +S
Sbjct: 176 TVWLRPQELHLG-KGVAASGPLATRMGLSGIPVAAETIALHTIFELLKAAGGRVHLCRLS 234

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
               + L++ AKA     +C +SIN+L+L + D+  ++S  ++ PPLR + +R ++  AL
Sbjct: 235 SSAGVELVRQAKAEGLAVSCDVSINSLMLTDVDIGYFDSRARLTPPLRQQRDRDALAAAL 294

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID +VSDHTP   D K LPFAEA  G+ GLE +LS AL+      + L + +  ++
Sbjct: 295 ADGTIDALVSDHTPVDEDAKALPFAEAEPGATGLELLLSIALKWSRDGGVPLARALATVT 354

Query: 361 TRPAQIFNLPGGTLQT-------GTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFT 413
           + PA++     GTLQ        G   D+ ++D +  WTV+AD ++S  K+T F      
Sbjct: 355 SEPARVLGSALGTLQASVGRIVEGGVGDLCVVDPDAHWTVQADALASQGKHTPFSSYELP 414

Query: 414 GKVVRTYISGKQVY 427
           G+V  T + G+  +
Sbjct: 415 GRVRCTLVGGQVAF 428


>gi|220928065|ref|YP_002504974.1| dihydroorotase [Clostridium cellulolyticum H10]
 gi|254788856|sp|B8I770|PYRC_CLOCE RecName: Full=Dihydroorotase; Short=DHOase
 gi|219998393|gb|ACL74994.1| dihydroorotase, multifunctional complex type [Clostridium
           cellulolyticum H10]
          Length = 428

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 130/425 (30%), Positives = 222/425 (52%), Gaps = 6/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
             ++ N  ++D    +D V  I+  +GII   G+    A       + D TGL   PG++
Sbjct: 2   KLLIKNGHVLDVKTGLDRVTDILAVDGIIHEVGSKIDEA----GCEVIDATGLYVTPGLV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           DA   L     EY ++I + ++ A  GG TS+  MP   +  LD    +KY + + +   
Sbjct: 58  DAHCHLRDPGYEYKEDIESGTRSAAKGGFTSVACMP-NTNPVLDNEAMVKYVINKAKTDG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            +NV+P   L+  ++G+E+SE+  L+  G V+       + ++ ++  +M+YA M +  +
Sbjct: 117 FLNVFPIGALSKGLKGEELSEIGELKFAGAVALSDDGRPVGNSSLMKKAMQYASMFDITI 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G++NEG  ++ LGL G P+ +E V +ARDL++A++T    H + +S  
Sbjct: 177 ISHCEDLDLVDEGLMNEGYQSSILGLKGNPAPAEEVMIARDLILAEYTKATIHIAHVSTE 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
             + LI++AK    K T     +   L +N  E +N+  KV PPLR++ +  ++++ L+ 
Sbjct: 237 LGVDLIRNAKRRGVKVTAETCPHYFTLTDNACEGFNTNAKVNPPLRTQKDVDAIIQGLKD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALST 361
           G IDII +DH P H+D K + F  A+ G +G ET    A+  L     +SLK+L+  +S 
Sbjct: 297 GTIDIISTDHAPHHIDEKNVEFKIAANGMVGFETAFPLAVTYLVKPGHLSLKELVYKMSF 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            P+Q+  L  GT++ G  AD+ + DLN ++ V   +  S  KN+ F+     G+   T +
Sbjct: 357 NPSQMLGLNKGTIEVGKLADLIIFDLNEEYKVNITEFESKSKNSPFNGLLLYGQPQYTIV 416

Query: 422 SGKQV 426
            G  V
Sbjct: 417 GGTPV 421


>gi|238026388|ref|YP_002910619.1| dihydroorotase [Burkholderia glumae BGR1]
 gi|237875582|gb|ACR27915.1| Aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia glumae BGR1]
          Length = 425

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 136/419 (32%), Positives = 216/419 (51%), Gaps = 8/419 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           ++DP+    +   + +  G + A GA    A F  +  I D  GLV  PG++D    L  
Sbjct: 10  LVDPAAGTQQTADVYLAAGKVAAIGA--APADFHAAKTI-DAAGLVVAPGLVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYP 128
             +E+   + +    AVAGG+TS++  P      LDE   ++  + + R   L   +VYP
Sbjct: 67  PGNEHRATLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVE--MLKFRASKLHQAHVYP 123

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  + G+ I+EM  L E G + F Q+ + I DTQVLL +++YA      V L   D
Sbjct: 124 LGALTVGLRGEVITEMVELTESGCIGFTQANVPIRDTQVLLRALQYASTYGFTVWLRPLD 183

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
            FL   GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    IAL+
Sbjct: 184 AFLAKGGVAASGAVASRLGLSGVPVSAETIALHTLFELMRVTGARVHVARLSSAAGIALV 243

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     +C +S N+L L + D+  +++  ++ PPLR+E +R ++   +  G ID I
Sbjct: 244 REAKAEGLAVSCDVSANHLHLIDVDIGYFDAQFRLDPPLRAERDREAIRAGVADGTIDAI 303

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            SDHTP   D KLLPFAEA+ G+ GLE +LS  ++  +   + L + +  +++ PA +  
Sbjct: 304 CSDHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWANEANLPLAQALSRITSAPADVLK 363

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           LP G L  G  AD+ + D    W V+   + S   N+ F       +V  T ++G+  +
Sbjct: 364 LPAGRLAPGAVADLVVFDPAAHWQVEPRALKSQGHNSPFLGYELPAQVRVTIVAGQLAF 422


>gi|330826427|ref|YP_004389730.1| Allantoinase [Alicycliphilus denitrificans K601]
 gi|329311799|gb|AEB86214.1| Allantoinase [Alicycliphilus denitrificans K601]
          Length = 431

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 139/433 (32%), Positives = 228/433 (52%), Gaps = 16/433 (3%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R+IDP+  +D+V  + +  G I+A   D     F  S +I D  G + +PG++D
Sbjct: 3   ILIQNGRVIDPASGLDKVCNVALAAGRIIAV--DREPKDFTPSRVI-DAGGCLVLPGLVD 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L     E+ + + +    AVAGG+TS++  P      LDE   ++  + + R + L
Sbjct: 60  LAARLREPGHEHERMLESEMAAAVAGGVTSLVCPP-DTDPVLDEQGLVE--MLKFRAEKL 116

Query: 124 --INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
               ++P   LT  + G+ ++EM  L E G V F Q+ +++  TQVL  +++YA      
Sbjct: 117 HQARLFPLGALTRGLAGEVLTEMAELTESGCVGFSQADVALASTQVLQRALQYAATYGYT 176

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V L   +  LG +GV   G +A  +GL GIP  +ET+ L     + +  GG  H   +S 
Sbjct: 177 VWLRPQELHLG-KGVAASGPLATRMGLSGIPVAAETIALHTIFELLKAAGGRVHLCRLSS 235

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
              + L++ AKA     +C +SIN+L+L + D+  ++S  ++ PPLR + +R ++  AL 
Sbjct: 236 SAGVELVRQAKAEGLAVSCDVSINSLMLTDVDIGYFDSRARLTPPLRQQRDRDALAAALA 295

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID +VSDHTP   D K LPFAEA  G+ GLE +LS AL+      + L + +  +++
Sbjct: 296 DGTIDALVSDHTPVDEDAKALPFAEAEPGATGLELLLSIALKWSRDGGVPLARALATVTS 355

Query: 362 RPAQIFNLPGGTLQT-------GTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTG 414
            PA++     GTLQ        G   D+ ++D +  WTV+AD ++S  K+T F      G
Sbjct: 356 EPARVLGSALGTLQASVGRIVEGGVGDLCVVDPDAHWTVQADALASQGKHTPFSSYELPG 415

Query: 415 KVVRTYISGKQVY 427
           +V  T + G+  +
Sbjct: 416 RVRCTLVGGQVAF 428


>gi|170698778|ref|ZP_02889842.1| dihydroorotase, multifunctional complex type [Burkholderia
           ambifaria IOP40-10]
 gi|170136335|gb|EDT04599.1| dihydroorotase, multifunctional complex type [Burkholderia
           ambifaria IOP40-10]
          Length = 428

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 137/420 (32%), Positives = 214/420 (50%), Gaps = 7/420 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILA-AGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLT 69
           +IDP    +    + V +G I A A A    A F     I D +GL+  PG++D    L 
Sbjct: 10  LIDPVAGTERQADVFVADGKIAALAQAGTAPAGFNAEKTI-DASGLIVAPGLVDLCARLR 68

Query: 70  GSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVY 127
               E+   + +    AVAGG+T+++  P      LDE   ++  + + R ++L   NV+
Sbjct: 69  EPGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQANVH 125

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   
Sbjct: 126 PLGALTVGLKGEVITEMVALTESGCVGFTHANVPVRDTQVLLRALQYASTYGYTTWLRPL 185

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL
Sbjct: 186 DAFIGRGGVAASGALASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLAL 245

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           ++ AKA     TC + +N+L L + D+  ++S  ++ PPLR E +R ++  AL  G ID 
Sbjct: 246 VREAKAEGLPVTCDVGVNHLHLIDIDIGYFDSQFRLDPPLRGERDREAIRAALADGTIDA 305

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I SDHTP   D KLLPF EA+ G+ GLE +LS  ++        L + +R ++  PA + 
Sbjct: 306 ICSDHTPVDDDEKLLPFGEATPGATGLELLLSLTVKWADETNTPLAQALRRITAAPADVL 365

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G +  G AAD+ + D    W V+   + S   N+ F        V  T ++G+  +
Sbjct: 366 QLPAGRVAEGAAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPACVRATLVAGQVAF 425


>gi|56551688|ref|YP_162527.1| dihydroorotase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56543262|gb|AAV89416.1| Dihydroorotase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 408

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 141/426 (33%), Positives = 212/426 (49%), Gaps = 23/426 (5%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSAL--IHDCTGLVAV 58
           M+   + N R+IDP+         IVE G++L  G  A   +   S    + D  G    
Sbjct: 1   MSFIAIINGRLIDPASKK------IVEGGLLLKEGRIAACGQIDPSQANNVIDAEGGYIA 54

Query: 59  PGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           P IID        P  +S ++    K    GGI  + LMP   S  LDE   I+ A  + 
Sbjct: 55  PAIID--------PTVFSVDLPAFIK----GGIGRVALMP-DQSPALDEAALIQRA--KA 99

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
                + VYP A  +  +EG+E++E+ L+Q  G  +       I D+ ++   + YA  L
Sbjct: 100 SGGEAVEVYPLAAGSRGLEGRELAEIGLMQRAGAKAVATGRQWIADSGLMYRLLDYAASL 159

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
              V     D  L    V  EG++A+ LGL   P+++E + +ARDL++A+ TG   H + 
Sbjct: 160 GLTVISHAEDGGLTKGCVATEGLMASRLGLRAAPAVAEAIVVARDLMLAEETGCKIHFAQ 219

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           ++  +S  LI+ AK    K T GI+   L+L++   E + +  ++ PPLR E +R++ VE
Sbjct: 220 LTTKKSFDLIRQAKEKGVKVTVGINPAYLLLSDRHTEDFRTFARLSPPLRGEDDRLASVE 279

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
           AL  G ID+  S H PR  + K LPF +A  G  G ET+LSA+L L H   I L +L+  
Sbjct: 280 ALRDGVIDMFCSAHDPRDAEDKRLPFIDAKPGMAGAETLLSASLELVHQGVIDLSRLVEL 339

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           LS   AQ+    GG L  G  ADI + D++ +W + +  M++   N+ FD     GKV  
Sbjct: 340 LSVNAAQLLGCEGGGLSVGDEADIVIFDIDREWQLDSAKMAAKAGNSPFDGRMMRGKVTH 399

Query: 419 TYISGK 424
           T   GK
Sbjct: 400 TIKGGK 405


>gi|16801017|ref|NP_471285.1| dihydroorotase [Listeria innocua Clip11262]
 gi|21542203|sp|Q92AH1|PYRC_LISIN RecName: Full=Dihydroorotase; Short=DHOase
 gi|16414452|emb|CAC97181.1| pyrC [Listeria innocua Clip11262]
          Length = 426

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 138/425 (32%), Positives = 225/425 (52%), Gaps = 7/425 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N ++++ S ++ E   ++++NG +    AD++     TS    D TG +  PG ID
Sbjct: 2   YVLKNGQVLNESGEL-ENKDVLIQNGKVNLI-ADSIEV---TSGEEFDATGKLIAPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T +K A  GG T+I  MP       D    +     +I+  + 
Sbjct: 57  VHVHLREPGGEHKETILTGTKAAARGGYTTICSMP-NTKPVPDSKEVMNSLQAKIKETAE 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +   L+E G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDFEALKEAGAFAFTDDGVGVQLAGTMYEAMKRAAALDMAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++GI A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGIFAEKEGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E D+   +   K+ PPLRS+ +R +++E L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEDIPGNDGNWKMNPPLRSKEDRAALLEGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F    + +LK+LI  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEQAAFGIVGLETAFPLLYTHFVKTNEWTLKQLIDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ F LP G L+ G  ADI ++DL  + T+      S  KNT F  E   G  V T+  
Sbjct: 356 PAECFKLPYGKLEEGAVADIVVLDLEKEATIDPATFYSKGKNTPFVGETCIGWPVATFAE 415

Query: 423 GKQVY 427
           G+ VY
Sbjct: 416 GELVY 420


>gi|295098821|emb|CBK87910.1| dihydroorotase [Eubacterium cylindroides T2-87]
          Length = 423

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 129/385 (33%), Positives = 207/385 (53%), Gaps = 7/385 (1%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D +GL  +PG++D  V L        + I T +K A AGG T+++ MP  +  F D    
Sbjct: 42  DASGLTVLPGLVDVHVHLREPGHAQKETIKTGTKAAAAGGFTTVLCMP-NVIPFPDNVED 100

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +K  LE I  +S++N YP AC+T    GKE+ +M  L+  GI  F    + + + +++  
Sbjct: 101 VKNYLELIHDQSVVNTYPYACITKKEAGKEVVDMHALKALGIHWFSDDGVGVANDEIMKE 160

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRG-VINEGIIANYLGLVGIPSISETVPLARDLLIAQH 229
           +M  A+  + ++   T D      G  ++E  I    G +GIPS  E+  L RDL I + 
Sbjct: 161 AMTKANQEDVMIVAHTEDMSYRKPGACVHESEITKAKGWLGIPSACESAQLIRDLEIVKE 220

Query: 230 TGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRS 289
               YHA  IS  +S+  +K AK      +  ++ ++L+L + DV+  N   K+ PPLRS
Sbjct: 221 CKNAYHACHISAKESVEALKKAKNDGLNVSGEVTAHHLLLEDKDVQGPN--WKMNPPLRS 278

Query: 290 ETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF--HG 347
             +RMS++E LE G +DII +DH P     K  P  +A FG + LET  +     F  + 
Sbjct: 279 HEDRMSLIEGLENGSLDIIANDHAPHTAQEKNQPMDKAPFGIVSLETSFALLYTEFVVNQ 338

Query: 348 QQISLKKLIRALSTRPAQIFNLPG-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTV 406
           ++ SL +L+  +S  PA+ F L G G ++ G  ADI L+D+N+++T+ A    S+ KNT 
Sbjct: 339 KRWSLPQLVNWMSKAPAKRFKLDGIGEIKEGNDADIILVDMNHEYTIDASKFESMGKNTP 398

Query: 407 FDKEFFTGKVVRTYISGKQVYTLES 431
           FD      ++ +T++ GK+V+  E+
Sbjct: 399 FDGWKVACQIKQTFVKGKEVWKKEA 423


>gi|303240756|ref|ZP_07327269.1| dihydroorotase, multifunctional complex type [Acetivibrio
           cellulolyticus CD2]
 gi|302591644|gb|EFL61379.1| dihydroorotase, multifunctional complex type [Acetivibrio
           cellulolyticus CD2]
          Length = 428

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 211/385 (54%), Gaps = 3/385 (0%)

Query: 40  NAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPL 99
           N +F +  +I+   G   +PG++DA   L     EY ++I T ++ A  GG TSI  MP 
Sbjct: 36  NLEFVSGDIIY-AEGKYVLPGLVDAHCHLRDPGFEYKEDIETGTRSAAKGGFTSIACMP- 93

Query: 100 GMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSP 159
             +  +D    +KY + + + + ++NVYP   ++  ++G+E+SE+  L+  G V+     
Sbjct: 94  NTNPVIDNQAIVKYIINKAKQEGVVNVYPIGAISKGLKGEELSEIGELKFAGAVAISDDG 153

Query: 160 MSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVP 219
             +  + ++  +++YA M +  V     D  L   G +NEG ++  +GL GIPS +E + 
Sbjct: 154 KPLKSSSLMKKALQYASMFDITVISHCEDLELVDEGTMNEGYLSTIMGLKGIPSAAEEIM 213

Query: 220 LARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNS 279
           ++RDL++A++T    H + +S   S+ LI+HAK    K TC    +   L E   E +N+
Sbjct: 214 VSRDLILAEYTKIPVHIAHVSTELSVDLIRHAKKRGVKVTCETCPHYFTLTEEACEGFNT 273

Query: 280 LRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLS 339
           L KV PPLR+  +  +++E L+ G IDII +DH P H D K + FA A+ G +G ET L 
Sbjct: 274 LAKVNPPLRTNKDVQAIIEGLKDGTIDIIATDHAPHHADEKNVEFAIAANGMVGFETALP 333

Query: 340 AALR-LFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDM 398
             +  L     +++++L+  +   P++I  L  G+++ G+ AD+ ++D+N ++ V     
Sbjct: 334 LCVTYLVKPGHLTIEQLVEKMCVNPSKILGLNKGSIEVGSCADLTILDINEEFEVDIQKF 393

Query: 399 SSIHKNTVFDKEFFTGKVVRTYISG 423
           SS  KN+ F+     G V  T ++G
Sbjct: 394 SSKSKNSPFNGFKLQGTVYYTIVNG 418


>gi|91776455|ref|YP_546211.1| dihydroorotase [Methylobacillus flagellatus KT]
 gi|91710442|gb|ABE50370.1| dihydroorotase [Methylobacillus flagellatus KT]
          Length = 424

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 137/425 (32%), Positives = 220/425 (51%), Gaps = 4/425 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++   R+IDP   +D V  + V NG ++  G D     F  + +I D +GL+  PG++
Sbjct: 2   NILIKQGRLIDPRHRVDAVQDLYVSNGKVV--GIDHAPDDFMPNEVI-DASGLIVCPGLV 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L    +EY  ++ +    AVAGG+TS+   P      LDE   ++      +   
Sbjct: 59  DVSARLREPGNEYKASLKSELHAAVAGGVTSLACPP-DTDPVLDESGLVEMLRHRAKQLH 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L NV+P   LT  + GK+++EM  L + G V F Q+   I DT VL  +++YA      V
Sbjct: 118 LSNVHPLGALTRQLAGKQLTEMSELTDAGCVGFSQADEPIMDTLVLWRALQYAATFGFTV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
            L   + +L   GV ++G +A  LGL  IP  +ET+ LA  L I + TG   H   +S  
Sbjct: 178 WLRPQEPYLAQGGVAHDGEVAARLGLKTIPVAAETLALATILHIVRETGAKVHLCRLSSA 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           + +A+++ AK      +  +S ++L L E+D+  +++   + PPLRS+ +R ++ + L  
Sbjct: 238 EGVAMVREAKQQGLHISSDVSAHHLHLTEHDIGFFDANCHLRPPLRSQRDRDALRQGLAD 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID++ SDH P   D KL+PF EA  G+ GLE +L   L+    Q+++L + +  +++ 
Sbjct: 298 GTIDLVCSDHAPVDDDAKLVPFGEAEAGATGLELLLPLTLKWAEEQKVALVEALARITST 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA I  +  G L    AADI + D    W V A ++ S  KNT  +     GKV  T ++
Sbjct: 358 PANILGIAKGHLGLNAAADICIFDPAQYWKVTAANLRSQGKNTPLNGLELAGKVRYTIVN 417

Query: 423 GKQVY 427
           G   Y
Sbjct: 418 GGIAY 422


>gi|193222400|emb|CAL62854.2| Putative dihydroorotase-like protein [Herminiimonas arsenicoxydans]
          Length = 432

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 150/435 (34%), Positives = 227/435 (52%), Gaps = 22/435 (5%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFP---TSALIHDCTGLVAVPGII 62
           + N  +IDP+  ID       +  + +AAG  A   + P    +A + D +GLV  PG +
Sbjct: 5   IKNGHLIDPANGID------AKQDVFIAAGKIAGLGQAPEGFVAAKVIDASGLVVAPGFV 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E+   + +  + A+ GG+TS+I  P      LDE   ++  + + R KS
Sbjct: 59  DLSARLREPGYEHKATLESEMQAAIQGGVTSLICPP-DTDPVLDEPGLVE--MLKHRAKS 115

Query: 123 L--INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           L   +VYP   LT  ++G  ++EM  L + G + F Q+   I DT VLL +M+YA   + 
Sbjct: 116 LNQAHVYPLGALTMGLKGAALTEMAELTDAGCIGFAQADQPILDTTVLLRAMQYAKTFDY 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V L   D  LG +GV + G +A+ LGL G+P ++ET+ L   L + + TG   H   +S
Sbjct: 176 TVWLRPQDPHLGRKGVAHSGPVASRLGLSGVPVMAETIALHTILELVRVTGTRVHLCRMS 235

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
               + L++ AK      +C +  +++ L END+  ++S  ++ PPLRS+ +R ++  AL
Sbjct: 236 SAAGLELVRAAKQEGLPISCDVGAHHIHLTENDIGFFDSNARLTPPLRSQRDRDAIHRAL 295

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF--------HGQQISL 352
             G ID I SDHTP   D KLLPF EAS G+ GLE +LS AL+             Q SL
Sbjct: 296 LDGTIDAICSDHTPVDDDEKLLPFGEASPGATGLELLLSLALKWAENCADLDKQSSQQSL 355

Query: 353 KKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFF 412
            + I  +S   A++  LP G L  G+ ADI L D   +WTV A  ++S  K+T F     
Sbjct: 356 VQAIAKISADAARVVGLPSGQLALGSVADICLFDPAARWTVAAKALASQGKHTPFLGYEL 415

Query: 413 TGKVVRTYISGKQVY 427
           +G+V  T ++G   Y
Sbjct: 416 SGQVKTTIVAGHIAY 430


>gi|149926770|ref|ZP_01915030.1| dihydroorotase [Limnobacter sp. MED105]
 gi|149824699|gb|EDM83915.1| dihydroorotase [Limnobacter sp. MED105]
          Length = 438

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 219/425 (51%), Gaps = 3/425 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADA-LNAKFPTSALIHDCTGLVAVPGIID 63
           +++  R+IDPS   D +  + V  G ++A      + A F  S  I D TGL  +PG++D
Sbjct: 4   LISGGRVIDPSIGADAIMEVAVAAGRVVAVAPKGEMPADFAPSKTI-DATGLWVLPGLVD 62

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L     EY   + +  + A+AGGITS++  P      LDE   I+    + R  +L
Sbjct: 63  LSARLREPGYEYRATLESEMEAAMAGGITSLVCPP-DTEPVLDEPGLIEMLKFKARQLNL 121

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             VYP   LT+ + G+ ++EM  L E G V F Q+   I D +VLL +MKYA      V 
Sbjct: 122 AKVYPLGALTTGLNGETLTEMAELTEAGCVGFSQAESPIRDLRVLLQAMKYARNFGFTVF 181

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   +      GV + G  A+ +GL GIP ++ET+ L     + + TG   H   IS  +
Sbjct: 182 LRPTEPNFSKGGVAHAGAYASRMGLSGIPVMAETIALQAYFELVRSTGTRMHICRISSAK 241

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
            I L++ AK+     TC ++I+++ L + D+  ++    ++PPLR + +R ++   L  G
Sbjct: 242 GIELVRQAKSEGLPVTCDVAIHHVHLTDLDIGFFDPNAHLIPPLREQRDRDAIRAGLLDG 301

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID I SDHTP   D KLLPFAE+  G+ GLE +L+ A++    Q +   +++  L   P
Sbjct: 302 TIDAICSDHTPVDDDAKLLPFAESEAGATGLELLLTLAVKWMREQNVPPARIVELLCGNP 361

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A I  +  G+L+TG  AD+ L +    W V    + S  K+T F+     GKV  T ++G
Sbjct: 362 ADIIKVQAGSLRTGMPADLCLFNPEVDWVVGEASLISQGKHTPFNGFPMQGKVQLTMVNG 421

Query: 424 KQVYT 428
              Y+
Sbjct: 422 NVGYS 426


>gi|172059818|ref|YP_001807470.1| dihydroorotase [Burkholderia ambifaria MC40-6]
 gi|171992335|gb|ACB63254.1| dihydroorotase, multifunctional complex type [Burkholderia
           ambifaria MC40-6]
          Length = 425

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 136/419 (32%), Positives = 214/419 (51%), Gaps = 8/419 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP    +    + V +G I A G     A F     I D +GL+  PG++D    L  
Sbjct: 10  LIDPVAGTERQADVFVADGKIAALGT--TPAGFNAEKTI-DASGLIVAPGLVDLCARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYP 128
              E+   + +    AVAGG+T+++  P      LDE   ++  + + R ++L   NV+P
Sbjct: 67  PGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQANVHP 123

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   D
Sbjct: 124 LGALTVGLKGEVITEMVALTESGCVGFTHANVPVRDTQVLLRALQYASTYGYTTWLRPLD 183

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
            F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL+
Sbjct: 184 AFIGRGGVAASGALASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLALV 243

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     TC + +N++ L + D+  ++S  ++ PPLR E +R ++  AL  G ID I
Sbjct: 244 REAKAEGLPVTCDVGVNHVHLIDIDIGYFDSQFRLDPPLRGERDREAIRAALADGTIDAI 303

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            SDHTP   D KLLPFAEA+ G+ GLE +LS  ++        L + +R ++  PA +  
Sbjct: 304 CSDHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWADETNTPLAQALRRITAAPADVLQ 363

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           LP G +  G AAD+ + D    W V+   + S   N+ F        V  T ++G+  +
Sbjct: 364 LPAGRVAEGAAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPACVRATLVAGQVAF 422


>gi|15595598|ref|NP_249092.1| dihydroorotase [Pseudomonas aeruginosa PAO1]
 gi|107099387|ref|ZP_01363305.1| hypothetical protein PaerPA_01000399 [Pseudomonas aeruginosa PACS2]
 gi|254237364|ref|ZP_04930687.1| noncatalytic dihydroorotase-like protein [Pseudomonas aeruginosa
           C3719]
 gi|12230976|sp|Q51551|PYRX_PSEAE RecName: Full=Dihydroorotase-like protein; AltName: Full=Aspartate
           carbamoyltransferase 44 kDa Non-catalytic chain
 gi|9946255|gb|AAG03790.1|AE004477_7 noncatalytic dihydroorotase-like protein [Pseudomonas aeruginosa
           PAO1]
 gi|126169295|gb|EAZ54806.1| noncatalytic dihydroorotase-like protein [Pseudomonas aeruginosa
           C3719]
          Length = 423

 Score =  220 bits (560), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 137/418 (32%), Positives = 208/418 (49%), Gaps = 5/418 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+ D+D+VG + +E G I+A GA    A F     + D  GLVA PG++D  
Sbjct: 5   IRGARVIDPASDLDQVGDLHIEAGKIVAIGA--APAGFSAQKTL-DGAGLVAAPGLVDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L         N+ + ++ A AGG TS+   P      LD     +  L+  R      
Sbjct: 62  VALREPGYGRKGNVESETRAAAAGGTTSLCCPPY-TRPVLDTPAVAELILDRAREAGNAK 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT    G+++SE+  L++ G V+F          ++L  +++YA   +  V   
Sbjct: 121 VYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASNRILRRALEYAATFDLTVIFT 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
           + D  L   G+ +EG  A++LGL GIP  +ETV LAR+LL+ + +G   H S ++  + I
Sbjct: 181 SQDTDLAEGGLAHEGPTASFLGLAGIPETAETVALARNLLLVEQSGVRAHFSQLTSARGI 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L+  A+A     TC +++  LIL +  +  ++SL  V PPLR+  +R ++ EA++ G +
Sbjct: 241 ELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLYHVQPPLRTRADREALREAVKNGVV 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
             I S H P   D K  PFA    G  G E +L  A+ L     + L  L+  LS  PAQ
Sbjct: 301 QAIASHHQPHEADAKNAPFAATEPGISGAELLLPLAMTLVQDGLLDLPTLLARLSHGPAQ 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
              LP G L  G AAD+ L D     T+  +   S  +N+ F      G+V  T + G
Sbjct: 361 ALRLPAGRLAVGQAADLVLFDPQGS-TLAGESWYSKGQNSPFVGHCLPGRVRYTLVDG 417


>gi|182414327|ref|YP_001819393.1| dihydroorotase, multifunctional complex type [Opitutus terrae
           PB90-1]
 gi|177841541|gb|ACB75793.1| dihydroorotase, multifunctional complex type [Opitutus terrae
           PB90-1]
          Length = 429

 Score =  220 bits (560), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 136/431 (31%), Positives = 218/431 (50%), Gaps = 12/431 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M S  + N R+IDP+   D  G + V +G ++    D+L+      A   D  GLVA PG
Sbjct: 1   MPSLWIQNARVIDPASKRDATGDLFVTDGRLV----DSLSRDAKRRAKKIDARGLVACPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D  V        + + I T S+ A AGG T+++ MP   +   D    I+Y  + IR 
Sbjct: 57  LVDIHVHFREPGQSHKETIATGSRAAAAGGFTTVVCMP-NTTPPADNVGTIQYINDAIRR 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++ V+PT C+T  M+G+ ++    LQ  G+V+       +   +V+  + +YA M + 
Sbjct: 116 DAVVKVHPTGCITVGMKGQALAPFGSLQRAGVVAITDDGDCVQSNEVMRRACEYAKMFDL 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +     D  +    V+NEG+++  LGL G P+ +E + +AR++++A +TG   H   IS
Sbjct: 176 PLMDHCQDTSMTQGAVMNEGVVSTRLGLRGWPNAAEDLIVARNIVLASYTGARIHLQHIS 235

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             QS+ +I+ AK      T   + +++ L +  +  Y+   K+ PPLR+E +R  ++  L
Sbjct: 236 SGQSVEMIRRAKKRGVSITAEATPHHIALTDAALVSYDPNFKMNPPLRTEEDRQEIIAGL 295

Query: 301 EKGDIDIIVSDHTPRHMD---TKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLI 356
             G +D I +DH P H D    K + FA    G IGLET L+  L  L   Q+  L +++
Sbjct: 296 RDGVLDCISTDHAP-HTDYEKDKEIDFAPN--GIIGLETSLAVVLEVLVKQQKFKLPQVV 352

Query: 357 RALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
             ++ RPA I  L  GTL  G  ADI L D    W   A    S   N+ +    FTG+V
Sbjct: 353 DLMTRRPADILKLKAGTLAVGAPADICLFDPAETWRYDAKAGLSKSSNSPWHGHTFTGRV 412

Query: 417 VRTYISGKQVY 427
             T + G+ VY
Sbjct: 413 KTTIVDGRVVY 423


>gi|330815722|ref|YP_004359427.1| Aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia gladioli BSR3]
 gi|327368115|gb|AEA59471.1| Aspartate carbamoyltransferase, 44 kDa non-catalytic chain
           [Burkholderia gladioli BSR3]
          Length = 425

 Score =  219 bits (559), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 137/419 (32%), Positives = 216/419 (51%), Gaps = 8/419 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           ++DP    ++   + +  G ++A GA    A F  +  I D +GL+  PG++D    L  
Sbjct: 10  LVDPVAGTEQQSDVFIAAGKVVAIGA--APADFQAARTI-DASGLIVAPGLVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYP 128
              E+   + +    AVAGG+TS++  P      LDE   ++  + + R   L   +VYP
Sbjct: 67  PGYEHKATLESEMAAAVAGGVTSLVCQP-DTDPVLDEPGLVE--MLKFRASKLHQAHVYP 123

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  ++G+ I+EM  L E G + F Q+ + I DTQVLL +++YA      V L   D
Sbjct: 124 LGALTVGLKGEVITEMVELTESGCIGFTQANVPIRDTQVLLRALQYASTYGYTVWLRPVD 183

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
            FL   GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    I L+
Sbjct: 184 AFLAKGGVAASGPLASRLGLSGVPVSAETIALHTLRELVRVTGARVHIARLSSAAGIELV 243

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     TC +S N+L L + D+  ++S  ++ PPLR+E +R ++  A+E G ID I
Sbjct: 244 RQAKAEGLPITCDVSANHLHLIDLDIGYFDSQFRLDPPLRAERDRAAIRAAVEDGTIDAI 303

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            SDHTP   D KLLPFAEA+ G+ GLE +LS  ++      + L + +  ++   A +  
Sbjct: 304 CSDHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWAQEAGLPLARALNRITAGAADVLK 363

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           LP G L  G  AD+ + D    W V+   + S   N+ F       +V  T ++G+  +
Sbjct: 364 LPAGRLVPGGVADLVVFDPAAHWQVEPRALKSQGHNSPFLGYELPARVCATLVAGQVAF 422


>gi|77163895|ref|YP_342420.1| dihydroorotase multifunctional complex type [Nitrosococcus oceani
           ATCC 19707]
 gi|254435652|ref|ZP_05049159.1| Amidohydrolase family, putative [Nitrosococcus oceani AFC27]
 gi|76882209|gb|ABA56890.1| dihydroorotase [Nitrosococcus oceani ATCC 19707]
 gi|207088763|gb|EDZ66035.1| Amidohydrolase family, putative [Nitrosococcus oceani AFC27]
          Length = 429

 Score =  219 bits (559), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 133/422 (31%), Positives = 213/422 (50%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +    +IDP   ID +  + +  G ++A G+      F     I D    +  PG+ID +
Sbjct: 5   IRGGHLIDPYNKIDGLQDLYLAEGRVVAIGS--APEGFRAEQEI-DAQDQIVCPGLIDLQ 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     E    I T +  A  GGIT++   P  ++  +D    +              
Sbjct: 62  ARLREPGQEQKGTIATETLAAAKGGITTLCCPPDTLA-IIDTPAVVDLIAHREAQYQRTR 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           + P   LT  ++G +++EM +L+E G V      M I ++QV+  +M+YA  L   + L 
Sbjct: 121 ILPLGALTQGLQGLQLAEMGILREAGCVGVSNGLMPIANSQVMRQAMEYAATLGITLFLY 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
           + D +LG  G  +EGI++  LGL GIP  +ETV LARDLL+ + TG   H   +S  +++
Sbjct: 181 SRDPWLGIEGCCHEGIVSARLGLAGIPETAETVSLARDLLLIEQTGVQAHFCHLSSARAV 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            +++ A+      +  ++  +L L E+D+  ++S   V+PPLRS  +R ++ E L  G  
Sbjct: 241 RMVREAQTEGLPISADVTAYHLHLTEHDIGEFDSQCHVIPPLRSLRDRDALHEGLRDGTF 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
             I SDH P   D KL  F     G  GLET+L  +LRL     ++L ++I  L+ +PAQ
Sbjct: 301 SAICSDHQPHEFDAKLGAFPITEPGISGLETLLPLSLRLTQDDTLTLAEVIAYLTCQPAQ 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  + GG L  G  ADI + D +  WT K ++M+S  +NT F    F G+V  T + G+ 
Sbjct: 361 VLGIEGGHLAPGQRADICIFDPHCHWTFKPEEMASQGRNTPFGGWEFQGRVTYTLLEGRV 420

Query: 426 VY 427
           V+
Sbjct: 421 VF 422


>gi|289435180|ref|YP_003465052.1| dihydroorotase, multifunctional complex type [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
 gi|289171424|emb|CBH27968.1| dihydroorotase, multifunctional complex type [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
          Length = 426

 Score =  219 bits (559), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 137/426 (32%), Positives = 226/426 (53%), Gaps = 7/426 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N ++++ + ++ E   ++++NG +    AD+++    TS  + D T  V  PG ID
Sbjct: 2   YVLKNGQVLNEAGEL-ENKDVLIQNGKVNLI-ADSIDV---TSGEVFDATDKVIAPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T +K A  GG T+I  MP       D    ++    +I   + 
Sbjct: 57  VHVHLREPGGEHKETILTGTKAAARGGYTTICSMP-NTKPVPDSKEIMESLQAKINETAQ 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +M  L+E G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDMEALKEAGAFAFTDDGVGVQLAGTMYEAMKRAAKLDMAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++GI A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGIFAEKAGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E D+   +   K+ PPLRS+ +R +++E L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEDIPGNDGNWKMNPPLRSKEDRAALLEGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F    + +LK+L+  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEKAAFGIVGLETAFPLLYTHFVKTNEWTLKQLVDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA  FNLP G L+ G  ADI ++DL  +  +      S  KNT F  E   G  V T+  
Sbjct: 356 PATCFNLPYGKLEEGRVADIVVLDLAKESKIDPATFYSKGKNTPFVGEACIGWPVATFAE 415

Query: 423 GKQVYT 428
           G  VY+
Sbjct: 416 GTLVYS 421


>gi|296386900|ref|ZP_06876399.1| dihydroorotase [Pseudomonas aeruginosa PAb1]
          Length = 423

 Score =  219 bits (559), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 137/418 (32%), Positives = 209/418 (50%), Gaps = 5/418 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  +D+VG + +E G I+A GA    A F     + D  GLVA PG++D  
Sbjct: 5   IRGARVIDPASGLDQVGDLHIEAGKIVAIGA--APAGFSAQKTL-DGAGLVAAPGLVDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L         N+ + ++ A AGG TS+   P      LD     +  L+  R      
Sbjct: 62  VALREPGYGRKGNVESETRAAAAGGTTSLCCPPY-TRPVLDTPAVAELILDRAREAGNAK 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT    G+++SE+  L++ G V+F          ++L  +++YA   +  V   
Sbjct: 121 VYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASNRILRRALEYAATFDLTVIFT 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
           + D  L   G+ +EG  A++LGL GIP  +ETV LAR+LL+ + +G   H S ++  + I
Sbjct: 181 SQDTDLAEGGLAHEGPTASFLGLAGIPETAETVALARNLLLVEQSGVRAHFSQLTSARGI 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L+  A+A     TC +++  LIL +  +  ++SL  V PPLR++T+R ++ EA++ G +
Sbjct: 241 ELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLYHVQPPLRTKTDREALREAVKNGVV 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
             I S H P   D K  PFA    G  G E +L  A+ L     + L  L+  LS  PAQ
Sbjct: 301 QAIASHHQPHEADAKNAPFAATEPGISGAELLLPLAMTLVQDGLLDLPTLLARLSHGPAQ 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
              LP G L  G AAD+ L D     T+  +   S  +N+ F      G+V  T + G
Sbjct: 361 ALRLPAGRLAVGQAADLVLFDPQGS-TLAGESWYSKGQNSPFVGHCLPGRVRYTLVDG 417


>gi|121606233|ref|YP_983562.1| allantoinase [Polaromonas naphthalenivorans CJ2]
 gi|120595202|gb|ABM38641.1| dihydroorotase [Polaromonas naphthalenivorans CJ2]
          Length = 431

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 141/434 (32%), Positives = 224/434 (51%), Gaps = 18/434 (4%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R+IDP+   D+VG + +  G I++    AL    P   L  D TG +  PG+ID
Sbjct: 3   LLIKNGRVIDPATGFDQVGDLAIAAGRIVSLNG-ALADFVPNKTL--DATGCIVAPGLID 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFI---KYALEEIRV 120
               L     E+   + +    AVAGG+TS++  P      LDE   +   K+  E++  
Sbjct: 60  LSARLREPGHEHEGMLESELAAAVAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRAEKMHQ 118

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
                V+P   LT  ++G+ ++EM  L E G V+F Q+ + + +TQVL+ +M+YA     
Sbjct: 119 S---RVFPLGALTRALKGEALTEMVQLTESGCVAFSQAEVPLANTQVLMRAMQYAATFGY 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            + L   +  LG +GV   G +A  LGL G+P  +ET+ L     + + TG   H   IS
Sbjct: 176 SIWLRPQELHLG-KGVAASGALATRLGLSGVPVAAETIALHTIFELMRATGARIHLCRIS 234

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
               +AL+  AKA     TC +SIN+L L + D+  ++S  ++ PPLR + +R ++ + L
Sbjct: 235 SAAGVALVAGAKAEGLNVTCDVSINSLHLTDVDIGYFDSRMRLDPPLRQQRDRDALRQGL 294

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID +VSDH+P   D K LPFAEA  G+ GLE +L  A +  +  Q  + + +  L+
Sbjct: 295 ADGTIDALVSDHSPVDEDAKTLPFAEAEPGATGLELLLGLACKWGNDSQAGMTRALAVLT 354

Query: 361 TRPAQIFNLPGGTLQT-------GTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFT 413
           + PA++     GTLQ        G  AD+ + D + +WTV+   + S  K+T F      
Sbjct: 355 SEPARVLGQTLGTLQASAGRLVKGGVADVCIFDPDSEWTVEPAALRSQGKHTPFSGHALP 414

Query: 414 GKVVRTYISGKQVY 427
           G+V  T + G+  +
Sbjct: 415 GRVRYTLVGGQVAF 428


>gi|16803877|ref|NP_465362.1| dihydroorotase [Listeria monocytogenes EGD-e]
 gi|47096558|ref|ZP_00234148.1| dihydroorotase, multifunctional complex type [Listeria
           monocytogenes str. 1/2a F6854]
 gi|224501362|ref|ZP_03669669.1| dihydroorotase [Listeria monocytogenes FSL R2-561]
 gi|254829167|ref|ZP_05233854.1| pyrC [Listeria monocytogenes FSL N3-165]
 gi|254899466|ref|ZP_05259390.1| dihydroorotase [Listeria monocytogenes J0161]
 gi|254912395|ref|ZP_05262407.1| dihydroorotase [Listeria monocytogenes J2818]
 gi|254936722|ref|ZP_05268419.1| pyrC [Listeria monocytogenes F6900]
 gi|21542200|sp|Q8Y663|PYRC_LISMO RecName: Full=Dihydroorotase; Short=DHOase
 gi|16411291|emb|CAC99915.1| pyrC [Listeria monocytogenes EGD-e]
 gi|47015090|gb|EAL06033.1| dihydroorotase, multifunctional complex type [Listeria
           monocytogenes str. 1/2a F6854]
 gi|258601577|gb|EEW14902.1| pyrC [Listeria monocytogenes FSL N3-165]
 gi|258609319|gb|EEW21927.1| pyrC [Listeria monocytogenes F6900]
 gi|293590377|gb|EFF98711.1| dihydroorotase [Listeria monocytogenes J2818]
          Length = 426

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 137/425 (32%), Positives = 224/425 (52%), Gaps = 7/425 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N ++++ S  + E   ++++NG +    AD++     TS    D TG +  PG ID
Sbjct: 2   YVLKNGQVLNASGKL-ESKDVLIQNGKVNLI-ADSIEV---TSGEEFDATGKLITPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T +K A  GG T+I  MP       D    ++    +I+  + 
Sbjct: 57  VHVHLREPGGEHKETILTGTKAAARGGYTTICSMP-NTKPVPDSKEVMESIQAKIKETAK 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +   L+E G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDFEALKEAGAFAFTDDGVGVQLAGTMYEAMKRAAALDMAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++GI A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGIFAEKEGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E  +   +   K+ PPLRS+ +R +++E L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEAIPGNDGNWKMNPPLRSKEDRAALLEGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F    + +LK+LI  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEQAAFGIVGLETAFPLLYTHFVKTNEWTLKQLIDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ F LP G L+ G+ ADI ++DL  +  +  D   S  KNT F  E   G  V T+  
Sbjct: 356 PAECFKLPYGKLEEGSVADIVVLDLEKEANIDPDTFYSKGKNTPFVGETCIGWPVATFAE 415

Query: 423 GKQVY 427
           G  VY
Sbjct: 416 GTLVY 420


>gi|290893034|ref|ZP_06556023.1| dihydroorotase [Listeria monocytogenes FSL J2-071]
 gi|290557394|gb|EFD90919.1| dihydroorotase [Listeria monocytogenes FSL J2-071]
          Length = 426

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 137/425 (32%), Positives = 226/425 (53%), Gaps = 7/425 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N ++++ S ++ E   ++++NG +    AD++     TS    D TG +  PG ID
Sbjct: 2   YVLKNGQVLNASGEL-ENKDVLIQNGKVNLI-ADSIEV---TSGEEFDATGKLIAPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T ++ A  GG T+I  MP       D    ++    +I+  + 
Sbjct: 57  VHVHLREPGGEHKETILTGTQAAARGGYTTICSMP-NTKPVPDSKEVMENLQAKIKETAE 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +   L+E G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDFEALKEVGAFAFTDDGVGVQLAGTMYEAMKRAAALDMAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++GI A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGIFAEKEGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E  +   +   K+ PPLRS+ +R +++E L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEAIPGNDGNWKMNPPLRSKADRAALLEGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F    + +LK+LI  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEQAAFGIVGLETAFPLLYTHFVKTNEWTLKQLIDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ FNLP G L+ G+ ADI ++DL  + T+      S  KNT F  E   G  V T+  
Sbjct: 356 PAECFNLPYGKLEEGSVADIVVLDLEKEATIDPATFYSKGKNTPFAGETCIGWPVATFAE 415

Query: 423 GKQVY 427
           G  VY
Sbjct: 416 GTLVY 420


>gi|330963804|gb|EGH64064.1| dihydroorotase [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 423

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 137/421 (32%), Positives = 212/421 (50%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP+  +D+   + +E G ++A GA    A F  + +I D TGLVA PG++D  V+
Sbjct: 7   GARVIDPASGLDQTTDLHIEAGKLVAIGA--APAGFEPTQVI-DATGLVAAPGLVDLNVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ A+AGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAIAGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++ 
Sbjct: 123 PVGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           DH L   G+ ++G  A +LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DHDLAEGGLAHDGPTAAFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVEDGLLDLPTLLARLSSGPAGAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G  ADI L D     TV  +   S   N  F      G V  T + G+  Y
Sbjct: 363 RLPAGKLSAGAPADIVLFD-PAASTVAGETWLSKGDNCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|160931532|ref|ZP_02078927.1| hypothetical protein CLOLEP_00364 [Clostridium leptum DSM 753]
 gi|156869403|gb|EDO62775.1| hypothetical protein CLOLEP_00364 [Clostridium leptum DSM 753]
          Length = 424

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 135/428 (31%), Positives = 217/428 (50%), Gaps = 8/428 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M S ++   ++ DP +   E   ++  NG+I        N + P    + D   L  +PG
Sbjct: 1   MGSILIRGAKLADPEKICCERLDLLCRNGVIEKIEK---NIQDPADKTV-DAQSLALLPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D  V L      Y +++ T  + A AGG+TS++ MP      +D    ++  L+    
Sbjct: 57  LVDMHVHLRDPGLTYKEDVFTGCRAAAAGGVTSLLAMP-NTKPPMDSPALVEELLQRAE- 114

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +   VYP  C+T  M+G+E++    LQ+ G V+       + ++ ++  +MK A  L  
Sbjct: 115 SACCRVYPAVCITKGMKGEELAPFMELQKAGAVALTDDGRPVENSLLMARAMKEAASLGL 174

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V     D +L   G++NEG ++  L + G+P+ SE    AR++ +A+  G   H   +S
Sbjct: 175 RVVSHCEDLYLSQGGLMNEGAVSRELNVPGVPAASENAATAREIALAESYGVPIHICHVS 234

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S A+I+ AK    + T   + + L+L E  +   N+  ++ PPLR++ +R +++EAL
Sbjct: 235 TAVSAAMIRDAKKRGVQVTGETAPHYLLLTEEALRKKNADWRMSPPLRTDEDRKALLEAL 294

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRAL 359
             G +D I +DH P H +     F  A  GSIG+ET LSA    L     ++L +LI  +
Sbjct: 295 RDGTLDAIATDHAP-HSEEDKADFYRAPNGSIGMETALSACYTALVKTGYLTLPELIAKM 353

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           S  PA++  LPGGTL+ G  AD AL D N +WTV  D +    KNT F     +GKVV T
Sbjct: 354 SLNPARLLKLPGGTLRAGGPADFALFDENRRWTVDRDRLHGRSKNTPFHGMSLSGKVVMT 413

Query: 420 YISGKQVY 427
              G+ VY
Sbjct: 414 VCRGEIVY 421


>gi|326796928|ref|YP_004314748.1| dihydroorotase [Marinomonas mediterranea MMB-1]
 gi|326547692|gb|ADZ92912.1| dihydroorotase, multifunctional complex type [Marinomonas
           mediterranea MMB-1]
          Length = 426

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 126/422 (29%), Positives = 215/422 (50%), Gaps = 4/422 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N R+IDPS+D+D V  + +E+  +++ G       F    +I D      +PG++D  V 
Sbjct: 7   NGRVIDPSQDLDAVIDVFIEDHKVVSIGE--APEGFDADEII-DAADRWVLPGLVDIAVA 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         NI T  + A++GG+T+++  P      +D         ++     + NV+
Sbjct: 64  LREPGYTQKGNIATEGRAAISGGVTTLV-SPPDTKPIVDTPAVAALIQDKADQAGMANVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   LT  ++G ++S M  L + G V+       + +T VL  +++YA   + +V     
Sbjct: 123 PIGALTKGLQGDQLSNMVALTDAGCVALSNHRRPMRNTLVLSRALEYAATHDLLVVFHPD 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           +  L   G  +EG+++   GL GIP  +ET+ L RDLL+ + TG   H + +S  +S+ +
Sbjct: 183 ESSLSEGGCAHEGMMSTVHGLAGIPETAETIALMRDLLLVEKTGVRAHFARLSCAKSVEM 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+      T  ++++NL+L +  +  ++    V+PPLRSE +R++++E +++G I  
Sbjct: 243 IADAQESGLPVTADVALHNLLLTDEVLNEFDGQFHVIPPLRSENDRLTLIEGIKRGAIRS 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I SDH P     K+ PFA    G   +E +L  AL+L     +SL  +I+ L+  PA  F
Sbjct: 303 ICSDHQPHEKMAKVAPFAATEPGMANVEILLPLALQLMDEGDLSLTDVIKTLTCGPASCF 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            L  G+L+ G+ AD  L D    W        S   N+ FD    TG+V +TY+SG+ +Y
Sbjct: 363 GLEAGSLKPGSFADFILFDSTQTWVWDDSSRRSKGHNSAFDGVELTGRVTQTYVSGQCIY 422

Query: 428 TL 429
           + 
Sbjct: 423 SF 424


>gi|251771865|gb|EES52439.1| dihydroorotase, multifunctional complex type [Leptospirillum
           ferrodiazotrophum]
          Length = 432

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 136/427 (31%), Positives = 216/427 (50%), Gaps = 7/427 (1%)

Query: 3   SFVLNNTRIIDPSRDI-DEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGI 61
           + ++ N  + DP+  I    G ++V++G I  AG        P+     D  G V  PG 
Sbjct: 8   NLLITNVTLFDPAEGILGGEGPLLVKDGRIAPAGT-----PIPSGTPELDGRGGVLCPGF 62

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           +D          EY + I + S+ A AGG TS+ +M    S   D     +  L+  R  
Sbjct: 63  VDLHAHFREPGFEYKETIASGSRAAAAGGFTSVCVM-ANTSPVNDNDAITRAILDRAREV 121

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           +L+ V+P   +T  +EG+E++EM  L   G V+F      +    ++  +++Y+ +    
Sbjct: 122 NLVRVFPIGAVTRGLEGQELTEMGALASAGCVAFSDDGRPVSTALMMRRALEYSRIFGRP 181

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V     D  L +RGV+NEG ++  LGL GIP+ SE V +ARDL + +  GG  H + +S 
Sbjct: 182 VIDHCEDLVLSNRGVMNEGSVSAELGLAGIPNASEEVSIARDLSVLELAGGRLHVAHLST 241

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
              + L++ AK  +   T     +   L +  V  + +  K+ PPLR E +R++++E L+
Sbjct: 242 AGGVRLVREAKRRHLPVTAETCPHYFALTDEAVLCHGTHAKMNPPLRREEDRLAVIEGLK 301

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID+I +DH P     K   F  A FG IGLET  S +L L     ++  +LI  LST
Sbjct: 302 DGTIDVIATDHAPHASHEKEQEFDRAPFGIIGLETAFSLSLELVREGALTFSELIYRLST 361

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           RPA++F LP G L+TG  AD+ L+DL+ +W        S  +N+ F      G+V  T +
Sbjct: 362 RPAELFGLPRGCLRTGGLADLVLLDLSGEWEAGRPGYRSKSRNSPFTGRRMKGRVAATIV 421

Query: 422 SGKQVYT 428
            G+ V++
Sbjct: 422 GGRVVFS 428


>gi|313632746|gb|EFR99715.1| dihydroorotase [Listeria seeligeri FSL N1-067]
          Length = 426

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 138/426 (32%), Positives = 225/426 (52%), Gaps = 7/426 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N +I++ + ++ E   ++++NG +    AD+++    TS  + D T  V  PG ID
Sbjct: 2   YVLKNGQILNEAGEL-ENKDVLIQNGKVNLI-ADSIDV---TSGEVFDVTDKVIAPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T +K A  GG T+I  MP       D    ++    +I   + 
Sbjct: 57  VHVHLREPGGEHKETILTGTKAAARGGYTTICSMP-NTKPVPDSKQIMESLQAKINETAQ 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +M  L+E G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDMEALKEAGAFAFTDDGVGVQLAGTMYEAMKRAAKLDMAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++GI A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGIFAEKAGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E D+   +   K+ PPLRS+ +R +++E L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEDIPGNDGNWKMNPPLRSKEDRAALLEGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQI-SLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F    + +LK+L+  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEKAAFGIVGLETAFPLLYTHFVKTNVWTLKQLVDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA  FNLP G L+ G  ADI ++DL  +         S  KNT F  E   G  V T+  
Sbjct: 356 PAACFNLPYGKLEEGKVADIVVLDLAKESKXXPATFYSKGKNTPFVGEACIGWPVATFAE 415

Query: 423 GKQVYT 428
           G  VY+
Sbjct: 416 GTLVYS 421


>gi|319778589|ref|YP_004129502.1| Dihydroorotase [Taylorella equigenitalis MCE9]
 gi|317108613|gb|ADU91359.1| Dihydroorotase [Taylorella equigenitalis MCE9]
          Length = 428

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 138/429 (32%), Positives = 220/429 (51%), Gaps = 5/429 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL+N R++DP+   D +  +I+E G +     D     +   A   D +G V +PG++D
Sbjct: 3   YVLDNARLLDPASGNDGIATLIIEEGKVSKIIKDKSTDNY-AEAQKFDLSGKVIMPGLVD 61

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L G  D Y  N+      AVAGGITS++L P      LDE   +   L   +   L
Sbjct: 62  LCSHLKGGNDPY-HNLNRELNAAVAGGITSLVLSP-DTQPILDEPGLVDTILRNAQDMGL 119

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             VYP   LT  +EG+ ++ M  L+  G + F QS   + +   L  +M+YA   +  + 
Sbjct: 120 SKVYPLGALTMGLEGEVLAPMATLKNAGCIGFSQSNNPLINLSTLNRAMRYARTHHLALW 179

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   +  L + GV+  G  A+ LGL GIP  +ET+ L     + + T    H S ++  +
Sbjct: 180 LQASEPNLTADGVMASGAYASRLGLKGIPVQAETIALNTLFALQKSTMTTLHISNLTSAE 239

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
            I++++ AK      TC +SINNL   + DV  ++S  ++ PPLRS+ +R ++ E L  G
Sbjct: 240 GISIVREAKKQGLPVTCDVSINNLTFIDQDVGFFDSHFRLSPPLRSQKDRSAITEGLLDG 299

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID I S+H     D K +PFAEA  G++G E +LS+ ++      ++L   I  +S +P
Sbjct: 300 TIDAISSNHMSVSSDHKQVPFAEAQAGAVGFELLLSSVIKWSLQNNVALLDAISFISNKP 359

Query: 364 AQIFN--LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            QI +  L  G++  G  AD+  +DL  +W   +D +SS++ +T F       KV  T++
Sbjct: 360 GQILSKQLNLGSIHEGMPADLICVDLETEWVPSSDTLSSLNYHTPFLNYPLPAKVNMTFV 419

Query: 422 SGKQVYTLE 430
            GK V+  E
Sbjct: 420 GGKLVFNRE 428


>gi|237748810|ref|ZP_04579290.1| dihydroorotase [Oxalobacter formigenes OXCC13]
 gi|229380172|gb|EEO30263.1| dihydroorotase [Oxalobacter formigenes OXCC13]
          Length = 430

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 144/431 (33%), Positives = 225/431 (52%), Gaps = 12/431 (2%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNA--KFPTSALIHDCTGLVAVPGI 61
            ++ N R+IDP+  ID +  I + +G +LA   DA  A   F     I D  GLV  PG 
Sbjct: 3   LLIANGRLIDPANGIDGIKNIAIADGKVLAV-EDAGKAIENFTPDRTI-DALGLVVSPGF 60

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           +D    L     E+   + +  + A+ GG+TS++  P      LDE   ++         
Sbjct: 61  VDLSARLREPGYEHKATLASEMQAAMQGGVTSLVCPP-DTDPVLDEPGLVEMLKYRAAAL 119

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           +  +VYP   LT  ++G+ ++EM  L + G + F Q+   I DT+VLL +++YA+  N  
Sbjct: 120 NQAHVYPLGALTVGLKGQALTEMAELTDAGCIGFSQANEPIIDTEVLLRALQYANSFNYS 179

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
             L   D +L  +G+ + G +A  LGL GI  I+ET+ L     + + TG   H   +S 
Sbjct: 180 TWLQPEDPYLSKKGMAHSGPVAARLGLSGISYIAETIRLHTIFELIRVTGARIHLGRLSS 239

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
            + I L++ AK      TC + I+++ L E+D++ +++  ++ PPLRS  +R+++ E L 
Sbjct: 240 AEGIELVRQAKKDGLPVTCDVGIHHIHLTEDDIDFFDTNARMTPPLRSRADRLAITEGLL 299

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQI-----SLKKLI 356
            G ID I SDHTP   D KLLPF EA+ G+ GLE +LS  L+   GQ +     +L K I
Sbjct: 300 DGTIDAICSDHTPVDDDEKLLPFGEATPGATGLELLLSLTLKW--GQSLENDPSNLSKAI 357

Query: 357 RALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
             +++ PA I     G L  G  ADI + D +  WTV+A  ++S  K+T F      G+V
Sbjct: 358 AKITSDPAGILGKNCGKLSVGDKADICVFDPSESWTVEASKLASQGKHTPFLGREIPGRV 417

Query: 417 VRTYISGKQVY 427
             T + GK  +
Sbjct: 418 RLTIVEGKVTF 428


>gi|73540415|ref|YP_294935.1| dihydroorotase [Ralstonia eutropha JMP134]
 gi|72117828|gb|AAZ60091.1| dihydroorotase [Ralstonia eutropha JMP134]
          Length = 448

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 143/422 (33%), Positives = 218/422 (51%), Gaps = 5/422 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+ ++D    + +  G I+  G+    A F  +  I D  GL+  PG++D  
Sbjct: 24  IQGGRLIDPAANLDAQQDLYIAAGKIVGVGS--APADFTANKTI-DARGLIVCPGLVDLS 80

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
             L     EY   + +    A AGG+TS+ L P      LDE   ++      R  +  +
Sbjct: 81  ARLREPGYEYKATLESEVAAAAAGGVTSL-LCPPDTDPVLDEPGLVEMLKFRARTLNQTH 139

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT  ++G+ ++EM  L E G V F Q+   + +TQVLL +++YA      V L 
Sbjct: 140 VYPLGALTQGLKGEVLTEMNQLTEAGCVGFSQAEAPVRNTQVLLRALQYAQTFGFTVWLR 199

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D FLG  GV   G +A+ LGL G+  I+ETV L     + + +G   H   +S    +
Sbjct: 200 PEDPFLGG-GVAASGAVASRLGLSGVSVIAETVRLHTIFELMRASGARVHLCRLSTAAGL 258

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L++ AK      TC ++I+++ L + D+  +NS  +  PPLRS  +R ++V AL  G I
Sbjct: 259 ELVRQAKREGLAVTCDVNIHHVSLTDMDIGYFNSQMRFSPPLRSARDRDAIVAALADGTI 318

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
           D + SDHTP   D KLLPFAEA+ G+IGLE +L   LR     ++ LK  +  +++ PA+
Sbjct: 319 DALCSDHTPVDDDEKLLPFAEATPGAIGLELLLPLTLRWAAEHKVPLKTALARITSEPAR 378

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           +  L  GTL +G  ADI + D    W V    + S  KN+ +      G+V  T + G+ 
Sbjct: 379 VAGLKAGTLASGAVADICVFDPKEVWKVDRQSIKSQGKNSPWLGYEMEGRVRMTLVGGQV 438

Query: 426 VY 427
           VY
Sbjct: 439 VY 440


>gi|116054132|ref|YP_788575.1| dihydroorotase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115589353|gb|ABJ15368.1| noncatalytic dihydroorotase-like protein noncataly [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 423

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 136/418 (32%), Positives = 208/418 (49%), Gaps = 5/418 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  +D+VG + +E G I+A GA    A F     + D  GLVA PG++D  
Sbjct: 5   IRGARVIDPASGLDQVGDLHIEAGKIVAIGA--APAGFSAQKTL-DGAGLVAAPGLVDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L         N+ + ++ A AGG TS+   P      LD     +  L+  R      
Sbjct: 62  VALREPGYGRKGNVESETRAAAAGGTTSLCCPPY-TRPVLDTPAVAELILDRAREAGNAK 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT    G+++SE+  L++ G V+F          ++L  +++YA   +  V   
Sbjct: 121 VYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASNRILRRALEYAATFDLTVIFT 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
           + D  L   G+ +EG  A++LGL GIP  +ETV LAR+LL+ + +G   H S ++  + I
Sbjct: 181 SQDTDLAEGGLAHEGPTASFLGLAGIPETAETVALARNLLLVEQSGVRAHFSQLTSARGI 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L+  A+A     TC +++  LIL +  +  ++SL  V PPLR++ +R ++ EA++ G +
Sbjct: 241 ELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLYHVQPPLRTKADREALREAVKNGVV 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
             I S H P   D K  PFA    G  G E +L  A+ L     + L  L+  LS  PAQ
Sbjct: 301 QAIASHHQPHEADAKNAPFAATEPGISGAELLLPLAMTLVQDGLLDLPTLLARLSHGPAQ 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
              LP G L  G AAD+ L D     T+  +   S  +N+ F      G+V  T + G
Sbjct: 361 ALRLPAGRLAVGQAADLVLFDPQGS-TLAGESWYSKGQNSPFVGHCLPGRVRYTLVDG 417


>gi|77461536|ref|YP_351043.1| dihydroorotase [Pseudomonas fluorescens Pf0-1]
 gi|77385539|gb|ABA77052.1| dihydroorotase-like protein [Pseudomonas fluorescens Pf0-1]
          Length = 423

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 140/417 (33%), Positives = 209/417 (50%), Gaps = 5/417 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDPS  +D++  I VE   I+A GA    A F T+    D  GLVA PG++D  V 
Sbjct: 7   GARVIDPSSGLDQITDIHVEACKIVALGA--APAGF-TAVETIDAQGLVAAPGLVDLNVA 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L          I + ++ A AGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGTIASETRAAAAGGVTSLCCPP-KTRPVLDTSAVAELILDRAREAGNTKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  ++G++++E+  L++ G V+F     S  +T+ L  ++ YA   +  V  ++ 
Sbjct: 123 PIGALSKGLDGEQLAELVALRDAGCVAFGNGLESFRNTRTLCRALDYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           DH L   G+ +EG  A++LGL GIP  +ETV LARDLL+ + TG   H S ++  + +AL
Sbjct: 183 DHDLADGGLAHEGATASFLGLPGIPETAETVALARDLLLVEQTGVRAHFSQLTSARGVAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A   K T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G +  
Sbjct: 243 IAQAQARGLKVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVVSA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS  PA+  
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVEDGLLDLPTLLSRLSAGPAEAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
            LP G L  G AADI L D     TV  +   S  +N  F      G V  T + G+
Sbjct: 363 RLPAGKLAVGGAADIVLFDPKAS-TVAGETWLSKGENCPFLGHSLPGVVRYTLVDGR 418


>gi|94311671|ref|YP_584881.1| dihydroorotase [Cupriavidus metallidurans CH34]
 gi|93355523|gb|ABF09612.1| Dihydroorotase (DHOase) [Cupriavidus metallidurans CH34]
          Length = 439

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 139/424 (32%), Positives = 218/424 (51%), Gaps = 9/424 (2%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+ ++D    + +  G I+  G    +  F  +  I D  G++  PG++D  
Sbjct: 20  IQGGRLIDPAANVDAEQDLYIAAGKIVGVGRAPTD--FHANKTI-DARGMIVCPGLVDLS 76

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL-- 123
             L     EY   + +    A AGG+TS++  P      LDE   ++  + + R   L  
Sbjct: 77  ARLREPGYEYKATLESELAAATAGGVTSLVCPP-DTDPVLDEPGLVE--MLKFRAHKLNQ 133

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
            +VYP   LT  ++G  ++EM  L E G V F Q+   IHDT+VL  +M+YA      + 
Sbjct: 134 THVYPLGALTVGLKGDALTEMGQLTEAGCVGFSQAEAPIHDTKVLQRAMQYAQTFGFTLW 193

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   D FLG  GV   G +A+ LGL G+  I+ETV L     + + TG   H   +S   
Sbjct: 194 LRPEDPFLGG-GVAASGAVASRLGLSGVSVIAETVRLHTIFELIRATGARVHLCRLSSAA 252

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
            + L++ A+      TC ++I+++ L + D+  +NS  +  PPLR   +R ++V AL  G
Sbjct: 253 GLELVRQARKEGLPVTCDVNIHHVSLTDMDIGFFNSQMRFTPPLRGARDRDAIVAALADG 312

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID + SDHTP   D KLLPFAEAS G+ GLE +L   LR     ++ L + +  +++ P
Sbjct: 313 TIDALCSDHTPVDDDEKLLPFAEASPGATGLELLLPLTLRWASEHKVPLVRALARITSEP 372

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++  L  G+L TG+ AD+ + D    W V+   + S  KN+ +      G+V  T + G
Sbjct: 373 ARVIGLNVGSLTTGSMADVCVFDPKQLWKVERSVLKSQGKNSPWLGYEMEGRVRTTLVCG 432

Query: 424 KQVY 427
           + VY
Sbjct: 433 QVVY 436


>gi|289624699|ref|ZP_06457653.1| dihydroorotase [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289647571|ref|ZP_06478914.1| dihydroorotase [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330865799|gb|EGH00508.1| dihydroorotase [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 423

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 139/421 (33%), Positives = 210/421 (49%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP   +D+V  + VE G + A GA A     PT  +  D  GLVA PG++D  V+
Sbjct: 7   GARVIDPVSGMDQVTDLHVEAGKLTAIGA-APEGFEPTQTI--DAAGLVAAPGLVDLNVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAVAGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S ++T+ L  +++YA   +  V  ++ 
Sbjct: 123 PVGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFNNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ ++G  A +LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DRDLAEGGLAHDGATAAFLGLAGIPETAETVALARDLLLVEQSGARAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  LI  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVDDGLLDLPTLIARLSSGPAAAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G  ADI L D     TV  +   S  +N  F      G V  T + G+  Y
Sbjct: 363 RLPAGKLSAGAPADIVLFD-PAASTVAGETWLSKGENCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|325527149|gb|EGD04552.1| dihydroorotase [Burkholderia sp. TJI49]
          Length = 428

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 136/420 (32%), Positives = 215/420 (51%), Gaps = 7/420 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILA-AGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLT 69
           +IDP    +    + +  G I A A A    A F     I D +GL+  PG++D    L 
Sbjct: 10  LIDPVAGSERQADVFISGGKIDAIAEAGRAPAGFAADKTI-DASGLIVAPGLVDLCARLR 68

Query: 70  GSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVY 127
               E+   + +    AVAGG+T+++  P      LDE   ++  + + R ++L   NV+
Sbjct: 69  EPGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQANVH 125

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   LT  ++G+ I+EM  L E G   F  + + + DTQVLL +++YA        L   
Sbjct: 126 PLGALTVGLKGEVITEMVALTESGCAGFTHANVPVRDTQVLLRALQYASTYGFTTWLRPL 185

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL
Sbjct: 186 DAFIGKGGVAASGPVASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLAL 245

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           ++ AKA     +C + +N+L L + D+  ++S  ++ PPLRSE +R ++  AL  G ID 
Sbjct: 246 VRAAKAEGLPVSCDVGVNHLHLIDVDIGYFDSQFRLDPPLRSERDREAIRAALADGTIDA 305

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I SDHTP   D KLLPF EA+ G+ GLE +LS  ++     +  L + +R +++ PA + 
Sbjct: 306 ICSDHTPVDDDEKLLPFGEATPGATGLELLLSLTVKWADETRTPLAQALRRITSAPADVL 365

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G AAD+ + D    W V+   + S   N+ F        V  T ++G+  +
Sbjct: 366 KLPAGRLAEGGAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPACVRATLVAGQIAF 425


>gi|218889143|ref|YP_002438007.1| dihydroorotase [Pseudomonas aeruginosa LESB58]
 gi|254243501|ref|ZP_04936823.1| noncatalytic dihydroorotase-like protein [Pseudomonas aeruginosa
           2192]
 gi|126196879|gb|EAZ60942.1| noncatalytic dihydroorotase-like protein [Pseudomonas aeruginosa
           2192]
 gi|218769366|emb|CAW25126.1| noncatalytic dihydroorotase-like protein [Pseudomonas aeruginosa
           LESB58]
          Length = 423

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 136/418 (32%), Positives = 207/418 (49%), Gaps = 5/418 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  +D+VG + +E G I+A GA    A F     + D  GLVA PG++D  
Sbjct: 5   IRGARVIDPASGLDQVGDLHIEAGKIVAIGA--APAGFSAQKTL-DGAGLVAAPGLVDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L         N+ + ++ A AGG TS+   P      LD     +  L+  R      
Sbjct: 62  VALREPGYGRKGNVESETRAAAAGGTTSLCCPPY-TRPVLDTPAVAELILDRAREAGNAK 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT    G+++SE+  L++ G V+F          ++L  +++YA   +  V   
Sbjct: 121 VYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASNRILRRALEYAATFDLTVIFT 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
           + D  L   G+ +EG  A++LGL GIP  +ETV LAR+LL+ + +G   H S ++  + I
Sbjct: 181 SQDTDLAEGGLAHEGPTASFLGLAGIPETAETVALARNLLLVEQSGVRAHFSQLTSARGI 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L+  A+A     TC +++  LIL +  +  ++SL  V PPLR+  +R ++ EA++ G +
Sbjct: 241 ELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLYHVQPPLRTRADREALREAVKNGVV 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
             I S H P   D K  PFA    G  G E +L  A+ L     + L  L+  LS  PAQ
Sbjct: 301 QAIASHHQPHEADAKNAPFAATEPGISGAELLLPLAMTLVQDGLLDLPTLLARLSHGPAQ 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
              LP G L  G AAD+ L D     T+  +   S  +N+ F      G+V  T + G
Sbjct: 361 ALRLPAGRLAVGQAADLVLFDPQGS-TLAGESWYSKGQNSPFVGHCLPGRVRYTLVDG 417


>gi|326203547|ref|ZP_08193411.1| dihydroorotase, multifunctional complex type [Clostridium
           papyrosolvens DSM 2782]
 gi|325986367|gb|EGD47199.1| dihydroorotase, multifunctional complex type [Clostridium
           papyrosolvens DSM 2782]
          Length = 428

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 126/425 (29%), Positives = 226/425 (53%), Gaps = 6/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
             ++ +  I+D    +D V  I++ +GII   G++   A       + D  GL  +PG++
Sbjct: 2   KLLIKDGNIMDVKTGLDSVQDILIVDGIIHDIGSEIDEA----GCEVIDAKGLQVIPGLV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           DA   L     EY ++I T ++ A  GG TS+  MP   +  LD    +KY + + ++  
Sbjct: 58  DAHCHLRDPGYEYKEDIETGTRSAAKGGFTSVACMP-NTNPVLDNEAMVKYVINKAKIDG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++NV+P   L+  ++G+E+SE+  L+  G V+       + ++ ++  +M+YA M +  +
Sbjct: 117 IVNVFPIGALSKGLKGEELSEIGELKFAGAVALSDDGRPVGNSSLMKKAMQYASMFDITI 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G++NEG  ++ LGL G P+ +E V +ARDL++A++T    H + +S  
Sbjct: 177 ISHCEDLDLVDEGLMNEGFQSSILGLKGNPAPAEEVMIARDLILAEYTKATIHIAHVSTE 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
             + LI++AK    + T     +   L ++  E +N+  KV PPLR++ +  ++++ L+ 
Sbjct: 237 LGVDLIRNAKKRGVRVTAETCPHYFTLTDSACEGFNTNAKVNPPLRTQKDVDAIIQGLKD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALST 361
           G IDII +DH P H+D K + F  A+ G +G ET    A+  L     ++LK+L+  +S 
Sbjct: 297 GTIDIISTDHAPHHIDEKNVEFKNAANGMVGFETAFPLAITYLVKPGHLTLKELVYKMSF 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            P+Q+  L  GT++ G  AD+ + D++ Q+ V   +  S  KN+ F+     G+   T +
Sbjct: 357 NPSQMLGLNKGTIEVGKLADLMIFDIDEQYKVDITNFESKGKNSPFNGFSLYGQPQYTIV 416

Query: 422 SGKQV 426
            G  V
Sbjct: 417 GGSPV 421


>gi|327441132|dbj|BAK17497.1| dihydroorotase [Solibacillus silvestris StLB046]
          Length = 424

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 140/424 (33%), Positives = 217/424 (51%), Gaps = 8/424 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V+ N ++++   ++  V  I++ENG I +     +N   P  A + D  G  A PG +D 
Sbjct: 4   VIQNVKLLNEEGEL-VVSTIVIENGKIAS-----INGDIPAGATVIDGNGHFASPGFVDV 57

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
              L     E+ + I T S  A  GG T+I  MP       D    ++     I+  ++I
Sbjct: 58  HTHLREPGFEHKETIATGSASAAKGGFTTICAMP-NTKPVPDSVENMQLINGLIKESAVI 116

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
            V P   LT ++ G+  + M+ L+EQG V+F    + I     +   M+ A  L+A+V  
Sbjct: 117 RVLPYGSLTKDISGEVRTNMQELKEQGAVAFSDDGIGIQLASTMYEQMQQAAKLDAVVVA 176

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D+ L   GV++EG     LGL GIPSI E+V +ARD+L+A+  G  YH   +S  +S
Sbjct: 177 HCEDNSLIYDGVMHEGKRNKELGLPGIPSICESVQIARDVLLAEAAGARYHVCHVSTKES 236

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           +  ++ AKA   K T  +  ++L+L E D+   ++  K+ PPLR+  ++ S+  AL  G 
Sbjct: 237 VRAVRDAKAAGIKVTAEVCPHHLLLEEMDIPSDDANWKMNPPLRAADDKDSLHAALLDGT 296

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTRP 363
           ID I +DH P   + K      A FG +G ET        F    + +LK+L+  +S + 
Sbjct: 297 IDCIATDHAPHTAEEKCCGMVGAPFGIVGFETAFPLLYTNFVETGKWTLKQLVDWMSVKA 356

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           AQIF+LP GTL+ G +AD+ LIDL+ + T+ A+   S  +NT F+     G  V T   G
Sbjct: 357 AQIFDLPYGTLEVGASADLVLIDLDKEQTIDAEGFVSKGRNTPFNGWTAKGWPVVTMFEG 416

Query: 424 KQVY 427
             VY
Sbjct: 417 NIVY 420


>gi|224500068|ref|ZP_03668417.1| dihydroorotase [Listeria monocytogenes Finland 1988]
 gi|254831562|ref|ZP_05236217.1| dihydroorotase [Listeria monocytogenes 10403S]
 gi|284802283|ref|YP_003414148.1| dihydroorotase [Listeria monocytogenes 08-5578]
 gi|284995425|ref|YP_003417193.1| dihydroorotase [Listeria monocytogenes 08-5923]
 gi|284057845|gb|ADB68786.1| dihydroorotase [Listeria monocytogenes 08-5578]
 gi|284060892|gb|ADB71831.1| dihydroorotase [Listeria monocytogenes 08-5923]
          Length = 426

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 136/425 (32%), Positives = 225/425 (52%), Gaps = 7/425 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N ++++ S ++ E   ++++NG +    AD++     TS    D TG +  PG ID
Sbjct: 2   YVLKNGQVLNASGEL-ENKDVLIQNGKVNLI-ADSIEV---TSGEEFDATGKLIAPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T ++ A  GG T+I  MP       D    ++    +I+  + 
Sbjct: 57  VHVHLREPGGEHKETILTGTQAAARGGYTTICSMP-NTKPVPDSKEVMENLQAKIKETAE 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +   L+E G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDFEALKEAGAFAFTDDGVGVQLAGTMYEAMKRAAALDMAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++GI A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGIFAEKEGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E  +   +   K+ PPLRS+ +R +++E L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEAIPGNDGNWKMNPPLRSKEDRAALLEGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F    + +LK+LI  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEQAAFGIVGLETAFPLLYTHFVKTNEWTLKQLIDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ F LP G L+ G+ ADI ++DL  +  +  D   S  KNT F  E   G  V T+  
Sbjct: 356 PAECFKLPYGKLEEGSVADIVVLDLEKEANIDPDTFYSKGKNTPFVGETCIGWPVATFAE 415

Query: 423 GKQVY 427
           G  VY
Sbjct: 416 GTLVY 420


>gi|313895678|ref|ZP_07829234.1| amidohydrolase family protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975804|gb|EFR41263.1| amidohydrolase family protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 430

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 131/427 (30%), Positives = 224/427 (52%), Gaps = 6/427 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +L    +IDP    +EV  +++ENGII   G    N K P  A ++D TG +  PG
Sbjct: 1   MSTLLLKGGTVIDPGSKRNEVSDVLIENGIIQKVGK---NLKSP-DAEVYDATGKIVAPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +ID  V       E  ++  + S+   AGG T++  MP   S  +D    ++   +    
Sbjct: 57  LIDMHVHFREPGQEAKEDFASGSRAGAAGGYTTVATMP-NTSPVVDTAALVRSLQKRAED 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            S+I+++    +T N EG+E++E+  + E G V+F          +VLL++  Y    + 
Sbjct: 116 VSVIHIHIIGAVTKNQEGRELAELGDMVEAGAVAFSDDGHFDPSAKVLLSAYDYLVPFDK 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +     D+ L   G +NEG  +  LG+ G P+++E + +ARD+++A++ G H H + IS
Sbjct: 176 AIINHEEDNSLVEDGAMNEGHRSAMLGIKGRPTVAEDIAVARDVMLAEYAGAHVHVAHIS 235

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++ +++ AKA   + T  ++ ++L + +  V   +S  KV PPLR++ +  +MV  L
Sbjct: 236 SARAVQIVREAKARGVRVTTEVTPHHLTMTDECVNPVDSSTKVNPPLRTQKDVDAMVAGL 295

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRAL 359
             G ID+IV+DH+P   + K   +  A  G  GLET L   L  L H  ++ ++ +I  +
Sbjct: 296 ADGTIDMIVTDHSPHEREDKDREYVYAPSGFPGLETALGVVLTDLVHTGKMDMETVIERM 355

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           S  PA++F L  GTL  G  AD+ +ID    WTV+A+   +   ++ F      GK V T
Sbjct: 356 SYAPARVFRLNAGTLNEGAPADVVVIDPQRLWTVEAEKFYTRGSHSPFVGRKLKGKAVLT 415

Query: 420 YISGKQV 426
            + G+ V
Sbjct: 416 VVDGEIV 422


>gi|186477074|ref|YP_001858544.1| dihydroorotase [Burkholderia phymatum STM815]
 gi|184193533|gb|ACC71498.1| dihydroorotase, multifunctional complex type [Burkholderia phymatum
           STM815]
          Length = 425

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 135/417 (32%), Positives = 211/417 (50%), Gaps = 4/417 (0%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP    ++   + +  G I+A G     A F  +  I D  GL   PG +D    L  
Sbjct: 10  LIDPVAGTEQQQDVFIAAGKIVALGN--APADFSAARTI-DAKGLYVAPGFVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    A+AGG+TS++  P      LDE   I+      R  +  +VYP  
Sbjct: 67  PGYEHKATLESEMAAALAGGVTSLVCPP-DTDPVLDEPGLIEMLKFRARNLNRAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+   I DTQVLL +++YA      V L   D +
Sbjct: 126 ALTVGLKGQVITEMVALTESGCIGFSQADTPIVDTQVLLRALQYAKTYGYTVWLRPQDAY 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           L   GV   G +A+ LGL G+P  +ET+ L     + + TG   H S +S    + L++ 
Sbjct: 186 LAKGGVAASGPLASRLGLSGVPVSAETIALHTIFELVRVTGARVHLSHVSSAAGVELMRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     +C ++IN++ L + D+  +++  ++ PPLRS+ +R ++   L  G ID I S
Sbjct: 246 AKAEGLPVSCDVTINHVHLIDVDIGYFDAQFRLDPPLRSQRDREAIRAGLLDGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP 370
           DHTP   D KLLPFAEA+ G+ GLE +LS  ++      I L K +  ++  PA +  LP
Sbjct: 306 DHTPVDDDEKLLPFAEATPGATGLELLLSLTVKWADEAGIPLAKALNRITAAPAGVLKLP 365

Query: 371 GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            G ++ G  AD+ + D +  W ++   + S   NT F       +V  T +SG+  +
Sbjct: 366 AGRIEAGATADLCVFDRDVHWRIEPRALKSQGHNTPFLGYELPARVRATVVSGQVAF 422


>gi|315282841|ref|ZP_07871160.1| dihydroorotase [Listeria marthii FSL S4-120]
 gi|313613511|gb|EFR87336.1| dihydroorotase [Listeria marthii FSL S4-120]
          Length = 426

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 136/425 (32%), Positives = 223/425 (52%), Gaps = 7/425 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N ++++ S ++ E   ++++NG +    AD++     TS    D TG +  PG ID
Sbjct: 2   YVLKNGQVLNESGEL-ENKDVLIQNGKVNLI-ADSIEV---TSGKEFDATGKLIAPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T ++ A  GG T+I  MP       D    +     +I+  + 
Sbjct: 57  VHVHLREPGGEHKETILTGTQAAARGGYTTICSMP-NTKPVPDSKEVMASLQAKIKETAE 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +   L+E G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDFEALKEAGAFAFTDDGVGVQLAGTMYEAMKRAAALDMAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++GI A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGIFAEKEGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E D+   +   K+ PPLRS+ +R +++E L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEDIPGNDGNWKMNPPLRSKADRAALLEGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F    + +LK+LI  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEQAAFGIVGLETAFPLLYTHFVKTNEWTLKQLIDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ F LP G L+ G  ADI ++DL  +  +      S  KNT F  E   G  V T+  
Sbjct: 356 PAECFKLPYGKLEVGVVADIVVLDLEKEANIDPATFYSKGKNTPFVGETCIGWPVATFAE 415

Query: 423 GKQVY 427
           G  VY
Sbjct: 416 GTLVY 420


>gi|300088014|ref|YP_003758536.1| dihydroorotase, multifunctional complex type [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527747|gb|ADJ26215.1| dihydroorotase, multifunctional complex type [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 430

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 136/433 (31%), Positives = 215/433 (49%), Gaps = 13/433 (3%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M S ++ N ++IDP+R ++    + V NG I A G    N +   +  + D  G +  PG
Sbjct: 1   MKSILIKNGQVIDPARGVNGRYDVAVTNGSITAIGQ---NLEPGDNHKVIDAAGKIVTPG 57

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYT--FIKYALEEI 118
            ID    L     E  + I + ++ A  GG T++  MP    +  D  +  FIK+     
Sbjct: 58  FIDLHCHLRQPGAEQKETIYSGTRAAARGGFTAVCAMPNTDPAIDDRLSADFIKHTAT-- 115

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
             +  + V P  C+T    G+ ++E+  L E G++ F     S+   ++L  +M+YA  L
Sbjct: 116 -TEGAVRVLPVGCITRGRRGERLAELGELAEAGVIGFSDDGSSVPSARLLKQAMEYARGL 174

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
           +  V     +  L   G INEGIIA  LGL GIP+ +E + +ARD+ +A  TG   H   
Sbjct: 175 DLPVLEHCEEAGLAEGGQINEGIIATRLGLAGIPAAAEEMIIARDIALASLTGARLHLCH 234

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           +S    +A+I+ AKA   + T  ++ ++L L E     Y++  KV PPLR+  +  ++++
Sbjct: 235 VSTRGGVAIIRQAKAKGVRVTAEVTPHHLTLTEERCLNYDTAAKVNPPLRTPDDVTALID 294

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
            +  G I+ I +DH P   + K   FA A FG  GLET   + + L    ++ L ++I  
Sbjct: 295 GINDGTINAIATDHAPHTDNDKCCEFALAPFGISGLETAFGSLMGLVAEGRVELNRIIEC 354

Query: 359 LSTRPAQIFNLPG----GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTG 414
           L+  PA I   PG    G+L  G  ADI ++D   +WTV     +S  KNT    E  TG
Sbjct: 355 LTAAPAGIIG-PGHGVTGSLTPGDPADIVILDTAMEWTVDTSQFASRGKNTPLAGEKLTG 413

Query: 415 KVVRTYISGKQVY 427
           KV+ T   G  ++
Sbjct: 414 KVIMTIFGGDIIF 426


>gi|237798178|ref|ZP_04586639.1| dihydroorotase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|237806083|ref|ZP_04592787.1| dihydroorotase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021030|gb|EGI01087.1| dihydroorotase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331027196|gb|EGI07251.1| dihydroorotase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 423

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 138/421 (32%), Positives = 208/421 (49%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP   +D++  + +E G + A GA A     PT  +  D TGLVA PG++D  V 
Sbjct: 7   GARVIDPVSGLDQITDLHIEAGKLCAIGA-APEGFEPTQTI--DATGLVAAPGLVDLNVA 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAVAGGVTSVCCPPQ-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L+  G V+F     S  +T+ L  +++YA   +  V  ++ 
Sbjct: 123 PIGALSKGLEGEQLAELMALRSAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ ++G  A +LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DRDLAEGGLAHDGPTAAFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS+ PAQ  
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVEDGLLDLPTLLARLSSGPAQAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G  ADI L D     TV  +   S   N  F      G V  T + G+  Y
Sbjct: 363 RLPAGKLSAGAPADIVLFD-PAASTVAGETWLSKGDNCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|78065440|ref|YP_368209.1| dihydroorotase [Burkholderia sp. 383]
 gi|77966185|gb|ABB07565.1| dihydroorotase [Burkholderia sp. 383]
          Length = 425

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 138/417 (33%), Positives = 211/417 (50%), Gaps = 4/417 (0%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP    ++   + V  G I A G     A F     I D  GL+  PG++D    L  
Sbjct: 10  LIDPVAGTEQQADVFVAGGTIAALGT--APAGFNADKTI-DAAGLIVAPGLVDLCARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    AVAGG+T+++  P      LDE   ++      R     NV+P  
Sbjct: 67  PGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVEMLKYRARNLHQANVHPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA   +    L   D F
Sbjct: 126 ALTVGLKGEVITEMVALTESGCVGFTHANVPVRDTQVLLRALQYASTYDYTTWLRPQDAF 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           +G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL++ 
Sbjct: 186 IGRGGVAASGALASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSSAGLALVRE 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     TC + +N+L L + D+  ++S  ++ PPLRSE +R ++  AL  G ID I S
Sbjct: 246 AKAEGLPVTCDVGVNHLHLIDVDIGYFDSQFRLDPPLRSERDREAIRVALADGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP 370
           DHTP   D KLLPF EA+ G+ GLE +LS  L+     +  L + +R +++ PA +  LP
Sbjct: 306 DHTPVDDDEKLLPFGEATPGATGLELLLSLTLKWADETRTPLAQALRRITSAPADVLKLP 365

Query: 371 GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            G L  G AAD+ + D    W V+   + S   N+ F        V  T ++G+  +
Sbjct: 366 AGRLTEGGAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPASVRTTLVAGQIAF 422


>gi|284048654|ref|YP_003398993.1| dihydroorotase, multifunctional complex type [Acidaminococcus
           fermentans DSM 20731]
 gi|283952875|gb|ADB47678.1| dihydroorotase, multifunctional complex type [Acidaminococcus
           fermentans DSM 20731]
          Length = 430

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 131/423 (30%), Positives = 223/423 (52%), Gaps = 6/423 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           ++ N RI+DPS+ +D+V  ++VE+G I A  A  ++A    +  + D TGLV  PG ID 
Sbjct: 4   LIKNGRIVDPSQQLDQVMDLLVEDGKI-AEAAPHIDA---AADEVFDATGLVVAPGFIDL 59

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
              L     E  +++ T +  A  GGIT +  MP      +D    +    E  + +  +
Sbjct: 60  HTHLREPGLEAKEDLVTGTMAAAHGGITRVACMP-NTKPVIDSSIVVSGIQERAKNEGYV 118

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           +V     +T   +GKE++EM  + ++G++ F      +    V+  + +Y    +  + +
Sbjct: 119 HVEVIGAITKGEKGKELTEMGDMAQRGVMGFSDDGHYVSSALVMNLAAQYVSAFDKPLIV 178

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D  +   G ++EG ++  LG+ GIPSI+E + +ARD  IA++TG H H + I+   +
Sbjct: 179 HDIDEEMNHEGYMHEGAVSARLGVPGIPSIAEDICVARDAAIAEYTGAHIHIAHIASKGA 238

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + +++ AKA     TC +++++L L +     Y++  +V PPLRS     +M   L+ G 
Sbjct: 239 VDIVRKAKAKGVNITCEVTVHHLTLTDEACAGYSTATRVSPPLRSRDHVEAMRAGLKDGT 298

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRP 363
           ID IV+DH P   + K + F  A  G  GLET +   L  L+H  + S+ +++  +ST P
Sbjct: 299 IDAIVTDHAPHAPEEKDVEFRYAPNGFCGLETSVGVILTELYHTGEFSINEIVNKMSTSP 358

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+I NL  G+L  G  ADI ++DL+ +WTV +    +  K T F+ +   G  V T + G
Sbjct: 359 ARIMNLDAGSLAPGKNADITILDLDREWTVDSSKFYTRGKVTPFNGKHCKGMAVATMVDG 418

Query: 424 KQV 426
           + V
Sbjct: 419 RFV 421


>gi|114330472|ref|YP_746694.1| dihydroorotase [Nitrosomonas eutropha C91]
 gi|114307486|gb|ABI58729.1| dihydroorotase [Nitrosomonas eutropha C91]
          Length = 423

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 138/423 (32%), Positives = 215/423 (50%), Gaps = 4/423 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
            + N R+IDP   +D +G + +  G I++   D+    F     I D +GLV  PG++D 
Sbjct: 4   CIQNGRLIDPDSGMDRIGDLYLAEGRIISI--DSRPEHFHDDREI-DASGLVVCPGLVDL 60

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
              L     EY   + +  + AVAGG+TS+   P      LDE   ++      R     
Sbjct: 61  SARLREPGLEYMATLESELEAAVAGGVTSLACPP-DTDPPLDEPGLVEMLKHRARNLDRA 119

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
            VYP   LT  ++G+ ++EM  L + G V+F Q+   I +  VL+ +M+YA      V L
Sbjct: 120 RVYPVGALTQGLKGERLTEMVELHDAGCVAFSQADAPIANLHVLMRAMQYAATFGFKVWL 179

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D +L + GV ++G +A  LGL  IP  +ET+ L   L + + TG   H   IS  + 
Sbjct: 180 RPQDMYLANHGVAHDGEVATRLGLPAIPVCAETIALTDILSLMKETGASAHLCRISSAEG 239

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           +AL++ AK      TC +SI+++ L + D+  +++   ++PPLR   +R ++   L  G 
Sbjct: 240 VALVRAAKQQGLPLTCDVSIHHVHLVDMDIGFFDANCHLMPPLRGLADRDALRAGLMDGA 299

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID I SDH P   D KLLPFA+A  G+ GLE +L   L+     ++SL + +  +++ PA
Sbjct: 300 IDTICSDHAPVDDDAKLLPFAQAETGATGLELLLPLTLKWAMESRLSLPEALARITSYPA 359

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           +I  +  G L  G  AD+ + D +  W V   ++ S  KNT F      G+   T ISG 
Sbjct: 360 RILGIDAGRLVAGAPADLCIFDPDAYWVVSNAELKSQGKNTPFLGMELCGRTRFTLISGH 419

Query: 425 QVY 427
            VY
Sbjct: 420 VVY 422


>gi|289209570|ref|YP_003461636.1| dihydroorotase [Thioalkalivibrio sp. K90mix]
 gi|288945201|gb|ADC72900.1| dihydroorotase, multifunctional complex type [Thioalkalivibrio sp.
           K90mix]
          Length = 431

 Score =  216 bits (551), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 134/426 (31%), Positives = 208/426 (48%), Gaps = 4/426 (0%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           S ++ N RIIDP+ D D VGA+ V+   ILA G   +   F     I D +GL   PG+I
Sbjct: 2   SVLIENVRIIDPADDYDAVGALCVQGAEILARGQ--IPDGFEPRRRI-DGSGLWVFPGLI 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    +    +E+   I + +  A  GGITS+++ P      +D    I+      R   
Sbjct: 59  DLSARMREPGEEHKATIASETLAAARGGITSVVIPP-DTDPPIDSPAEIELIARRARQAC 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            + VY    LT  +EG++++EM  LQ+ G      +   +    VL  +++YA      +
Sbjct: 118 GVRVYTLGALTQRLEGQQLAEMAALQQAGARGVSNAHKPLASLLVLRRALEYATTFGLTI 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
            L   D  L   G ++EG ++  LGL GIP  +ET  L   L + + TG   H + +S  
Sbjct: 178 VLPAQDLSLTGSGCMHEGAVSTRLGLSGIPEAAETAALGAILALVEQTGARVHVARLSTR 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +   +I  A+A     T  ++ + L L E DV  Y+    V+PPLR++ +R  +  A+ +
Sbjct: 238 RGAEMIAKARAEGLPITADVAAHQLFLTEVDVAEYDPNGHVIPPLRAQRDRDGLRAAVAR 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G+I  I SDH P   D KL PFA    G   LET+L   LRL     +SL + +  +++ 
Sbjct: 298 GEISAICSDHQPHEADAKLGPFAGTEPGISALETLLPLTLRLVEDGLLSLGEALARVTSG 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+I +   G L  G  AD  L D      ++  D  S  +N+ F    FTG+V  T+++
Sbjct: 358 PAEILDFEQGRLGAGARADFVLYDPTALQEMRKQDWLSTGRNSPFFGWTFTGQVRETWVA 417

Query: 423 GKQVYT 428
           G+  +T
Sbjct: 418 GRPAWT 423


>gi|298485005|ref|ZP_07003102.1| Dihydroorotase [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298160415|gb|EFI01439.1| Dihydroorotase [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 423

 Score =  216 bits (551), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 140/421 (33%), Positives = 209/421 (49%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP   +D+V  + VE G + A GA A     PT   I D  GLVA PG++D  V+
Sbjct: 7   GARVIDPVSGMDQVTDLHVEAGKLTAIGA-APEGFEPTQ--IIDVAGLVAAPGLVDLNVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAVAGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++ 
Sbjct: 123 PVGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ ++G  A +LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DRDLAEGGLAHDGATAAFLGLAGIPETAETVALARDLLLVEQSGARAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  LI  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVDDGLLDLPTLIARLSSGPAAAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G  ADI L D     TV  +   S  +N  F      G V  T + G+  Y
Sbjct: 363 RLPAGKLSAGAPADIVLFD-PAASTVAGETWLSKGENCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|147669650|ref|YP_001214468.1| dihydroorotase [Dehalococcoides sp. BAV1]
 gi|146270598|gb|ABQ17590.1| dihydroorotase [Dehalococcoides sp. BAV1]
          Length = 428

 Score =  216 bits (551), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 146/431 (33%), Positives = 224/431 (51%), Gaps = 15/431 (3%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N RIIDP+   D V  +++ENG++     D    K  T  +I D TG V  PG ID
Sbjct: 3   ILIKNGRIIDPASGTDNVADLLIENGLVTGINKDISREK--TEKVI-DATGKVVCPGFID 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLG--MSSFLDEYTFIKYALEEIRVK 121
             V L     E  + I +  K A AGG TSI  MP     +  L    FIK    ++   
Sbjct: 60  LHVHLREPGFEAKETIESGCKAAAAGGFTSICPMPNTNPAADCLPVIDFIKNTATKV--- 116

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           SLI V P A +T   +G+E+S M  L E G+V F      +  + +LLN++ Y+   +  
Sbjct: 117 SLIRVLPIAAITKGRKGQELSPMGELAEAGVVGFSDDGDYVSSSSLLLNALLYSRTFDLP 176

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           +     D  L   G++NEG++A  LGL GI + +E + + RD+ +A+ +GG  H   IS 
Sbjct: 177 IMEHCEDACLAEGGLMNEGLLACRLGLKGITNATEEIAVNRDIALAKESGGRLHLCHIST 236

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
             S+ L++ AKA   + +  ++ ++L L E +V  YN+  KV PPLR++T+  +++  L+
Sbjct: 237 AGSVELVRQAKAAGIRVSAEVTPHHLTLTEAEVNGYNTSAKVNPPLRTQTDIEALIAGLK 296

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID I +DH P   + KL  F  A+ G  GLET L++ + L H  ++SL  LI  L+ 
Sbjct: 297 DGTIDAIATDHAPHTRNDKLCEFGLAANGISGLETALASPMGLVHSGKLSLSLLIEKLTL 356

Query: 362 RPAQIF-----NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
            P Q+      N+  G L+ G+ AD+ + D + +WT+      S  KNT  +     G+V
Sbjct: 357 GPQQVLGEKYQNI--GNLKAGSCADVVIFDPDEEWTIDTAKFFSKGKNTPLEGRKLKGRV 414

Query: 417 VRTYISGKQVY 427
             T   G+ VY
Sbjct: 415 KTTIACGQIVY 425


>gi|330886259|gb|EGH20160.1| dihydroorotase [Pseudomonas syringae pv. mori str. 301020]
          Length = 423

 Score =  216 bits (551), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 140/421 (33%), Positives = 210/421 (49%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP   +D+V  + VE G + A GA A     PT  +  D  GLVA PG++D  V+
Sbjct: 7   GARVIDPVSGMDQVTDLHVEAGKLTAIGA-APEGFEPTQTI--DAAGLVAAPGLVDLNVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAVAGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++ 
Sbjct: 123 PVGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ ++G  A +LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DRDLAEGGLAHDGATAAFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  LI  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLGDDGLLDLPTLIARLSSGPAAAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP GTL  G  ADI L D     TV  +   S  +N  F      G V  T + G+  Y
Sbjct: 363 RLPAGTLSAGAPADIVLFD-PAASTVAGETWLSKGENCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|308273323|emb|CBX29926.1| Dihydroorotase [uncultured Desulfobacterium sp.]
          Length = 435

 Score =  216 bits (551), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 140/430 (32%), Positives = 224/430 (52%), Gaps = 10/430 (2%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILA-------AGADALNAKFPTSALIHDCTGLVA 57
           ++   R+IDP  ++D V  I++EN  I+         G  +   K      I D +G + 
Sbjct: 4   LIKGGRVIDPG-NLDGVMDILIENDRIIGITPLERTDGDPSELFKKDNDIKIIDASGKIV 62

Query: 58  VPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEE 117
           VPG+ID  V L     EY + I T +  A +GG T +  MP  +    D     +Y L  
Sbjct: 63  VPGLIDMHVHLREPGQEYKETIETGTLAAASGGFTGLCAMPNTIP-VNDNRQTTEYILNR 121

Query: 118 IRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHM 177
            R    +NVYP A ++  + G+ + E   L+E G ++       + +++++  +M+YA  
Sbjct: 122 ARDFGKVNVYPVAAISIGLNGERLCEYGDLKEAGAIAISDDGKPVSNSRLMRRAMEYAKQ 181

Query: 178 LNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS 237
               V        L S G +NEGIIA  +GL GIP+ +E++ +ARD+ + + TG H H +
Sbjct: 182 FGLPVISHCEVSELSSGGSMNEGIIATGMGLSGIPNEAESIMVARDIALCELTGAHLHIA 241

Query: 238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMV 297
            +S  QS+  I+ AK      T   + +   L ++ V  YN+  K+ PPLRSE +R ++ 
Sbjct: 242 HVSTLQSVRAIRDAKKRGVPVTAETAPHYFTLTQDAVCGYNTNAKMNPPLRSEADRDAIR 301

Query: 298 EALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIR 357
           E L  G ID+I +DH P  +  K + F  A+ G +GLET +S  L+L   + ISL +LI 
Sbjct: 302 EGLADGTIDVIATDHAPHSILEKEVEFDMAANGIVGLETSVSLGLKLVKDKIISLSELIE 361

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            +S  PA+I +L   +++ G AADI +ID +  +TV +D   S+ +NT F+     G+  
Sbjct: 362 KMSVNPARILHLD-RSIKKGKAADITIIDTDISYTVDSDSFCSLGRNTPFNGWKMKGRAC 420

Query: 418 RTYISGKQVY 427
            T + GK V+
Sbjct: 421 LTMVGGKIVF 430


>gi|254253084|ref|ZP_04946402.1| Dihydroorotase [Burkholderia dolosa AUO158]
 gi|124895693|gb|EAY69573.1| Dihydroorotase [Burkholderia dolosa AUO158]
          Length = 429

 Score =  216 bits (551), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 124/377 (32%), Positives = 193/377 (51%), Gaps = 1/377 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D +G    PG++D    L     E+   + +    AVAGG+T+++  P      LDE   
Sbjct: 51  DASGQTVAPGLVDLCARLREPGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGL 109

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           ++      R     NV+P   LT  ++G+ I+EM  L E G V F  + + + DTQVLL 
Sbjct: 110 VEMLKFRARNLRQANVHPLGALTVGLKGEVITEMVALTESGCVGFTHANVPVRDTQVLLR 169

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +++YA        L   D F+G  GV   G +A+ LGL G+P  +ET+ L     + + T
Sbjct: 170 ALQYASTYGYTTWLRPQDAFIGRGGVAASGAVASRLGLSGVPVAAETIALHTIFELMRVT 229

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G   H + +S    +AL++ AKA     TC + +N+L L + D+  ++S  ++ PPLRSE
Sbjct: 230 GARVHLARLSSAAGLALVRAAKAEGLPVTCDVGVNHLHLIDVDIGYFDSQFRLDPPLRSE 289

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQI 350
            +R ++  AL  G ID I SDHTP   D KLLPF EA+ G+ GLE +LS  ++     + 
Sbjct: 290 RDREAISAALADGTIDAICSDHTPVDDDEKLLPFGEATPGATGLELLLSLTVKWADETRT 349

Query: 351 SLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKE 410
            L + +R ++  PA +  LP G +  G AAD+ + D    W V+   + S   N+ F   
Sbjct: 350 PLAQALRRITAAPADVLQLPAGRIAEGAAADLCVFDPRAHWRVEPRALKSQGHNSPFLGY 409

Query: 411 FFTGKVVRTYISGKQVY 427
                V  T ++G+  +
Sbjct: 410 ELPACVRTTLVAGQVAF 426


>gi|217967956|ref|YP_002353462.1| dihydroorotase, multifunctional complex type [Dictyoglomus turgidum
           DSM 6724]
 gi|217337055|gb|ACK42848.1| dihydroorotase, multifunctional complex type [Dictyoglomus turgidum
           DSM 6724]
          Length = 431

 Score =  216 bits (550), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 135/428 (31%), Positives = 230/428 (53%), Gaps = 12/428 (2%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGII--LAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           +  N  ++ P +D +E+G + +E+ II  +  G D +N     +  + D    + VP ++
Sbjct: 4   LFKNITLVYPEKDKEEIGDLYIEDRIIKRIGKGLD-ING----NVEVIDGKDKIVVPTLV 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     E+ + I + SK AVAGG T+I  MP   +  +D    +++  E+  +  
Sbjct: 59  DIHVHLREPGYEWKETIESGSKAAVAGGFTAICCMP-NTNPPIDNKEMVRFIYEKADIVG 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L  VYP   +T   EGKEISEM  +   G   F      + +++VL  +++Y+ + NA +
Sbjct: 118 LSRVYPIGTITKGREGKEISEMGDMFMAGAKGFSDDGSCVMNSEVLRCALEYSKIFNAPI 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G +N G I+  LG  G+P ++E   +ARD+ ++  TGG  H + IS  
Sbjct: 178 IEHAEDTNLTLEGNVNFGKISTLLGFKGMPWVAEASIVARDVFLSALTGGRLHIAHISCW 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDV-EM-YNSLRKVLPPLRSETERMSMVEAL 300
           QS+ +IK  K H    TC ++ ++L+L E+ V EM Y++  K+ PPLR++ ++ ++ E +
Sbjct: 238 QSLDMIKWGKEHGANITCEVTPHHLVLTEDAVKEMNYDTNTKMNPPLRTKEDQEALWEGI 297

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRL-FHGQQISLKKLIRAL 359
           +   ID+I +DH P H+D K++ +  A +G  GLET +   +   ++ ++I L KL + +
Sbjct: 298 KNDLIDVIATDHAPHHLDDKMVEYGLAEYGISGLETAIPLVITYGYYERKIPLSKLFKKM 357

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           S  P +I NLP   L+    A++ +IDL+ +  V+ +   S  KNT F      G  V T
Sbjct: 358 SYNPCKILNLPYIPLEESVPANLTIIDLSEK-EVEKEKFFSKGKNTPFHGWRLKGWPVMT 416

Query: 420 YISGKQVY 427
           ++ G+ VY
Sbjct: 417 FVEGRLVY 424


>gi|83589731|ref|YP_429740.1| dihydroorotase [Moorella thermoacetica ATCC 39073]
 gi|83572645|gb|ABC19197.1| dihydroorotase [Moorella thermoacetica ATCC 39073]
          Length = 431

 Score =  216 bits (550), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 134/425 (31%), Positives = 228/425 (53%), Gaps = 5/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + ++   R+IDP+R++D    I++E   I    A   N + P  A + D  G++  PG+I
Sbjct: 2   AILIKGGRVIDPARNLDGRQDILIEGEKITTLAA---NLEAPAGARVIDAGGMIVTPGLI 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     E  + I + ++ A AGG T++  M    +   D  + I +  E+ R + 
Sbjct: 59  DMHVHLREPGYEQKETIASGTRAAAAGGFTAVACM-ANTNPVADSASVIYFIKEKARQEG 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++ VYP   L+  +EGKEI+E+  L   G V+       + +  V+ ++++YA M N  V
Sbjct: 118 VVRVYPVGALSKGLEGKEIAEIGDLAAAGAVAISDDGRPVMNALVMRHALEYAKMFNLPV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L + G+++EG++A  LGL GIP+ +E V +ARDL++A+ TGG  H + +S  
Sbjct: 178 ISHCEDEALANDGLMHEGLVATILGLRGIPAAAEEVMVARDLILAELTGGRLHLAHVSTA 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S+ L+K A+A   + T   + ++L L +  V+ Y++  KV PPLR   +  ++  AL  
Sbjct: 238 GSVRLLKEARARGVRVTAEATPHHLCLTDMLVQSYDTSTKVNPPLRPAGDVAAVAAALAA 297

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALST 361
           GDID+I SDH P   + K + +  A FG +GLET +   +  L    +++ ++ I++ + 
Sbjct: 298 GDIDVIASDHAPHADEDKDVEYDYAPFGMVGLETAVPLVVTELILPGKLTWQQAIKSWTA 357

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA+I N+PGG+L  G  AD+ +ID + +  V  ++  S   N+        G  V T +
Sbjct: 358 NPARILNIPGGSLVPGGVADVTIIDPDMEKEVDVNEFYSRGHNSPLQGRKLKGWPVLTIV 417

Query: 422 SGKQV 426
            G+ V
Sbjct: 418 GGRVV 422


>gi|241762315|ref|ZP_04760396.1| Dihydroorotase [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241373218|gb|EER62848.1| Dihydroorotase [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 408

 Score =  216 bits (549), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 140/426 (32%), Positives = 213/426 (50%), Gaps = 23/426 (5%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKF-PTSA-LIHDCTGLVAV 58
           M+   + N R+IDP+         IVE G++L  G  A   +  P+ A  + D  G    
Sbjct: 1   MSFIAIINGRLIDPASQK------IVEGGLLLKEGRIAARGQIDPSQADKVIDAEGGYIA 54

Query: 59  PGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           P IID        P  +S ++    K    GGI  + LMP   S  LDE   I+ A  + 
Sbjct: 55  PAIID--------PTVFSVDLPAFIK----GGIGRVALMP-DQSPALDEAALIQRA--KA 99

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
                + VYP A  +  ++G+E++E+ L+Q  G  +       I D+ ++   + YA  L
Sbjct: 100 SGGEAVEVYPLAAGSRGLQGQELAEIGLMQRAGAKAVATGRQWIADSGLMYRLLDYAASL 159

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
              V     D  L    V  EG++A+ LGL   P+++E + +ARDL++A+ T    H + 
Sbjct: 160 GLTVISHAEDGGLTKGCVATEGLMASRLGLRAAPAVAEAIVVARDLMLAEETDCKIHFAQ 219

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           ++  +S  LI+ AK    K T GI+   L+L++   E + +  ++ PPLR E +R++ VE
Sbjct: 220 LTTKKSFDLIRQAKEKGVKVTVGINPAYLLLSDRHTEDFRTFARLSPPLRGEDDRLASVE 279

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
           AL  G ID+  S H PR  + K LPF +A  G  G ET+LSA+L L H   I L +L+  
Sbjct: 280 ALLDGVIDMFCSAHDPRDAEDKRLPFIDAKPGMAGAETLLSASLELVHQGVIDLSRLVEL 339

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           LS   AQ+    GG L  G  ADI + D++ +W + +  M++   N+ FD     GKV  
Sbjct: 340 LSVNAAQLLGCEGGGLSVGDEADIVIFDIDREWQLDSAKMAAKAGNSPFDGRMMRGKVTH 399

Query: 419 TYISGK 424
           T   GK
Sbjct: 400 TIKGGK 405


>gi|206601576|gb|EDZ38059.1| Dihydroorotase [Leptospirillum sp. Group II '5-way CG']
          Length = 438

 Score =  216 bits (549), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 126/426 (29%), Positives = 220/426 (51%), Gaps = 6/426 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           SF L + RI+DP+  ID  G + VE G++   GA  + +   T   + +  G +  PG++
Sbjct: 9   SFFLKDVRILDPATGIDTTGHLRVEKGLVAEFGAIGVPS---TGIPVWEGEGSIVTPGLV 65

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYAL-EEIRVK 121
           D          EY + I + S+ AV+GG T++ +M    +  ++++  +   +  + R  
Sbjct: 66  DVHAHFREPGFEYKETIESGSRAAVSGGFTAVCVM--ANTDPVNDHPEVTLGMVNKAREI 123

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
            L  V+P   ++  ++G+ ++EM  L   G V F    + +  +++L  +++YA + +  
Sbjct: 124 GLCRVFPIGAVSLGLKGETLTEMGALARAGCVGFSDDGLPVKTSRLLRRALEYAALFHRP 183

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V     D  L   G +NEG ++  LGL GIP+ SE V +ARDL I + T G  H + +S 
Sbjct: 184 VIDHCEDRDLSDGGGMNEGWVSTDLGLRGIPAASEEVVVARDLEILKTTRGRLHVAHLST 243

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
              + L++ AK  +   T     +   L +  V  +++  K+ PPLR+E +R++++E L 
Sbjct: 244 AGGVRLVREAKKRHLHVTAETCPHYFSLTDEAVRCHHADAKMNPPLRTEEDRLAIIEGLR 303

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID+I +DH P     K   F +A FG IGLET  S  L+L +   + L  L+  +S 
Sbjct: 304 DGTIDMIATDHAPHAPFEKEREFDQAPFGIIGLETAFSLGLQLVNSGILELSMLLYLMSV 363

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           RP+++F LP G ++ G  AD+ + D N           S  +N+ F  +   G++  T++
Sbjct: 364 RPSRVFGLPRGEIRVGGMADLMVFDPNQSTVAGVPRFHSRSRNSPFSGQKLPGRIRMTFV 423

Query: 422 SGKQVY 427
            GK+V+
Sbjct: 424 GGKKVF 429


>gi|260752732|ref|YP_003225625.1| amidohydrolase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552095|gb|ACV75041.1| amidohydrolase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 408

 Score =  216 bits (549), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 140/426 (32%), Positives = 212/426 (49%), Gaps = 23/426 (5%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKF-PTSAL-IHDCTGLVAV 58
           M+   + N R+IDP+         IVE G++L  G  A   +  P+ A  + D  G    
Sbjct: 1   MSFIAIINGRLIDPASKK------IVEGGLLLKEGRIAACGQIDPSQADNVIDAEGGYIA 54

Query: 59  PGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           P IID        P  +S ++    K    GGI  + LMP   S  LDE   I+ A  + 
Sbjct: 55  PAIID--------PTVFSVDLPAFIK----GGIGRVALMP-DQSPALDEAALIQRA--KA 99

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
                + VYP A  +  +EG+E++E+ L+Q  G  +       I D+ ++   + YA  L
Sbjct: 100 SGGEAVEVYPLAAGSRGLEGRELAEIGLMQRAGAKAVATGRQWIADSGLMYRLLDYAASL 159

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
              V     D  L    V  EG++A+ LGL   P+++E + + RDL++A+ T    H + 
Sbjct: 160 GLTVISHAEDGGLTKGCVATEGLMASRLGLRAAPAVAEAIVVVRDLMLAEETDCKIHFAQ 219

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           ++  +S  LI+ AK    K T GI+   L+L++   E + +  ++ PPLR E +R++ VE
Sbjct: 220 LTTKKSFDLIRQAKEKGVKVTVGINPAYLLLSDRHTEDFRTFARLSPPLRGEDDRLASVE 279

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
           AL  G ID+  S H PR  + K LPF +A  G  G ET+LSA+L L H   I L +L+  
Sbjct: 280 ALRDGVIDMFCSAHDPRDAEDKRLPFIDAKPGMAGAETLLSASLELVHQGVIDLSRLVEL 339

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           LS   AQ+    GG L  G  ADI + D++ +W + +  M++   N+ FD     GKV  
Sbjct: 340 LSVNAAQLLGCEGGGLSVGDEADIVIFDIDREWQLDSAKMAAKAGNSPFDGRMMRGKVTH 399

Query: 419 TYISGK 424
           T   GK
Sbjct: 400 TIKGGK 405


>gi|206901461|ref|YP_002251283.1| dihydroorotase [Dictyoglomus thermophilum H-6-12]
 gi|206740564|gb|ACI19622.1| dihydroorotase [Dictyoglomus thermophilum H-6-12]
          Length = 432

 Score =  216 bits (549), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 129/426 (30%), Positives = 222/426 (52%), Gaps = 7/426 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           +  N  +I P +D++E G + VENG+I   G    N        I +    V  P ++D 
Sbjct: 4   LFKNVTLIYPEKDMEETGDLYVENGVIKKIGK---NLDINGDVEIIEGQNKVLAPTLVDM 60

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V L     E+ ++I +  K AVAGG T++  MP   +  +D    +++  E+  +  L 
Sbjct: 61  HVHLREPGYEWKEDIESGCKAAVAGGFTAVCCMP-NTNPPIDNKEIVRFIYEKSDIIGLS 119

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
            VYP   +T   EGKEISEM  +   G  +F      + +++VL  +++Y+ + +  +  
Sbjct: 120 RVYPIGTITKGREGKEISEMGDMYMAGAKAFSDDGNCVMNSEVLRYALEYSKIFDVPIIE 179

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D  L   G +N G I+  LG  G+P ++E   +ARD+ ++  TGG  H + IS  QS
Sbjct: 180 HAEDINLTLDGNVNFGKISTLLGFKGMPWVAEASIVARDVFLSALTGGKLHVAHISCWQS 239

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEM--YNSLRKVLPPLRSETERMSMVEALEK 302
           + +I+  K H    TC ++ ++L+L E+ V+   Y+   K+ PPLR++ ++ ++ E ++ 
Sbjct: 240 LDMIRWGKEHGVNVTCEVTPHHLVLTEDAVKELDYDPNTKMNPPLRTKEDQEALWEGIKN 299

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRL-FHGQQISLKKLIRALST 361
             ID+I +DH P H+D K++ +  A +G  GLET +   L   ++ ++I L K+ + +S 
Sbjct: 300 DLIDVIATDHAPHHLDDKMVEYGLAEYGISGLETAIPLILTYGYYERKIPLHKIFKKMSY 359

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            P +I NLP   L+    A+  +IDL+ +  V  +   S  KNT F      G  + T++
Sbjct: 360 NPCKILNLPYIPLEENVPANFTVIDLSLEKEVDKEKFFSKGKNTPFHGWKLKGWPIMTFV 419

Query: 422 SGKQVY 427
            G+ VY
Sbjct: 420 EGRLVY 425


>gi|330984653|gb|EGH82756.1| dihydroorotase [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 423

 Score =  216 bits (549), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 139/421 (33%), Positives = 209/421 (49%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP   +D+V  + VE G + A GA A     PT  +  D  GLVA PG++D  V+
Sbjct: 7   GARVIDPVSGMDQVTDLHVEAGKLTAIGA-APEGFEPTQTI--DAAGLVAAPGLVDLNVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRSAVAGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++ 
Sbjct: 123 PVGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ ++G  A +LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DRDLAEGGLAHDGATAAFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  LI  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVDDGLLDLPTLIARLSSGPAAAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G  ADI L D     TV  +   S  +N  F      G V  T + G+  Y
Sbjct: 363 RLPAGKLSAGAPADIVLFD-PAASTVAGETWLSKGENCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|87310856|ref|ZP_01092982.1| dihydroorotase [Blastopirellula marina DSM 3645]
 gi|87286371|gb|EAQ78279.1| dihydroorotase [Blastopirellula marina DSM 3645]
          Length = 422

 Score =  216 bits (549), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 132/424 (31%), Positives = 214/424 (50%), Gaps = 7/424 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +L N R+IDPS+ +D V  I++++G++ +     L+A+   +  + D TG +  PG
Sbjct: 1   MSTILLKNGRLIDPSQQLDRVTNILLKDGVVAS-----LDAQETYADRVIDATGKIVAPG 55

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +ID  V L     E  + I + +  A+ GG TSI  +P      LD    I+Y   +   
Sbjct: 56  LIDMHVQLREPGWEEDETIASGAAAAIVGGFTSIACIP-NTEPPLDSPASIEYVRHKAAR 114

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
               NV+  AC +S  +G+++SE+  L E G V F  +  +I + ++L  +++Y  M + 
Sbjct: 115 ADKCNVFVIACASSGRKGEQLSEIGTLVEAGAVGFSDASRAITNPELLRRALEYTQMFDK 174

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V        L   GV+++G+++  LGL  IP+ +E V  ARD+ + + TGG  H   +S
Sbjct: 175 PVLNRPELIELTHNGVMHDGMVSLVLGLAPIPAAAEDVMAARDICLCETTGGRLHLMSVS 234

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              ++ +++ AKA   + T  I   N  L +  +  ++   KV PPLRS     + +  L
Sbjct: 235 SSGTVEILRRAKARGVRTTAEIHPCNFALTDEALREFDPNCKVNPPLRSADHVAACIAGL 294

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLS-AALRLFHGQQISLKKLIRAL 359
           + G ID+I S H PR    K+    +A FG + LET L   A +L     ++  + I  L
Sbjct: 295 KDGTIDVISSGHAPRASQKKMHEMTDAPFGMVSLETTLGLTATKLVRPGHLTWSQAIDKL 354

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           ST PA+I  +P GTL  G  AD+ +ID +  WTV     +S   N  FD     GK    
Sbjct: 355 STTPARILGVPKGTLMVGADADVTIIDPDLPWTVDTSQYASRSSNCPFDGWKLIGKATNV 414

Query: 420 YISG 423
            + G
Sbjct: 415 IVGG 418


>gi|56476390|ref|YP_157979.1| dihydroorotase [Aromatoleum aromaticum EbN1]
 gi|56312433|emb|CAI07078.1| Dihydroorotase-like protein [Aromatoleum aromaticum EbN1]
          Length = 425

 Score =  216 bits (549), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 143/421 (33%), Positives = 224/421 (53%), Gaps = 6/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N R+IDP+  +D+   + + +G I+A G   +   F     I D TGLV  PG+ID    
Sbjct: 7   NGRVIDPANGLDDTRDMYLADGKIVAHGR--VPEGFAAERTI-DATGLVVAPGLIDLAAR 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L     EY   + +    A+AGG+TS+ + P      LDE   ++      +  +  +VY
Sbjct: 64  LREPGFEYRATLESEMDAAMAGGVTSLAIPP-DTDPVLDEPGLVEMLCYRAKKLNRAHVY 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   LT  + G+ +SEM  L E G V+F Q+ + + D+ VLL +M+YA      V L   
Sbjct: 123 PVGALTIGLNGERLSEMAELVEAGCVAFGQANVPVVDSAVLLRAMQYAATFGFRVWLQPL 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
             FL SRG  ++G +A  LGL GIP+ +ET+ L   + +A+ TG   H + +S  + +AL
Sbjct: 183 APFL-SRGFAHDGEVATRLGLPGIPTAAETIALYAHIQLARATGARLHVTRLSSAEGLAL 241

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I+ A+A     TC +SIN+L L+E D+  +NS   ++PPLRS+ +R ++ + L  G ID 
Sbjct: 242 IRQARADGLDVTCDVSINHLHLSEMDIGYFNSNCHLVPPLRSQRDRDALRQGLADGSIDA 301

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           + SDHTP   + KL PF+E+  G+ GLE +L   L+      + L + +  +++  A+I 
Sbjct: 302 LCSDHTPVDDNGKLTPFSESEAGATGLELLLPLTLKWAQETGLPLGQALARVTSDAARIV 361

Query: 368 NL-PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
            +   G L  G  AD+ L D     TV+ D + S  KNT F      G+V  T + G+ +
Sbjct: 362 GITKAGHLGAGARADLCLFDPAAHTTVRRDTLRSQGKNTPFLGLELPGRVHYTLVEGQVM 421

Query: 427 Y 427
           +
Sbjct: 422 H 422


>gi|56964100|ref|YP_175831.1| dihydroorotase [Bacillus clausii KSM-K16]
 gi|81365945|sp|Q5WFJ0|PYRC_BACSK RecName: Full=Dihydroorotase; Short=DHOase
 gi|56910343|dbj|BAD64870.1| dihydroorotase [Bacillus clausii KSM-K16]
          Length = 427

 Score =  215 bits (548), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 133/381 (34%), Positives = 197/381 (51%), Gaps = 2/381 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D TGL+  PG +D  V L     E  + I T +K A  GG T++  MP       D    
Sbjct: 43  DATGLLISPGFVDVHVHLREPGGEKKETIETGTKAAARGGFTTVAAMP-NTRPVPDNAEQ 101

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +      I   +++ V P A +T+   G+E+++ + L+E G  +F    + I +  ++L+
Sbjct: 102 LDLLQARISETAVVRVLPYASITTRQLGQELTDFKALKEAGAFAFTDDGVGIQEAGMMLS 161

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +MK A  LN  V     D+ L + G ++EG  A   GL GIPS+ E V +ARD+L+A+  
Sbjct: 162 AMKEAAALNMAVVAHCEDNSLINGGAVHEGHYAKAHGLNGIPSVCEAVHIARDVLLAEAA 221

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G HYH   +S  +S+  I+ AK    + T  ++ ++L+L E+D+   +   K+ PPLR++
Sbjct: 222 GAHYHVCHVSTKESVRTIRDAKKAGIRVTAEVTPHHLLLCEDDIIGKDPNFKMNPPLRAK 281

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQ 349
            +R ++V  L  G ID I +DH P   + K      A FG +GLET        F     
Sbjct: 282 EDRDALVAGLLDGTIDFIATDHAPHTAEEKSASLERAPFGIVGLETAFPLLYTHFVKPGT 341

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            +LK+LI  L+ +PAQ FNLP GTLQ G AAD+ LIDL    T+      S  KNT F  
Sbjct: 342 FTLKQLIDWLTVKPAQTFNLPYGTLQVGAAADLTLIDLKANETIDPSMFLSKGKNTPFAG 401

Query: 410 EFFTGKVVRTYISGKQVYTLE 430
               G    T ++GK VY  E
Sbjct: 402 WDCAGIPQATMVAGKTVYKKE 422


>gi|217964010|ref|YP_002349688.1| dihydroorotase (DHOase) [Listeria monocytogenes HCC23]
 gi|254788862|sp|B8DDR5|PYRC_LISMH RecName: Full=Dihydroorotase; Short=DHOase
 gi|217333280|gb|ACK39074.1| dihydroorotase (DHOase) [Listeria monocytogenes HCC23]
 gi|307571419|emb|CAR84598.1| dihydroorotase, multifunctional complex type [Listeria
           monocytogenes L99]
          Length = 426

 Score =  215 bits (548), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 136/425 (32%), Positives = 225/425 (52%), Gaps = 7/425 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N ++++ S ++ E   ++++NG +    AD++     TS    D TG +  PG ID
Sbjct: 2   YVLKNGQVLNASGEL-ENKDVLIQNGKVNLI-ADSIEV---TSGEEFDATGKLIAPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T ++ A  GG T+I  MP       D    ++    +I+  + 
Sbjct: 57  VHVHLREPGGEHKETILTGTQAAARGGYTTICSMP-NTKPVPDSKEVMENLQAKIKETAE 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +   L+E G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDFEALKEAGAFAFTDDGVGVQLAGTMYEAMKRAAALDMAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++GI A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGIFAEKEGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E  +   +   K+ PPLRS+ +R +++E L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEAIPGNDGNWKMNPPLRSKADRAALLEGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F    + +LK+LI  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEQAAFGIVGLETGFPLLYTHFVKTNEWTLKQLIDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ F LP G L+ G+ ADI ++DL  + T+      S  KNT F  E   G  V T+  
Sbjct: 356 PAECFKLPYGKLEEGSVADIVVLDLEKEATIDPATFYSKGKNTPFVGETCIGWPVATFAE 415

Query: 423 GKQVY 427
           G  VY
Sbjct: 416 GTLVY 420


>gi|170732192|ref|YP_001764139.1| dihydroorotase [Burkholderia cenocepacia MC0-3]
 gi|169815434|gb|ACA90017.1| dihydroorotase, multifunctional complex type [Burkholderia
           cenocepacia MC0-3]
          Length = 425

 Score =  215 bits (548), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 138/419 (32%), Positives = 218/419 (52%), Gaps = 8/419 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           ++DP    +    + V +G I A G+    A F     I D +GL+ VPG++D    L  
Sbjct: 10  LVDPVAGTEGQADVFVADGKIAALGS--APAGFNADQTI-DASGLIVVPGLVDLCARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYP 128
              E+   + +    AVAGG+T+++  P      LDE   ++  + + R ++L   NV+P
Sbjct: 67  PGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQANVHP 123

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   D
Sbjct: 124 LGALTVGLKGEVITEMVALTESGCVGFTHANVPVRDTQVLLRALQYASTYGYTTWLRPLD 183

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
            F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL+
Sbjct: 184 AFIGRGGVAASGALASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLALV 243

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     TC + +N++ L + D+  ++S  ++ PPLRSE +R ++  AL  G ID I
Sbjct: 244 REAKAEGLPVTCDVGVNHVHLIDVDIGYFDSQFRLDPPLRSERDREAIRAALADGTIDAI 303

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            SDHTP   D KLLPF EA+ G+ GLE +LS  L+     +  L + +R +++ PA +  
Sbjct: 304 CSDHTPVDDDEKLLPFGEATPGATGLELLLSLTLKWADETRTPLAQALRRITSAPADVLQ 363

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           LP G L  G AAD+ + D    W V+   + S   N+ F        V  T ++G+  +
Sbjct: 364 LPAGRLAEGGAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPAAVRTTLVAGRVAF 422


>gi|71736336|ref|YP_272775.1| dihydroorotase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257483593|ref|ZP_05637634.1| dihydroorotase [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|71556889|gb|AAZ36100.1| dihydroorotase, multifunctional complex type [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|320321979|gb|EFW78075.1| dihydroorotase [Pseudomonas syringae pv. glycinea str. B076]
 gi|320330916|gb|EFW86890.1| dihydroorotase [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330872140|gb|EGH06289.1| dihydroorotase [Pseudomonas syringae pv. glycinea str. race 4]
 gi|331009669|gb|EGH89725.1| dihydroorotase [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 423

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 139/421 (33%), Positives = 209/421 (49%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP   +D+V  + VE G + A GA A     PT  +  D  GLVA PG++D  V+
Sbjct: 7   GARVIDPVSGMDQVTDLHVEAGKLTAIGA-APEGFEPTQTI--DAAGLVAAPGLVDLNVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAVAGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++ 
Sbjct: 123 PVGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ ++G  A +LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DRDLAEGGLAHDGATAAFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  LI  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVDDGLLDLPTLIARLSSGPAAAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G  ADI L D     TV  +   S  +N  F      G V  T + G+  Y
Sbjct: 363 RLPAGKLSAGAPADIVLFD-PAASTVAGETWLSKGENCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|51243957|ref|YP_063841.1| dihydroorotase [Desulfotalea psychrophila LSv54]
 gi|81643360|sp|Q6AS41|PYRC_DESPS RecName: Full=Dihydroorotase; Short=DHOase
 gi|50874994|emb|CAG34834.1| probable dihydroorotase [Desulfotalea psychrophila LSv54]
          Length = 421

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 130/424 (30%), Positives = 220/424 (51%), Gaps = 7/424 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L   R+IDP    DE   I +E+G I+A          P  A I+D  G   VPG+ID
Sbjct: 3   IILKGGRVIDPRNRRDEDADIWMEDGQIIAP-----QETVPEDAKIYDLAGKWVVPGLID 57

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L    +EY ++I T +  A AGG T++  MP       D  +  +Y LE+    + 
Sbjct: 58  MHVHLRDPGEEYKESIVTGTDAAAAGGFTAVACMP-NTDPVNDTGSVTRYILEKSE-GAA 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             VYP   L+  ++G+ ++E   ++  G V+       +  +Q++  +M+YA   + +V 
Sbjct: 116 ARVYPVGALSEGLKGESLAEYADMKHAGAVALTDDGNPVVSSQLMRRAMEYAKSHDMLVI 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             + +  L  RG +NEG++A  LGL GIP+++E++ + R++ +A  TG   H + +S  +
Sbjct: 176 SHSEEPTLSKRGCMNEGLVATRLGLKGIPAVAESIMVQREIALAGLTGARLHIAHVSCIE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+A I+ AK      T   + +   L ++ V  Y++  K+ PPLR+E  R ++ +AL  G
Sbjct: 236 SLAAIRDAKKRGLPVTAETAPHYFSLTDDAVIGYDTHAKMNPPLRTEEHRQAIRQALADG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            +D+I +DH P  +  K + F  A+ G +GLET L  +L L     ++  +L+  +S+ P
Sbjct: 296 TLDVIATDHAPHSIVEKEVTFEYAANGIVGLETSLGLSLALVRDGVLTPSRLVELMSSVP 355

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           AQI ++ GG L  G  AD+ +ID   + T    +  S   N+ FD     G    T+++G
Sbjct: 356 AQILSVAGGELGVGAIADVTVIDPELEHTFLIAEGRSRGANSPFDGWKLKGAATLTFVAG 415

Query: 424 KQVY 427
           ++ Y
Sbjct: 416 EESY 419


>gi|309886|gb|AAA25977.1| dihydroorotase-like [Pseudomonas aeruginosa]
          Length = 423

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 136/418 (32%), Positives = 206/418 (49%), Gaps = 5/418 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+ D+D+VG + +E G I+A GA    A F     + D  GLVA  G++D  
Sbjct: 5   IRGARVIDPASDLDQVGDLHIEAGKIVAIGA--APAGFSAQKTL-DGAGLVAAAGLVDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L         N+ + ++ A AGG TS+   P      LD     +  L+  R      
Sbjct: 62  VALREPGYGRKGNVESETRAAAAGGTTSLCCPPY-TRPVLDTPAVAELILDRAREAGNAK 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT    G+++SE+  L++ G V+F          ++L  +++YA   +  V   
Sbjct: 121 VYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASNRILRRALEYAATFDLTVIFT 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
           + D  L   G+ +EG  A++LGL GIP  +ETV LAR+LL+ + +G   H S ++  + I
Sbjct: 181 SQDTDLAEGGLAHEGPTASFLGLAGIPETAETVALARNLLLVEQSGVRAHFSQLTSARGI 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L+  A+A     TC +++  LIL +  +  ++SL  V PPLR+  +R ++ EA+  G +
Sbjct: 241 ELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLYHVQPPLRTRADREALREAVNNGVV 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
             I S H P   D K  PFA    G  G E +L  A+ L     + L  L+  LS  PAQ
Sbjct: 301 QAIASHHQPHEPDAKNAPFAATEPGISGAELLLPLAMTLVQDGLLDLPTLLARLSHGPAQ 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
              LP G L  G AAD+ L D     T+  +   S  +N+ F      G+V  T + G
Sbjct: 361 ALRLPAGRLAVGQAADLVLFDPQGS-TLAGESWYSKGQNSPFVGHCLPGRVRYTLVDG 417


>gi|320528993|ref|ZP_08030085.1| putative dihydroorotase [Selenomonas artemidis F0399]
 gi|320138623|gb|EFW30513.1| putative dihydroorotase [Selenomonas artemidis F0399]
          Length = 430

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 129/427 (30%), Positives = 224/427 (52%), Gaps = 6/427 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M++ +L    +IDP    +EV  ++++NGII   G    N K P  A ++D TG +  PG
Sbjct: 1   MSTLLLKGGTVIDPGSKRNEVSDVLIKNGIIQKVGK---NLKSP-DAEVYDATGKIVAPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +ID  V       E  ++  + S+   AGG T++  MP   S  +D    ++   +    
Sbjct: 57  LIDMHVHFREPGQEAKEDFASGSRAGAAGGYTTVATMP-NTSPVVDTAALVRSLQKRAED 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            S+I+++    +T N EG+E++E+  + E G V+F          +VLL++  Y    + 
Sbjct: 116 VSVIHIHIIGAVTKNQEGRELAELGDMVEAGAVAFSDDGYFDPSAKVLLSAYDYLVPFDK 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +     D+ L   G +NEG  +  LG+ G P+++E + +ARD+++A++ G H H + IS
Sbjct: 176 AIINHEEDNSLVEDGAMNEGHRSAMLGIKGRPTVAEDIAVARDVMLAEYAGAHVHVAHIS 235

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++ +++ AKA   + T  ++ ++L + +  V   +S  KV PPLR++ +  +MV  L
Sbjct: 236 SARAVQIVREAKARGVRVTTEVTPHHLTMTDECVNPVDSSTKVNPPLRTQKDVDAMVAGL 295

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRAL 359
             G ID+IV+DH+P   + K   +  A  G  GLET L   L  L H  ++ ++ +I  +
Sbjct: 296 ADGTIDMIVTDHSPHEREDKDREYVYAPSGFPGLETALGVVLTDLVHTGKMDMETVIERM 355

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           S  PA++F +  GTL  G  AD+ +ID    WTV+A+   +   ++ F      GK V T
Sbjct: 356 SYAPARVFRMNAGTLNEGAPADVVVIDPQRLWTVEAEKFYTRGSHSPFVGRKLKGKAVLT 415

Query: 420 YISGKQV 426
            + G+ V
Sbjct: 416 VVDGEIV 422


>gi|87120927|ref|ZP_01076819.1| Dihydroorotase multifunctional complex type [Marinomonas sp.
           MED121]
 gi|86163765|gb|EAQ65038.1| Dihydroorotase multifunctional complex type [Marinomonas sp.
           MED121]
          Length = 425

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 132/425 (31%), Positives = 216/425 (50%), Gaps = 4/425 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
            + N RIIDPS+ +D V  + +E+  I+A G DA         +  D  GL  +PG++D 
Sbjct: 4   CIKNGRIIDPSQGLDAVQNLYIEDDKIIALG-DAPEGFVADETI--DAAGLWVLPGLVDL 60

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V+L         NI + +  A +GGIT+++  P   S  +D         ++       
Sbjct: 61  AVSLREPGYSQKGNIASETLAAASGGITTLVCQP-DTSPIVDTPAVAALIQDKAFESGRA 119

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           NV P   LT  +EG+++S M  L E G ++       + +T+VL  +++YA   + +V  
Sbjct: 120 NVLPIGALTQGLEGEKLSNMVALTEAGCIAVSNHRNPMANTKVLSRALEYAATHDLLVIF 179

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              +  L   G  +EG+I+   GL GIP  +ET+ LARDL++ + T    H + +S  +S
Sbjct: 180 HPDETSLSDGGCAHEGVISTMHGLAGIPETAETIALARDLMLVEKTKVKAHFARLSSAKS 239

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           I L+  AKA     T  ++++NL+L +  +  ++    VLPPLRSE +R++++E ++ G 
Sbjct: 240 IELVADAKAAGMDVTADVALHNLLLTDQVLSEFDGHYHVLPPLRSEEDRLTLIEGIKAGV 299

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           I  I SDH P     K+ PFA    G   LE +L  A+ L     +    L+  L+  PA
Sbjct: 300 ISAICSDHQPHEKMAKIAPFAATEPGMANLEVLLPLAMTLMDEGDLDFNLLLSCLTQGPA 359

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
               +  G+L  G+ ADI L D   +W    +   +  +N+ +  E   GKVV TY+SG+
Sbjct: 360 SCIGIDAGSLAVGSYADIVLFDSTTRWEWSQNHRKTKGQNSPWIGESLIGKVVSTYLSGQ 419

Query: 425 QVYTL 429
           +V+ +
Sbjct: 420 KVFPI 424


>gi|288939963|ref|YP_003442203.1| dihydroorotase, multifunctional complex type [Allochromatium
           vinosum DSM 180]
 gi|288895335|gb|ADC61171.1| dihydroorotase, multifunctional complex type [Allochromatium
           vinosum DSM 180]
          Length = 428

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 139/424 (32%), Positives = 214/424 (50%), Gaps = 8/424 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID-- 63
           + + R+IDP+   D V  I +  G +LA GA A +   P   L  D  G V  PG +D  
Sbjct: 9   IRHGRLIDPASGHDAVADIHLAEGRVLAIGA-APSGFQPDRTL--DARGQVVCPGFVDLC 65

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
           ARV   G   E    I +  + A A G+T++   P      +D     +   +  +   L
Sbjct: 66  ARVREPGL--EQKATIASEGRAAAASGVTTLCCPP-DTRPVIDNPAVARLIHQISKRHGL 122

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             V P   +T  +EG+ I+EM  L+  G  +  Q+   I DTQV   +++YA      V 
Sbjct: 123 TRVLPIGAMTVGLEGQSITEMAALKLAGCPALGQADRPIRDTQVQRRALEYAATFGLPVF 182

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   D  L + G  +EGI+   LGL GIP  +ETV +ARDL +A+ TG   H   +S  +
Sbjct: 183 LLPLDPELSAGGCAHEGIVGTRLGLPGIPEAAETVAVARDLALAEQTGARIHFRGLSTAR 242

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
            + ++  A+A   +A+  ++++ L L+E+D+E +++   ++PPLR+  +R ++ +AL +G
Sbjct: 243 GVEMLAEARARGVRASGDVALHQLFLSEHDLEHFDANCHLVPPLRTPADRDALRDALAEG 302

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            +  + SDH P   D KL PF E + G  GLET+L  ALRL     + L  +I  L+  P
Sbjct: 303 VLTAVCSDHQPHDPDAKLGPFPETAPGLSGLETVLPLALRLVADGVLDLMGMIERLTVGP 362

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A I     G L  G AAD+ + D    WT+  D   S  +NT F      G+V  T + G
Sbjct: 363 AAILERDLGRLAPGAAADLCVFDPEAVWTLSPDTWISQGRNTPFMGRELRGRVSWTLLGG 422

Query: 424 KQVY 427
           + V+
Sbjct: 423 RIVF 426


>gi|302189822|ref|ZP_07266495.1| dihydroorotase [Pseudomonas syringae pv. syringae 642]
          Length = 423

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 138/421 (32%), Positives = 211/421 (50%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP   +D++  + VE G + A G+ A     PT  +  D TGLVA PG++D  V+
Sbjct: 7   GARVIDPVSGLDQITDLHVEAGKLSAIGS-APEGFEPTQTI--DATGLVAAPGLVDLNVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAVAGGVTSLCCPPR-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++ 
Sbjct: 123 PIGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ ++G  A++LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DRDLAEGGLAHDGPTASFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  LI  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVDDGLLDLPTLIARLSSGPAAAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G  ADI L D     TV  +   S  +N  F      G V  T + G+  Y
Sbjct: 363 RLPAGKLSAGAPADIVLFD-PAASTVAGETWLSKGENCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|94498776|ref|ZP_01305324.1| dihydroorotase [Sphingomonas sp. SKA58]
 gi|94421785|gb|EAT06838.1| dihydroorotase [Sphingomonas sp. SKA58]
          Length = 442

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 137/423 (32%), Positives = 207/423 (48%), Gaps = 19/423 (4%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT   + N ++ DP+ D    G I++E   I+AAG        P  A   D  GLV  PG
Sbjct: 36  MTLRAIVNGKLADPAADALRDGVILIEGDRIVAAG----QIDVPADADRIDARGLVVAPG 91

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D  V  T  P  +             GGIT   LMP    + LD+   I+ A      
Sbjct: 92  LVDLGVFATDKPAFHF------------GGITRAALMP-DQRAPLDDVGLIRQATRA--G 136

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           K    V+P A  T  + G E++EM L+Q  G  +       I D+ V+L  + YA+ L  
Sbjct: 137 KPDFWVHPIAAATRGLMGSEMAEMGLMQAAGAKAVGTGRQWIADSGVMLRVLAYANGLGL 196

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +     D  L +R V   G  A  LGL   P+ +E + +ARDL++ + TG   H  +++
Sbjct: 197 TLIAHAEDGGLTARAVATSGETATRLGLPHAPACAEAMAIARDLMLVRETGAAIHFRLVT 256

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
                 LI+ AKA   + TCGI+   L LN+     + +  ++ PPLR E +R++ + A+
Sbjct: 257 TRAGFDLIRAAKAEGLRVTCGITPAYLFLNDQAATDFRTFARLSPPLRHEADRLASIAAV 316

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G +D+I S H PR  + K LPFA+A+ G  G ET+L+ +L L     +S+ +L+  L 
Sbjct: 317 ADGTVDVITSGHDPRGPEDKRLPFADAAPGMAGAETLLALSLNLVREGHVSINRLMTLLC 376

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+I  +  G+   G+AAD+ LID +  W V +  M++   NT FDK    G+  R  
Sbjct: 377 ANPAKILGIDAGSFTPGSAADLILIDPDAPWIVDSSRMAASAGNTPFDKLPVQGRARRVM 436

Query: 421 ISG 423
             G
Sbjct: 437 KGG 439


>gi|23098944|ref|NP_692410.1| dihydroorotase [Oceanobacillus iheyensis HTE831]
 gi|22777172|dbj|BAC13445.1| dihydroorotase [Oceanobacillus iheyensis HTE831]
          Length = 430

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 138/429 (32%), Positives = 228/429 (53%), Gaps = 10/429 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH-DCTGLVAVP 59
           M + +LN  R++ PS ++++V  +I +N II  A      ++ P     + D  G + +P
Sbjct: 1   MKTILLNANRLL-PSNELEKVEVLIEDNKIIKIA------SQIPDKVENYIDIEGKLLLP 53

Query: 60  GIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR 119
           G+ID  + L     E+ + I T +  A  GG T++  MP   +   D    +   L +I 
Sbjct: 54  GLIDVHIHLREPGGEHKETIKTGTMAAARGGYTTVCAMP-NTNPVPDHPEALTSLLSKIA 112

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
             + I V P A +T +++G+E ++++ L + G  +F    + I     +  +MK A   N
Sbjct: 113 DDAHIRVLPYASITKSLKGEERTDIQSLIDAGAFAFTDDGVGIQTADQMYQAMKDAARHN 172

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
             +     D+ L   GV++EG ++  L L GIPS+SE+V +ARD+L+A+ TG HYH   +
Sbjct: 173 TTIVAHCEDNSLVYGGVLHEGEVSERLSLPGIPSLSESVQIARDVLLAEATGCHYHVCHV 232

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           S  +S+ +I+ AK      T  +S ++L+LNE D+   N+  K+ PPLRS  ++ ++ + 
Sbjct: 233 STKESVRVIRDAKKAGIHVTAEVSPHHLLLNETDIPDDNADWKMNPPLRSTEDQQALFDG 292

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRA 358
           L  G ID+I +DH P   + K + F EA FG +GLET        L    +++L +L+  
Sbjct: 293 LMDGTIDLIATDHAPHATEEKAVGFKEAPFGIVGLETAFPLLYTHLVLKGKMTLYQLVER 352

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           ++ +PA  F LP G L+  + ADI +IDL  + T+  +   S  KNT FD     G  V 
Sbjct: 353 MTEKPAATFQLPYGKLEEDSVADITVIDLEKEETIHRETFYSKGKNTPFDNWKVKGIPVL 412

Query: 419 TYISGKQVY 427
           T ++G  VY
Sbjct: 413 TMVNGVVVY 421


>gi|288553135|ref|YP_003425070.1| dihydroorotase [Bacillus pseudofirmus OF4]
 gi|288544295|gb|ADC48178.1| dihydroorotase [Bacillus pseudofirmus OF4]
          Length = 425

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 134/416 (32%), Positives = 216/416 (51%), Gaps = 8/416 (1%)

Query: 22  GAIIVENGIILAAGADALNAK----FPTSA--LIHDCTGLVAVPGIIDARVTLTGSPDEY 75
           G I+ E+G ++ A     N K     P  A   I D  G +  PG +D  V L     E 
Sbjct: 8   GFILSESGELVRADVSFENGKVVSTIPNDAEQQIIDVAGKLITPGFVDVHVHLREPGGEK 67

Query: 76  SKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSN 135
            + I T +K A  GG T+I  MP       D    + +  + I+  + +NV P A +T+ 
Sbjct: 68  KETIETGTKAAARGGFTTICAMP-NTRPTPDTKEQLNWMNDRIKETASVNVLPYAAITTR 126

Query: 136 MEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRG 195
           + G+E++    L+E G  +F    + I    ++L +M+ A  L+  +     ++ L   G
Sbjct: 127 LLGRELTNFEELKESGAFAFTDDGVGIQSASMMLEAMRKAAALDMAIVAHCEENTLIQNG 186

Query: 196 VINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHN 255
            ++EG  +   GL GIPS+ E+V +ARD+L+A+  G HYH   IS  +S+ +++ AK   
Sbjct: 187 SVHEGRFSKENGLNGIPSVCESVHIARDVLLAEAAGVHYHVCHISTKESVRVVRDAKRAG 246

Query: 256 TKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPR 315
            + T  ++ ++L+L E+D++  ++  K+ PPLRS+ ++ +++E L  G ID I +DH P 
Sbjct: 247 IRVTAEVTPHHLLLCEDDIDGLDANYKMNPPLRSKEDQEALIEGLLDGTIDFIATDHAPH 306

Query: 316 HMDTKLLPFAEASFGSIGLETMLS-AALRLFHGQQISLKKLIRALSTRPAQIFNLPGGTL 374
             + K      A FG +GLET  +     L     I+LK+LI  L+  PA+ F L  G L
Sbjct: 307 TAEEKAQGIDRAPFGIVGLETAFTLLNTHLVKKNVITLKQLIDWLTVAPAKTFKLNAGGL 366

Query: 375 QTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLE 430
           + G AAD+ +IDL    T+  DD +S  KNT F     TG  + T++ G+ V+  E
Sbjct: 367 KEGAAADLCVIDLEQVETINPDDFASKGKNTPFKGWKTTGWPMMTFVGGELVWEKE 422


>gi|226224440|ref|YP_002758547.1| dihydroorotase [Listeria monocytogenes Clip81459]
 gi|259547448|sp|C1KWD6|PYRC_LISMC RecName: Full=Dihydroorotase; Short=DHOase
 gi|225876902|emb|CAS05611.1| Putative dihydroorotase [Listeria monocytogenes serotype 4b str.
           CLIP 80459]
          Length = 426

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 135/425 (31%), Positives = 225/425 (52%), Gaps = 7/425 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N ++++ S ++ E   ++++NG +    AD++     TS    D TG +  PG ID
Sbjct: 2   YVLKNGQVLNASGEL-ENKDVLIQNGKVNLI-ADSIEV---TSGEEFDATGKLIAPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T ++ A  GG T+I  MP       D    ++    +I+  + 
Sbjct: 57  VHVHLREPGGEHKETILTGTQAAARGGYTTICSMP-NTKPVPDSKEVMESLQAKIKETAK 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +   L+E G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDFEALKEAGAFAFTDDGVGVQLAGTMYEAMKRAAALDMAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++GI A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGIFAEKEGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E  +   +   K+ PPLRS+ +R +++E L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEAIPGNDGNWKMNPPLRSKEDRAALLEGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F   ++ +LK+LI  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEQAAFGIVGLETAFPLLYTHFVKTKEWTLKQLIDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ F LP G L+ G+ ADI ++DL  +  +      S  KNT F  E   G  V T+  
Sbjct: 356 PAECFKLPYGKLEEGSVADIVVLDLEKEANIDPATFYSKGKNTPFVGETCIGWPVATFSE 415

Query: 423 GKQVY 427
           G  VY
Sbjct: 416 GTLVY 420


>gi|124515272|gb|EAY56782.1| Dihydroorotase [Leptospirillum rubarum]
          Length = 438

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 126/427 (29%), Positives = 221/427 (51%), Gaps = 8/427 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSAL-IHDCTGLVAVPGI 61
           SF L + RI+DP+  +D  G + VE G++   GA  +    P++ + + +  G    PG+
Sbjct: 9   SFFLKDVRILDPATGVDTTGHLRVEKGLVAEFGAIGV----PSAGIPVWEGEGSTVTPGL 64

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYAL-EEIRV 120
           +D          EY + I + S+ AV+GG T++ +M    +  ++++  +   +  + R 
Sbjct: 65  VDVHAHFREPGFEYKETIESGSRAAVSGGFTAVCVM--ANTDPVNDHPEVTLGMINKARE 122

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             L  V+P   ++  ++G+ ++EM  L   G V F    + +  +++L  +++YA + + 
Sbjct: 123 IGLCRVFPIGAVSLGLKGETLTEMGALVRAGCVGFSDDGLPVKTSRLLRRALEYAALFHR 182

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V     D  L   GV+NEG ++  LGL GIP+ SE V +ARDL I + T G  H + +S
Sbjct: 183 PVIDHCEDRDLSDGGVMNEGWVSTDLGLRGIPAASEEVVVARDLEILKTTRGRLHVAHLS 242

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
               + L++ AK  +   T     +   L +  V  +++  K+ PPLR+E +R++++E L
Sbjct: 243 TAGGVRLVREAKKRHLHVTAETCPHYFSLTDEAVRCHHADAKMNPPLRTEEDRLAIIEGL 302

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID+I +DH P     K   F +A FG IGLET  S  L+L +   + L  L+  +S
Sbjct: 303 RDGTIDMIATDHAPHAPFEKEREFDQAPFGIIGLETAFSLGLQLVNSGVLDLSMLLYLMS 362

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
            RP+++F LP G ++ G  AD+ + D             S  +N+ F  +   G+V  T+
Sbjct: 363 VRPSRVFGLPRGEIRVGGMADLMVFDPKQSTVAGVPRFHSRSRNSPFSGQKLPGRVRMTF 422

Query: 421 ISGKQVY 427
           + GK+V+
Sbjct: 423 VGGKKVF 429


>gi|261855950|ref|YP_003263233.1| dihydroorotase [Halothiobacillus neapolitanus c2]
 gi|261836419|gb|ACX96186.1| dihydroorotase, multifunctional complex type [Halothiobacillus
           neapolitanus c2]
          Length = 458

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 137/427 (32%), Positives = 217/427 (50%), Gaps = 5/427 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH-DCTGLVAVPGI 61
           ++++   R+ DP+  +D +  + + +G I+  G DA   +FP + +   D  GL  +PG+
Sbjct: 29  TWLIQGARVFDPADQLDRIADVYLADGRIVGIG-DAPE-QFPHTQVQKIDAKGLWLIPGV 86

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           ID    L     E+   I T +  AVAGGIT++  MP      LD     ++     ++ 
Sbjct: 87  IDGWARLREPGLEHKATIATETLAAVAGGITTVC-MPPDTDPVLDTVAVARFIKRRAQLS 145

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
               V     LT  ++G+ ++EM  L E G V+   +   + D ++L  +++YA   + +
Sbjct: 146 GRARVVAIGALTQGLKGELLAEMAELTEGGCVAVSNAHYPVRDLRLLRRALEYAATFDIL 205

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V +   D  L  RG  +EG IA  LGL GIP  +ET PLA+ L +   TG   H + +S 
Sbjct: 206 VVIQPEDPSLSKRGCAHEGAIATRLGLPGIPVSAETAPLAQLLAVVAETGARIHINNLSS 265

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
              + +I  AKA     T  +S ++L L+E D +       V PPLR   +R ++   L 
Sbjct: 266 RAGVRMIAQAKAEGLPVTASVSAHHLWLSEMDTDALCGNTHVQPPLRGLRDRDALRAGLS 325

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID ++SDH P   D KL PF     G  GL+T+L   L+L   + +SL + + AL+ 
Sbjct: 326 DGTIDCVISDHQPHETDAKLAPFPATEPGISGLDTLLPLVLKLVDEEGLSLTRALDALTR 385

Query: 362 RPAQIFNL-PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           RPA++F L   G L  GT AD+ALID +  WT+    M S  ++T F    F  +   T+
Sbjct: 386 RPAELFGLNDSGRLALGTRADVALIDPDAYWTLDEKTMRSAGQDTPFFGWDFRHQTHATW 445

Query: 421 ISGKQVY 427
           ++G+ V+
Sbjct: 446 VNGRLVF 452


>gi|28872155|ref|NP_794774.1| dihydroorotase, multifunctional complex type [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213971477|ref|ZP_03399589.1| dihydroorotase, multifunctional complex type [Pseudomonas syringae
           pv. tomato T1]
 gi|301383496|ref|ZP_07231914.1| dihydroorotase [Pseudomonas syringae pv. tomato Max13]
 gi|302063238|ref|ZP_07254779.1| dihydroorotase [Pseudomonas syringae pv. tomato K40]
 gi|28855409|gb|AAO58469.1| dihydroorotase, multifunctional complex type [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213923759|gb|EEB57342.1| dihydroorotase, multifunctional complex type [Pseudomonas syringae
           pv. tomato T1]
          Length = 423

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 137/421 (32%), Positives = 209/421 (49%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP   +D+   + +E G ++A GA    A F  + +I D TGLVA PG++D  V+
Sbjct: 7   GARVIDPVSGLDQTTDLHIEAGKLVAIGA--APAGFEPTQVI-DATGLVAAPGLVDLNVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAVAGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++ 
Sbjct: 123 PVGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ ++G  A +LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DRDLAEGGLAHDGPTAAFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA+  G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVRSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVDDGLLDLPTLLARLSSGPADAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G  ADI L D     TV  +   S   N  F      G V  T + G+  Y
Sbjct: 363 RLPAGKLSAGAPADIVLFDPTAS-TVAGETWLSKGDNCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|331018481|gb|EGH98537.1| dihydroorotase [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 423

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 137/421 (32%), Positives = 209/421 (49%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP   +D+   + +E G ++A GA    A F  + +I D TGLVA PG++D  V+
Sbjct: 7   GARVIDPVSGLDQTTDLHIEAGKLVAIGA--APAGFEPTQVI-DATGLVAAPGLVDLNVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAVAGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++ 
Sbjct: 123 PVGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ ++G  A +LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DRDLAEGGLAHDGPTAAFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA+  G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTHADRDGLREAVRSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVDDGLLDLPTLLARLSSGPADAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G  ADI L D     TV  +   S   N  F      G V  T + G+  Y
Sbjct: 363 RLPAGKLSAGAPADIVLFDPTAS-TVAGETWLSKGDNCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|288870950|ref|ZP_06115887.2| dihydroorotase [Clostridium hathewayi DSM 13479]
 gi|288865285|gb|EFC97583.1| dihydroorotase [Clostridium hathewayi DSM 13479]
          Length = 431

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 138/426 (32%), Positives = 221/426 (51%), Gaps = 9/426 (2%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADA-LNAKFPTSALIHDCTGLVAVPGII 62
            ++ N RI+ P   +D +G I V +G IL  G  A    KF T   + D  GLVA PG++
Sbjct: 9   MLIKNVRIVSPGNGLDRIGDIAVSDGTILRVGECAEPEDKFDT---VIDGRGLVAAPGLV 65

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V        Y ++I T +  A  GG T+++ M       +D    ++Y LEE + K+
Sbjct: 66  DVHVHFRDPGLTYKEDIHTGAAAAAKGGFTTVVCM-ANTKPPVDNVETLRYVLEEGK-KT 123

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            I+V   A +T  + GKE+++M  L+  G   F    + I D ++L  +M+ A  L   +
Sbjct: 124 GIHVLQAAAVTVGLAGKELTDMEALKAHGAAGFTDDGIPIMDEKLLKTAMEEAARLELPL 183

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           +    D        IN G +++ LG+ G P+++E   +ARD +IA HTG       IS  
Sbjct: 184 SFHEEDPAFIVNNGINHGAVSDELGIYGSPALAEDSLVARDCMIALHTGAEVDIQHISSE 243

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++ ++K AK    +    ++ ++  L E  V  + +L K+ PPLR+E +R +++E L+ 
Sbjct: 244 GAVRMVKLAKELGARVYAEVTPHHFTLTEKAVLEHGTLAKMNPPLRTERDRQAIIEGLKN 303

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALST 361
           G ID+I +DH P   + K  P  +A  G IGLET L  A+ +L     +SL +L+  +S 
Sbjct: 304 GSIDMIATDHAPHSEEEKARPLQQAPSGIIGLETALGLAITKLVRPGHLSLLQLMEKMSL 363

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA++++L  G+++ G AAD+ L D   +WTV   + +S   N+ F      GKV  T  
Sbjct: 364 NPAKLYHLDSGSVEEGKAADLVLFDPEEEWTV--GEFASKSSNSPFTGSRLYGKVKYTIC 421

Query: 422 SGKQVY 427
            GK VY
Sbjct: 422 DGKIVY 427


>gi|313672864|ref|YP_004050975.1| dihydroorotase [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939620|gb|ADR18812.1| dihydroorotase [Calditerrivibrio nitroreducens DSM 19672]
          Length = 422

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 122/382 (31%), Positives = 216/382 (56%), Gaps = 4/382 (1%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           DC G + VPG+ID  V       EY ++I + SK AVAGG+T+   +P+  +  +++  +
Sbjct: 43  DCAGKIVVPGLIDMHVHFRDPGLEYKEDIESGSKAAVAGGVTT--CLPMANTKPVNDNAY 100

Query: 111 IK-YALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLL 169
           I  Y +++ +   LI++YP   +T  +EG E++E+  ++  G ++F      + +++V+ 
Sbjct: 101 ITTYMIDKAKKVGLIDLYPVGAITKGLEGLELAEIGEMKAAGAIAFSDDGKPVMNSEVMR 160

Query: 170 NSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQH 229
            + +Y + +  IV   + D  L ++G IN+G IA   GL GIP+ +E + +ARD+LI++ 
Sbjct: 161 RAAEYINGVGGIVLSHSEDINLAAKGAINDGKIATITGLKGIPAEAEEIIIARDILISKL 220

Query: 230 TGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRS 289
           TG H+H   +S   S+ LI+ AK    + TC ++ ++  L E+++  Y++  K+ PPLR+
Sbjct: 221 TGTHFHFCHVSTKGSLDLIRFAKDKGYRVTCEVAPHHFSLTEDELLSYDTNYKMNPPLRT 280

Query: 290 ETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQ 349
           + +  ++ +A ++G ID I +DH P H D K + F  A+FG IGL+T++   L+L   + 
Sbjct: 281 KEDVYAIKQAFKEGLIDCIATDHAPHHRDEKFVEFDLAAFGIIGLQTLIPLTLKLVEEEV 340

Query: 350 ISLKKLIRALSTRPAQIFNLPG-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFD 408
           I+L   ++  S  PA+I  L   G +     AD+A+ID + ++    +   S   N+ F 
Sbjct: 341 ITLNDFVKYTSYNPAKILGLADKGMVAEDKIADLAIIDKDKEYIFDENLNRSKSSNSPFM 400

Query: 409 KEFFTGKVVRTYISGKQVYTLE 430
            +   G    T  SGK VY L+
Sbjct: 401 GKKLKGINCITIKSGKIVYELQ 422


>gi|330873939|gb|EGH08088.1| dihydroorotase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 423

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 136/421 (32%), Positives = 210/421 (49%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP+  +D+   + +E G ++A GA    A F  + +I D TGLVA PG++D  V+
Sbjct: 7   GARVIDPASGLDQTTDLHIEAGKLVAIGA--APAGFEPTQVI-DATGLVAAPGLVDLNVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ AV GG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAVTGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++ 
Sbjct: 123 PVGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ ++G  A +LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DRDLAEGGLAHDGPTAAFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVEDGLLDLPTLLARLSSGPAGAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G  ADI L D     TV  +   S   N  F      G V  T + G+  Y
Sbjct: 363 RLPAGKLSAGAPADIVLFD-PAASTVAGETWLSKGDNCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|160897029|ref|YP_001562611.1| amidohydrolase [Delftia acidovorans SPH-1]
 gi|160362613|gb|ABX34226.1| amidohydrolase [Delftia acidovorans SPH-1]
          Length = 431

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 132/437 (30%), Positives = 219/437 (50%), Gaps = 24/437 (5%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH---DCTGLVAVPG 60
            ++ N R++DP+R +D+   + ++ G +LA G      K P         D  G   +PG
Sbjct: 3   ILIRNGRVMDPARGLDQQADVAIDGGKVLAIG------KAPEGFAAEREIDAAGCWVLPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFI---KYALEE 117
           ++D  V L     E+   + +    +VAGG+TS++  P      LDE   +   K+  E+
Sbjct: 57  LVDLAVRLREPGHEHEGMLQSEMAASVAGGVTSLVCPP-DTDPVLDEQGLVEMLKFRAEK 115

Query: 118 IRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHM 177
           +    L   +P   LT  ++G+ ++EM  L E G + F Q+ + +  TQ L  ++ YA  
Sbjct: 116 LHQSRL---FPLGALTLGLKGEVLTEMAELTESGCIGFSQAEVPMTSTQTLQRALAYAAT 172

Query: 178 LNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS 237
               V L   + +LG +GV   G +A  +GL G+P  +ET+ L     + + T    H  
Sbjct: 173 YGYTVWLRPQELYLG-KGVAASGPLATRMGLSGVPVAAETIALHTIFELMRGTQARVHLC 231

Query: 238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMV 297
            +S    + L++ AKA   + T  +SIN+L L + D+  ++S  +V PPLR + +R ++ 
Sbjct: 232 RLSSAAGVELVRRAKAEGLQVTADVSINSLHLTDTDIGYFDSSARVTPPLRQQRDRDALS 291

Query: 298 EALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIR 357
            AL  G ID +VSDHTP   D K+LPFAEA  G+ G+E +LS A++      + L + + 
Sbjct: 292 AALADGTIDALVSDHTPVDEDAKVLPFAEAEPGATGVELLLSLAVKWAQESGVPLSRALA 351

Query: 358 ALSTRPAQIFNLPGGTLQ-------TGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKE 410
           A++  P Q+     G LQ        G  AD+ ++D    WTVK  +++S  K+T F   
Sbjct: 352 AITASPVQVLGSALGELQEQLGRLAEGGVADLCIVDPQAAWTVKPQELASQGKSTPFGGY 411

Query: 411 FFTGKVVRTYISGKQVY 427
               +V  T + G+  +
Sbjct: 412 ELPARVRCTLVDGRVAF 428


>gi|46908069|ref|YP_014458.1| dihydroorotase [Listeria monocytogenes serotype 4b str. F2365]
 gi|47093074|ref|ZP_00230852.1| dihydroorotase, multifunctional complex type [Listeria
           monocytogenes str. 4b H7858]
 gi|254826121|ref|ZP_05231122.1| dihydroorotase [Listeria monocytogenes FSL J1-194]
 gi|254852743|ref|ZP_05242091.1| dihydroorotase [Listeria monocytogenes FSL R2-503]
 gi|254931993|ref|ZP_05265352.1| dihydroorotase [Listeria monocytogenes HPB2262]
 gi|254993757|ref|ZP_05275947.1| dihydroorotase [Listeria monocytogenes FSL J2-064]
 gi|255521075|ref|ZP_05388312.1| dihydroorotase [Listeria monocytogenes FSL J1-175]
 gi|300763850|ref|ZP_07073847.1| dihydroorotase, multifunctional complex type [Listeria
           monocytogenes FSL N1-017]
 gi|67460855|sp|Q71YH9|PYRC_LISMF RecName: Full=Dihydroorotase; Short=DHOase
 gi|46881339|gb|AAT04635.1| dihydroorotase, multifunctional complex type [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|47018575|gb|EAL09330.1| dihydroorotase, multifunctional complex type [Listeria
           monocytogenes str. 4b H7858]
 gi|258606067|gb|EEW18675.1| dihydroorotase [Listeria monocytogenes FSL R2-503]
 gi|293583544|gb|EFF95576.1| dihydroorotase [Listeria monocytogenes HPB2262]
 gi|293595361|gb|EFG03122.1| dihydroorotase [Listeria monocytogenes FSL J1-194]
 gi|300515586|gb|EFK42636.1| dihydroorotase, multifunctional complex type [Listeria
           monocytogenes FSL N1-017]
 gi|328466187|gb|EGF37344.1| dihydroorotase [Listeria monocytogenes 1816]
 gi|332312278|gb|EGJ25373.1| Dihydroorotase [Listeria monocytogenes str. Scott A]
          Length = 426

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 135/425 (31%), Positives = 224/425 (52%), Gaps = 7/425 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N ++++ S ++ E   ++++NG +    AD++     TS    D TG +  PG ID
Sbjct: 2   YVLKNGQVLNASGEL-ENKDVLIQNGKVNLI-ADSIEV---TSGEEFDATGKLIAPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T ++ A  GG T+I  MP       D    ++    +I+  + 
Sbjct: 57  VHVHLREPGGEHKETILTGTQAAARGGYTTICSMP-NTKPVPDSKEVMESLQAKIKETAK 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +   L+E G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDFEALKEAGAFAFTDDGVGVQLAGTMYEAMKRAAALDMAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++GI A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGIFAEKEGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E  +   +   K+ PPLRS+ +R +++E L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEAIPGNDGNWKMNPPLRSKEDRAALLEGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F    + +LK+LI  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEQAAFGIVGLETAFPLLYTHFVKTNEWTLKQLIDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ F LP G L+ G+ ADI ++DL  +  +      S  KNT F  E   G  V T+  
Sbjct: 356 PAECFKLPYGKLEEGSVADIVVLDLEKEANIDPATFYSKGKNTPFVGETCIGWPVATFSE 415

Query: 423 GKQVY 427
           G  VY
Sbjct: 416 GTLVY 420


>gi|91787043|ref|YP_547995.1| dihydroorotase [Polaromonas sp. JS666]
 gi|91696268|gb|ABE43097.1| dihydroorotase [Polaromonas sp. JS666]
          Length = 446

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 139/434 (32%), Positives = 219/434 (50%), Gaps = 18/434 (4%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKF-PTSALIHDCTGLVAVPGII 62
            ++ N R+IDP+  +DEV  + +  G I++   +   A F P   L  D TG +  PG+I
Sbjct: 17  LLIKNGRVIDPASGLDEVCDVAIAAGRIVSL--NHTTADFSPNKTL--DATGCIVAPGLI 72

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E+   + +    AVAGG+TS++  P      LDE   ++  + + R + 
Sbjct: 73  DLSARLREPGYEHEGMLESELAAAVAGGVTSLVCPP-DTDPVLDEPGLVE--MLKFRAEK 129

Query: 123 L--INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           L    V+P   LT  ++G+ ++EM  L E G V F Q+ + + +TQVL+ +++YA     
Sbjct: 130 LHQSRVFPLGALTRALKGEALTEMVELTEAGCVGFSQAEVPLANTQVLMRALQYATTFGY 189

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V L   +  LG +GV   G +A  LGL G+   +ET+ L     + + TG   H   IS
Sbjct: 190 TVWLRPQEMHLG-QGVAASGALATRLGLSGVSVAAETIALHTIFELVRATGARVHLCRIS 248

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
               +AL+  AKA     TC +SIN+L L + D+  ++S  ++ PPLR + +R ++ + L
Sbjct: 249 SAAGVALVGKAKAEGLDVTCDVSINSLHLTDVDIGYFDSRMRLDPPLRQQRDRDAIRQGL 308

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID +VSDH P   D K LPFAEA  G+ GLE +L  A +     Q  + + +  L+
Sbjct: 309 ADGTIDALVSDHNPVDEDAKTLPFAEAEAGATGLELLLGLACKWGADSQAGMARALAVLT 368

Query: 361 TRPAQIFNLPGGTLQT-------GTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFT 413
           + PA++     GTLQ        G  AD+ + D   +W V+   + S  K+T F      
Sbjct: 369 SEPARVLGNSLGTLQASAGRLVKGGMADLCVFDPASEWMVEPQALRSQGKHTPFSGYQLP 428

Query: 414 GKVVRTYISGKQVY 427
            +V  T + G+  Y
Sbjct: 429 ARVRWTVVGGQLAY 442


>gi|320355235|ref|YP_004196574.1| dihydroorotase [Desulfobulbus propionicus DSM 2032]
 gi|320123737|gb|ADW19283.1| dihydroorotase [Desulfobulbus propionicus DSM 2032]
          Length = 424

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 134/430 (31%), Positives = 221/430 (51%), Gaps = 8/430 (1%)

Query: 2   TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGI 61
           T++ + N RIIDP+   DE+  ++V +G I      A +   P      D +G   VPG+
Sbjct: 3   TTWRIRNGRIIDPANSRDEIADLLVIDGRI-----GAPDQPVPPDVQELDASGCWVVPGL 57

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           ID  V L    +EY ++I + ++ A  GG T +  MP       D  T     L   R +
Sbjct: 58  IDMHVHLREPGEEYKEDILSGARSAACGGFTGVACMP-NTKPVNDNATVTAMILTRAR-E 115

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           + + V+P   ++   +GK+++E   ++  G+V+       + D+Q++  +++YA      
Sbjct: 116 AAVRVHPVGAISLGSDGKQLAEFGEMRAAGVVAVSDDGRPVRDSQLMRRALEYASDFGLP 175

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V   + +  L S GV+NEG ++  LGL GIP+ +E++ + R++ +A+ TG   H + +S 
Sbjct: 176 VIAHSEEPSL-STGVMNEGPVSTLLGLKGIPTAAESIMVYREIALAEFTGARVHIAHVST 234

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
             SI LI+ AKA   + T   + +   L +  V  Y++  K+ PPLRS  +R ++  AL 
Sbjct: 235 AMSIELIRAAKARGVRVTAETAPHYFTLTDEAVIGYDTNTKMNPPLRSAADREAIRTALA 294

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G +D I +DH P  +  K L F  A+ G IGLET L   L L     I  ++L+  L+ 
Sbjct: 295 DGTLDAIATDHAPHSILEKELEFDAAANGIIGLETALPLTLALVRDGVIDARRLVELLAV 354

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           +PA I  LP G+L  G AAD+ +ID   ++   AD + S  +NT F      G+ V T +
Sbjct: 355 KPAAILGLPAGSLTPGLAADLTVIDPQREFVYTADQVMSKSRNTPFLGWTLQGRAVLTMV 414

Query: 422 SGKQVYTLES 431
            G   ++L +
Sbjct: 415 GGTIRHSLPA 424


>gi|209964827|ref|YP_002297742.1| dihydroorotase-like protein [Rhodospirillum centenum SW]
 gi|209958293|gb|ACI98929.1| dihydroorotase-like protein [Rhodospirillum centenum SW]
          Length = 430

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 142/422 (33%), Positives = 218/422 (51%), Gaps = 3/422 (0%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
           N R++DP+  +D  GA++VE   I   G        P    + DC G    PG++D R  
Sbjct: 9   NARLLDPATGLDAPGALLVEGERIADLGPHLFADGVPEGVAVVDCGGHCLAPGLVDLRAH 68

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           +     E+ + I T  + A AGGIT++  +P      +D+   +++     R + L+ ++
Sbjct: 69  VGEPGFEHDETIATAGRAAAAGGITALAALP-NTDPVIDDVAGLEFIARRAREERLVKIF 127

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
             A +T    G +I+E  LL E G V F     ++ D  V+  ++ YA      +     
Sbjct: 128 AYAAVTRETAGSQITEFGLLAEAGAVGFTDGLHAVADALVMRRALSYASAHGQTIFQHPE 187

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           +  L S G +N G +A  LGL GIP+ +E + L RDL + + TGG YHA+ IS  + + +
Sbjct: 188 EPRLAS-GSMNSGEVATRLGLGGIPAAAEIIMLERDLRLVELTGGRYHAAHISTAEGVEV 246

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I+ AKA     TC  +     L E D+  Y +  K+ PPLR E +R ++V  L  G ID 
Sbjct: 247 IRRAKAKGLAVTCDTAPPYFALTEVDIGDYRTFFKLSPPLRGEMDRRAIVAGLADGTIDA 306

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I SDH P   D+K +PFA+A+FG++G ET+L   L L H   + L + + A++  PA I 
Sbjct: 307 IASDHLPHDQDSKRVPFAQAAFGAVGSETLLPLTLELAHKGALPLLRALAAVTCIPAGIL 366

Query: 368 NLPG-GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
            L   G L+ G  AD+ L D    W V+A+ + S  KNT FD+    G V+RT + G+ V
Sbjct: 367 GLSELGRLRPGGPADLVLFDAGRPWVVEAEKLRSKSKNTCFDRRPVQGLVLRTVVDGRTV 426

Query: 427 YT 428
           + 
Sbjct: 427 HA 428


>gi|114570264|ref|YP_756944.1| dihydroorotase [Maricaulis maris MCS10]
 gi|114340726|gb|ABI66006.1| dihydroorotase [Maricaulis maris MCS10]
          Length = 425

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 126/429 (29%), Positives = 217/429 (50%), Gaps = 11/429 (2%)

Query: 2   TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGI 61
           TS  + N R++DP+   D  G +++E+G+I   G++        +  + D  G +  P +
Sbjct: 3   TSLAITNARLVDPASAHDGPGGVLIEDGVIAQMGSEL---DLDAADEVIDAKGRILAPAL 59

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSF--LDEYTFIKYALEEIR 119
           ID R     +     + + TL   A++GG  +I+L P   S     D +  +   L +  
Sbjct: 60  IDLRCAKEAALTPDGETVDTLCAAAMSGGFGTIVLAPNARSPLDKADGFAGMSRGLGQRS 119

Query: 120 VKSLINVYPTAC-LTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
           V+ L     +AC  T  + G++++E+ L+   G V   Q    I DT+++   + Y    
Sbjct: 120 VRIL-----SACGATQGLAGEQMAEIGLMVRGGAVYAGQGDRPIADTRLMRRLLSYTSQF 174

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
           +  +A    D  L S  V+ E   +  +GL   P++SE + + RD  +A+ +GG      
Sbjct: 175 DIWLACRPADAGLSSGSVVTESDWSARMGLPSEPTVSERIAIERDAALAELSGGKLMIDR 234

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           +S    +  ++H ++ + +    ++I +L LNE D    +S  ++ PPLRSE +R ++VE
Sbjct: 235 LSTAAGLDALRHVRSRDLEIAATVAIAHLTLNEVDAGGLDSAFRMDPPLRSEADRQALVE 294

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
           A+  G+ID +VSDH P   D K  PFA A  G++ LETML A L L H  ++ L   +R 
Sbjct: 295 AVIAGEIDAVVSDHRPTPFDDKADPFALAMAGTLSLETMLGAMLGLVHDGELELIDALRV 354

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           ++  PA +  LP G +  G  AD+ LID +  W  + D  +S   N+ +    F G+V++
Sbjct: 355 MTCGPADLLGLPQGRIAVGAPADLILIDGDKPWVCQPDGFASARGNSAWAGRRFQGRVLQ 414

Query: 419 TYISGKQVY 427
           T ++G  +Y
Sbjct: 415 TIVAGDTLY 423


>gi|299821731|ref|ZP_07053619.1| dihydroorotase [Listeria grayi DSM 20601]
 gi|299817396|gb|EFI84632.1| dihydroorotase [Listeria grayi DSM 20601]
          Length = 425

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 137/427 (32%), Positives = 224/427 (52%), Gaps = 11/427 (2%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGII--LAAGADALNAKFPTSALIHDCTGLVAVPGI 61
           ++L N  II  S +  E   I++E G I  +A+  +A + K      + D  G +  PG 
Sbjct: 2   YILKNGTIISESGE-KEQKDILIEAGRITKIASTIEAADEK------VIDVKGKLVSPGF 54

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           ID  V L     EY + I + +K A  GG T+I  MP       D    ++   + I   
Sbjct: 55  IDVHVHLREPGGEYKETIASGTKSAAKGGYTTICAMP-NTKPVPDTKEIMESIQKRIAET 113

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           +++ V P A +T  +  +E+ +   L+E G  +F    + +     +  +M+ A  LN  
Sbjct: 114 AVVRVLPYASITKALGTEELVDFEGLKEAGAFAFTDDGVGVQLAGTMYEAMQAAAKLNMA 173

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V     D+ L   GV+++G I+  LG+ GIP+I+E+V +ARD+L+A+    HYH   IS 
Sbjct: 174 VVAHCEDNSLIYGGVVHQGKISEELGIKGIPNIAESVQIARDVLLAEAADCHYHVCHIST 233

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
            +S+ +++ AK    K T  +S ++L+LNE D+   +   K+ PPLRS+ ++ +++E L 
Sbjct: 234 KESVRVVRDAKRAGIKVTAEVSPHHLLLNEEDIPENHGYWKMNPPLRSKADQEALLEGLL 293

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALS 360
            G ID I +DH P     K +P  +A+FG +GLET        F    + +LK+L+  ++
Sbjct: 294 DGTIDFIATDHAPHSEAEKDVPMEQAAFGIVGLETAFPLLYTNFVKTNKWTLKQLLDWMT 353

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T+PA++F LP G L+ G  ADI +IDL  + T+  +   S  +NT F      G  V T+
Sbjct: 354 TKPARVFQLPYGDLKEGAVADITVIDLEKENTIDPNTFYSKGRNTPFAGVTCAGYPVMTF 413

Query: 421 ISGKQVY 427
            +G+ VY
Sbjct: 414 ANGELVY 420


>gi|110638193|ref|YP_678402.1| dihydroorotase [Cytophaga hutchinsonii ATCC 33406]
 gi|110280874|gb|ABG59060.1| dihydroorotase [Cytophaga hutchinsonii ATCC 33406]
          Length = 421

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 135/419 (32%), Positives = 225/419 (53%), Gaps = 12/419 (2%)

Query: 1   MTSFVLNNTRIIDPSRDID-EVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVP 59
           M + V+ +  I+D + +++ ++ +I++ENGII       L+A       + +  G+    
Sbjct: 1   MGTIVIRSAEIVDSTSELNGKIRSILIENGIIKKISDKELSAD-----TVIEAKGMKVSL 55

Query: 60  GIIDARVTLTGSPD-EYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           G +D RVT TG P  EY +++ +    A+ GG T+I ++P   +  +     ++Y   + 
Sbjct: 56  GWMDMRVT-TGDPGHEYKEDLNSACNAAMQGGFTAIAVLP-NTTPPMQSKESVEYVKGKT 113

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
           R K L++VYP A LT N +G+E++E+  +   G ++F      I  + +LL ++ Y   +
Sbjct: 114 REK-LVDVYPIAALTLNNKGEELTEILDMNASGAIAFSDGVKPIWHSDLLLRALLYMQPI 172

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
           NA + +   D +L   G +NEG  +  LGL GIP +SE + + RDL I ++TGG  H + 
Sbjct: 173 NAQLIVHAEDKYLSHGGQMNEGKTSTMLGLKGIPKLSEQIMVDRDLSILEYTGGKIHFAH 232

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           IS P+S+ LIK AK      TC I+   L L++  +  ++S  KV PPLRS+ +     +
Sbjct: 233 ISSPKSLELIKEAKKKGLNVTCDIASYQLALDDTMLSSFDSNLKVNPPLRSKRDIDVFWK 292

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
            +  G +D+IVSDH P+  + K L F +A FG IGLETM S      +  +I L K+I  
Sbjct: 293 YINDGTVDVIVSDHIPQDTECKQLEFDQADFGMIGLETMFSVVNT--YNTKIELAKIIEK 350

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
           ++  P  + N+    L+ G  A++ + D   +W + A D+ S   NT F  +   G+ V
Sbjct: 351 ITVAPRAVLNINVPQLKEGAKANLTVFDTEKEWILSAADLRSKSVNTPFIGKKMKGRAV 409


>gi|330951380|gb|EGH51640.1| dihydroorotase [Pseudomonas syringae Cit 7]
          Length = 423

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 138/422 (32%), Positives = 212/422 (50%), Gaps = 7/422 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKF-PTSALIHDCTGLVAVPGIIDARV 66
             R+IDP   +D++  + +E G + A G+    A F PT  +  D TGLVA PG++D  V
Sbjct: 7   GARVIDPVSGLDQITDLHLEAGKLSAIGS--APAGFEPTQTI--DATGLVAAPGLVDLNV 62

Query: 67  TLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
           +L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V
Sbjct: 63  SLREPGYSRKGSIASETRAAVAGGVTSLCCPPR-TKPVLDTSAVAELILDRAREAGFSKV 121

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
           +P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++
Sbjct: 122 FPIGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNS 181

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIA 246
            D  L   G+ ++G  A++LGL GIP  +ETV LARDLL+ + +G   H S ++  +  A
Sbjct: 182 QDRDLAEGGLAHDGPTASFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAA 241

Query: 247 LIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDID 306
           LI  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I 
Sbjct: 242 LIAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVIQ 301

Query: 307 IIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQI 366
            I S H P   D KL PF     G   +E +L  A+ L     + L  LI  LS+ PA  
Sbjct: 302 AISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVDDGLLDLPTLIARLSSGPAAA 361

Query: 367 FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
             LP G L  G  ADI L D     TV  +   S  +N  F      G V  T + G+  
Sbjct: 362 LRLPAGKLSAGAPADIVLFD-PAASTVAGETWLSKGENCPFIGHCLPGSVRYTLVDGRIS 420

Query: 427 YT 428
           Y+
Sbjct: 421 YS 422


>gi|332981997|ref|YP_004463438.1| dihydroorotase [Mahella australiensis 50-1 BON]
 gi|332699675|gb|AEE96616.1| dihydroorotase [Mahella australiensis 50-1 BON]
          Length = 438

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 131/422 (31%), Positives = 216/422 (51%), Gaps = 6/422 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++   RIIDPS   D V  +++E G I        N +    ++I D  GL  VPG++D
Sbjct: 5   ILVKGGRIIDPSSHTDRVSDLLIEEGFIKVIDD---NIECDADSVI-DAGGLWIVPGLVD 60

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L     E  + I T ++ A AGG TS+  MP      +D    ++Y   +   ++ 
Sbjct: 61  MHCHLREPGYESKETIYTGTRSAAAGGFTSVACMP-NTQPPIDSKLMVEYIRLKAEKEAA 119

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + VYP  C+T   EGKE++   +L+E G V+      S+ +++++  +++YA   +  + 
Sbjct: 120 VKVYPIGCITKGREGKELAPFGMLKEAGAVALSDDGDSVANSRIMRLALQYALSFDMPII 179

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  L + GVIN+G +A  LGL GIP+ +E V +ARD+++A  TGG  H + +S   
Sbjct: 180 AHCEDKGLAADGVINDGAVATRLGLKGIPAAAEEVIVARDIVLAASTGGRLHIAHVSTAG 239

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +I+ AK      TC    +   L++   E YN+  KV PPLRS ++  +++  L+ G
Sbjct: 240 SVEMIRQAKRLGINVTCETCPHYFSLSDEMAEGYNTAAKVNPPLRSPSDVEAIISGLKDG 299

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALSTR 362
            ID+I +DH P  + +K      A+FG  G ET LS  +  L     +   + I  ++  
Sbjct: 300 TIDVIATDHAPHDLSSKGDDIYNAAFGISGFETALSVGITYLVDTDILEPMQFIAKMTHV 359

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA I  +  G L  G  AD+A++D   ++TV      S  KN+ +D     G+V+ T ++
Sbjct: 360 PADILGINAGQLSIGLPADVAIVDPYAEYTVDTGKFISNGKNSPYDGMRLKGRVLYTIVN 419

Query: 423 GK 424
           G+
Sbjct: 420 GR 421


>gi|254246155|ref|ZP_04939476.1| Dihydroorotase [Burkholderia cenocepacia PC184]
 gi|124870931|gb|EAY62647.1| Dihydroorotase [Burkholderia cenocepacia PC184]
          Length = 425

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 138/419 (32%), Positives = 217/419 (51%), Gaps = 8/419 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP    +    + V +G I A G+    A F     I D +GL+  PG++D    L  
Sbjct: 10  LIDPVAGTEGQADVFVADGKIAALGS--APAGFNADQTI-DASGLIVAPGLVDLCARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYP 128
              E+   + +    AVAGG+T+++  P      LDE   ++  + + R ++L   NV+P
Sbjct: 67  PGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQANVHP 123

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   D
Sbjct: 124 LGALTVGLKGEVITEMVALTESGCVGFTHANVPVRDTQVLLRALQYASTYGYTTWLRPLD 183

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
            F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL+
Sbjct: 184 AFIGRGGVAASGALASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLALV 243

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     TC + +N++ L + D+  ++S  ++ PPLRSE +R ++  AL  G ID I
Sbjct: 244 REAKAEGLPVTCDVGVNHVHLIDVDIGYFDSQFRLDPPLRSERDREAIRVALADGTIDAI 303

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            SDHTP   D KLLPF EA+ G+ GLE +LS  L+     +  L + +R +++ PA +  
Sbjct: 304 CSDHTPVDDDEKLLPFGEATPGATGLELLLSLTLKWADETRTPLAQALRRITSAPADVLQ 363

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           LP G L  G AAD+ + D    W V+   + S   N+ F        V  T ++G+  +
Sbjct: 364 LPAGRLAEGGAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPATVRTTLVAGRVAF 422


>gi|26991676|ref|NP_747101.1| dihydroorotase [Pseudomonas putida KT2440]
 gi|24986775|gb|AAN70565.1|AE016699_6 dihydroorotase, multifunctional complex type [Pseudomonas putida
           KT2440]
 gi|313500975|gb|ADR62341.1| PyrC_2 [Pseudomonas putida BIRD-1]
          Length = 423

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 138/416 (33%), Positives = 209/416 (50%), Gaps = 5/416 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP+  +D+V  + ++ G I+A GA    A F  S  I    GLVA PG++D  V+
Sbjct: 7   GARVIDPNSGLDQVTDLHLDGGRIVAIGA--APAGFSASRTIQ-ADGLVAAPGLVDLGVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         NI + ++ AVAGG+TS+   P      LD     +  L+  R  +   VY
Sbjct: 64  LREPGYSRKGNIASETRAAVAGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAANSKVY 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   LT  +EG++++E+  L++ G V+F      I + + L  +++YA   +  V   + 
Sbjct: 123 PVGALTKGLEGEQLAELVALRDTGCVAFGNGLKEIPNNRTLARALEYAATFDLTVVFHSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ +EG +A++LGL GIP  +ETV LAR+LL+ + +G   H S I+  +   L
Sbjct: 183 DRDLAQGGLAHEGAMASFLGLPGIPESAETVALARNLLLVEQSGVRAHFSQITSARGARL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQALGLPVTADVALYQLILTDESLREFSSLYHVQPPLRTAADRDGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVQDGLLDLPTLLARLSSGPAAAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
            LP G L+ G AAD+ L D     TV  +   S  +N  F      G V  T + G
Sbjct: 363 RLPAGELKVGGAADLVLFDPQAS-TVAGEQWFSRGENCPFIGHCLPGAVRYTLVDG 417


>gi|284102425|ref|ZP_06386043.1| dihydroorotase, multifunctional complex type [Candidatus
           Poribacteria sp. WGA-A3]
 gi|283830317|gb|EFC34550.1| dihydroorotase, multifunctional complex type [Candidatus
           Poribacteria sp. WGA-A3]
          Length = 439

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 133/423 (31%), Positives = 214/423 (50%), Gaps = 3/423 (0%)

Query: 10  RIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIH-DCTGLVAVPGIIDARVTL 68
           +++DP +  + +  +++E G I A   D         AL   D TGL+  PG +D  V  
Sbjct: 13  QVVDPGQ-WNGIADVLIEEGKISAVEPDLQQKLQGVKALTTIDATGLIVCPGFVDLHVHF 71

Query: 69  TGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYP 128
                E+ + I T S  AVAGG TS+  MP       D  +  ++ L +        V+P
Sbjct: 72  REPGFEHKETIATGSAAAVAGGFTSVCCMP-NTQPVNDSRSVTEFILAQAAAAGKARVFP 130

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              +T   +G+E++E+  L + G V+     + + ++ V+  +M+YA   +  V     D
Sbjct: 131 IGAITKGSKGEELAEIGELFDAGCVAVSDDGVPVMNSLVMRRAMEYASAFHLPVIDHCED 190

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
             L   G ++EG ++  LG+ GIP  +E V +AR++ +A+ TG   H   +S   S+ ++
Sbjct: 191 SQLSRGGSMHEGAVSTELGIPGIPKAAEEVMVARNISLAELTGARLHLPHVSTVGSVRMV 250

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     T     ++  L +  V  Y+S  K+ PPLR++ +  ++ E L    IDI+
Sbjct: 251 REAKARGVPVTAEACPHHFSLTDEAVRSYDSNAKMNPPLRTDEDVQAIKEGLRDHTIDIV 310

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            +DH P  +  KLL F  A FG IGLET     L L     ++L++ I  L+  PA++F+
Sbjct: 311 ATDHAPHAVQEKLLEFDAAPFGIIGLETAFPLTLNLVEEGLLTLEQAIAKLTREPARVFD 370

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYT 428
           L  GTL  G AAD+ LID    W V    + S+ +NT F      G+VV+T ++G+ VY 
Sbjct: 371 LSHGTLAPGVAADVTLIDPAATWVVDPARLHSLSRNTPFAGWTMKGRVVKTLVAGEVVYD 430

Query: 429 LES 431
            ES
Sbjct: 431 RES 433


>gi|295706347|ref|YP_003599422.1| dihydroorotase [Bacillus megaterium DSM 319]
 gi|294804006|gb|ADF41072.1| dihydroorotase [Bacillus megaterium DSM 319]
          Length = 429

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 138/430 (32%), Positives = 224/430 (52%), Gaps = 13/430 (3%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGII--LAAGADALNAKFPTSALIHDCTGLVAV 58
           MT+ + N T + +    I++V  + +ENG+I  +A+  D  N +      + D  G    
Sbjct: 1   MTTIIKNATWLNEGK--IEQV-ELKIENGVIAEIASHIDVENEE------VIDAGGNFLS 51

Query: 59  PGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           PG+ID  V L     E  + I T +  A  GG T+I  MP       D    +++  + I
Sbjct: 52  PGLIDVHVHLREPGGEKKETIETGTLAAAKGGFTAIAAMP-NTRPVPDTVEQMEWVNKRI 110

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
              + + V P A +T+   GKE+++   L+E G  +F    + +  T ++L +MK A  L
Sbjct: 111 EETAHVRVLPYASITTRQLGKELTDFEGLKEAGAFAFTDDGVGVQSTGMMLEAMKKAASL 170

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
           N  +     D+ L ++G +++G  A   GL GIPSI E V +ARD+L+A+    HYH   
Sbjct: 171 NKAIVAHCEDNDLINKGCVHDGKFAKEHGLNGIPSICEAVQIARDVLLAEAANCHYHVCH 230

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           +S  +SI  I+ AK    + T  ++ ++L+LNE D+   +S  K+ PPLR + ++ +++E
Sbjct: 231 VSTKESIRAIRDAKKAGIRVTAEVTPHHLLLNEEDIPELDSNFKMNPPLRGKDDQQALIE 290

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIR 357
           AL  G +D I +DH P   D K      A FG +GLET        L   + ++L++L+ 
Sbjct: 291 ALLDGTLDFIATDHAPHTADEKAEGMELAPFGIVGLETAFPLLYTNLVLKEVMTLEQLVS 350

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            L+ +PA  FNLP GT++ G  AD+ +IDL  +  +  ++  S  KNT F      G  V
Sbjct: 351 YLTNKPADTFNLPYGTIEVGKPADLTIIDLETEKAINPEEFVSKGKNTPFANWVCKGWPV 410

Query: 418 RTYISGKQVY 427
            T + GK+V+
Sbjct: 411 MTLVEGKRVW 420


>gi|294500998|ref|YP_003564698.1| dihydroorotase [Bacillus megaterium QM B1551]
 gi|294350935|gb|ADE71264.1| dihydroorotase [Bacillus megaterium QM B1551]
          Length = 429

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 138/430 (32%), Positives = 224/430 (52%), Gaps = 13/430 (3%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGII--LAAGADALNAKFPTSALIHDCTGLVAV 58
           MT+ + N T + +    I++V  + +ENG+I  +A+  D  N +      + D  G    
Sbjct: 1   MTTIIKNATWLNEGK--IEKV-ELKIENGVIAEIASHIDVENEE------VIDAGGNFLS 51

Query: 59  PGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           PG+ID  V L     E  + I T +  A  GG T+I  MP       D    +++  + I
Sbjct: 52  PGLIDVHVHLREPGGEKKETIETGTLAAAKGGFTAIAAMP-NTRPVPDTVEQMEWVNKRI 110

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
              + + V P A +T+   GKE+++   L+E G  +F    + +  T ++L +MK A  L
Sbjct: 111 EETAHVRVLPYASITTRQLGKELTDFEGLKEAGAFAFTDDGVGVQSTGMMLEAMKKAASL 170

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
           N  +     D+ L ++G +++G  A   GL GIPSI E V +ARD+L+A+    HYH   
Sbjct: 171 NKAIVAHCEDNDLINKGCVHDGKFAKEHGLNGIPSICEAVQIARDVLLAEAANCHYHVCH 230

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           +S  +SI  I+ AK    + T  ++ ++L+LNE D+   +S  K+ PPLR + ++ +++E
Sbjct: 231 VSTKESIRAIRDAKKAGIRVTAEVTPHHLLLNEEDIPGLDSNFKMNPPLRGKDDQQALIE 290

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIR 357
           AL  G +D I +DH P   D K      A FG +GLET        L   + ++L++L+ 
Sbjct: 291 ALLDGTLDFIATDHAPHTADEKAAGMELAPFGIVGLETAFPLLYTNLVLKEVMTLEQLVS 350

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            L+ +PA  FNLP GT++ G  AD+ +IDL  +  +  ++  S  KNT F      G  V
Sbjct: 351 YLTNKPADTFNLPYGTIEVGKPADLTIIDLETEKAINPEEFVSKGKNTPFANWVCKGWPV 410

Query: 418 RTYISGKQVY 427
            T + GK+V+
Sbjct: 411 MTLVEGKRVW 420


>gi|206561482|ref|YP_002232247.1| dihydroorotase [Burkholderia cenocepacia J2315]
 gi|198037524|emb|CAR53461.1| dihydroorotase-like protein [Burkholderia cenocepacia J2315]
          Length = 425

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 139/419 (33%), Positives = 217/419 (51%), Gaps = 8/419 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP    +    + V +G I A G+    A F     I D +GLV  PG++D    L  
Sbjct: 10  LIDPVAGTEGQADVFVADGKIAALGS--APAGFNADKTI-DASGLVVAPGLVDLCARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYP 128
              E+   + +    AVAGG+T+++  P      LDE   ++  + + R ++L   NV+P
Sbjct: 67  PGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQANVHP 123

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   D
Sbjct: 124 LGALTVGLKGEVITEMVALTESGCVGFTHANVPVRDTQVLLRALQYASTYGYTTWLRPLD 183

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
            F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL+
Sbjct: 184 AFIGRGGVAASGALASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLALV 243

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     TC + +N++ L + D+  ++S  ++ PPLRSE +R ++  AL  G ID I
Sbjct: 244 RAAKAEGLPVTCDVGVNHVHLIDVDIGYFDSQFRLDPPLRSERDREAIRVALADGTIDAI 303

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            SDHTP   D KLLPF EA+ G+ GLE +LS  L+     +  L + +R +++ PA +  
Sbjct: 304 CSDHTPVDDDEKLLPFGEATPGATGLELLLSLTLKWADETRTPLAQALRRITSAPADVLQ 363

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           LP G L  G AAD+ + D    W V+   + S   N+ F        V  T ++G+  +
Sbjct: 364 LPAGRLAEGGAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPATVRTTLVAGQVAF 422


>gi|163782777|ref|ZP_02177773.1| dihydroorotase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881898|gb|EDP75406.1| dihydroorotase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 422

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 137/431 (31%), Positives = 216/431 (50%), Gaps = 15/431 (3%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M   ++    +IDPS+++  +  I++E   I     D     F   A I D TGL+  PG
Sbjct: 1   MIKHLIKGGMVIDPSQELLGIYDILIEGDRIKRVEEDI----FEPEAEIIDATGLIVAPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
            +D  V        Y ++I + SK AVAGG T+++ MP      +D     +Y   +   
Sbjct: 57  FVDLHVHFRDPGQTYKEDILSGSKSAVAGGFTTVVCMP-NTEPPIDSPETAEYIRAKANC 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             L NV P   +T   +G+E+++   L+E G V+F      + D+ +    MK A  L+A
Sbjct: 116 WGLCNVLPAGTITKGRKGEELADFWALKEAGCVAFTDDGAPVMDSDI----MKKALELSA 171

Query: 181 IVALDTHDHFLGSR---GVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS 237
            + +   +H    R   G +NEG I+  +GL   P  +E V  ARD +++ +TGGH H  
Sbjct: 172 QLGVPIMNHCEDDRVAVGAVNEGEISALIGLSSRPPEAEDVLNARDCVLSYYTGGHVHIQ 231

Query: 238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMV 297
            ++    + +++H K    + TC ++ N+L+  E ++       +V PPLR E +R ++ 
Sbjct: 232 HLTTALGVDIVRHFKDKGARITCEVNPNHLLFTEGELLKSGGNARVNPPLRKEEDREALR 291

Query: 298 EALEKGDIDIIVSDHTPRHMDTKLLPFAEASF-GSIGLETMLSAALRLFHGQQISLKKLI 356
            AL  G ID I +DH P  +  K     EA+  G IGL+T L   L L   + +SL KL+
Sbjct: 292 RALSDGTIDCIATDHAPHAVFEK--GSVEAALPGIIGLQTALPIMLELVSREYLSLIKLV 349

Query: 357 RALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
             +ST PA++  + GGTL+ G+ AD+ + DL  +W +  +   S  KNT       TGKV
Sbjct: 350 ELMSTNPAKVIGVEGGTLKEGSPADVVIFDLKKEWVLNEETNFSKSKNTPLWNRTLTGKV 409

Query: 417 VRTYISGKQVY 427
           + T   GK VY
Sbjct: 410 MYTIKGGKVVY 420


>gi|302134696|ref|ZP_07260686.1| dihydroorotase [Pseudomonas syringae pv. tomato NCPPB 1108]
          Length = 423

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 136/421 (32%), Positives = 208/421 (49%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP   +D+   + +E G ++A GA    A F  + +I D TGLVA PG++D  V+
Sbjct: 7   GARVIDPVSGLDQTTDLHIEAGKLVAIGA--APAGFEPTQVI-DATGLVAAPGLVDLNVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAVAGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++ 
Sbjct: 123 PVGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ ++G  A +LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DRDLAEGGLAHDGPTAAFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL    PPLR+  +R  + EA+  G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHAQPPLRTRADRDGLREAVRSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVDDGLLDLPTLLARLSSGPADAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G  ADI L D     TV  +   S   N  F      G V  T + G+  Y
Sbjct: 363 RLPAGKLSAGAPADIVLFDPTAS-TVAGETWLSKGDNCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|229593130|ref|YP_002875249.1| dihydroorotase [Pseudomonas fluorescens SBW25]
 gi|229364996|emb|CAY53136.1| dihydroorotase-like protein [Pseudomonas fluorescens SBW25]
          Length = 423

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 136/420 (32%), Positives = 210/420 (50%), Gaps = 5/420 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP+  +D +  + +E G I+A GA    A F  S  + D  GLVA PG++D  V 
Sbjct: 7   GARVIDPASGLDHITDLHLEAGKIIAIGA--APAGFSASETL-DAKGLVAAPGLVDLNVA 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         NI + ++ A AGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGNIISETRAAAAGGVTSLCCPP-HTKPVLDTSAVTELILDRAREAGNCKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S   T+ LL +++YA   +  V   + 
Sbjct: 123 PIGALSKGLEGEQLAELIALRDAGCVAFGNGLESFRSTRTLLRALEYAATFDLTVIFHSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ +EG +A++LGL GIP  +ETV LARDLL+ + +G   H S ++  + +AL
Sbjct: 183 DRDLAEGGLAHEGAVASFLGLPGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGVAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  +  A++ G +  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTLADREGLRAAVKSGVVSA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS  PA+  
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVEDGLLDLPTLLARLSAGPAEAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G+AAD+ L D   + TV  +   S  +N  F        V  T + G+  Y
Sbjct: 363 RLPAGKLAVGSAADLVLFD-PARSTVAGEHWLSKGENCPFIGHSLPATVRYTLVDGRISY 421


>gi|312797103|ref|YP_004030025.1| aspartate carbamoyltransferase non-catalytic chain [Burkholderia
           rhizoxinica HKI 454]
 gi|312168878|emb|CBW75881.1| Aspartate carbamoyltransferase non-catalytic chain (EC 2.1.3.2)
           [Burkholderia rhizoxinica HKI 454]
          Length = 433

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 140/429 (32%), Positives = 219/429 (51%), Gaps = 18/429 (4%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDC-----TGLVAVPG 60
           +   R+IDP+   ++   I + +G I++ GA         +A +HD      TGL   PG
Sbjct: 9   IKGGRVIDPAAGTEQQADIWIADGRIVSIGA--------ATAPLHDAQTLDATGLAIAPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D    L     EY   + +    A+AGG+TS++  P      LDE   ++  + + R 
Sbjct: 61  LVDLCARLREPGYEYRATLESEMAAALAGGVTSLVCPP-DTDPPLDEPGLVE--MLKFRA 117

Query: 121 KSL--INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
           ++L  ++VYP   LT  ++G+ I+EM  L E G V F Q+   I DT VLL +++YA+  
Sbjct: 118 RNLDQVHVYPLGALTVGLKGEVITEMAELTEAGCVGFTQAERPIVDTTVLLRALQYANTF 177

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
              V L   D +LG  GV   G +A+ LGL  +P  +ET+ L     + + TG   H   
Sbjct: 178 GYTVWLRPQDPYLGRGGVAASGPVASRLGLSAVPVAAETIALHTIFELMRATGARVHLQH 237

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           +S    + L++ AK      TC ++IN++ L + D+  +++  +V PPLRS  +R ++  
Sbjct: 238 LSSAAGLELVRAAKREGLPVTCDVTINHVHLIDVDIGYFDAQFRVDPPLRSHRDRDAIRA 297

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRA 358
           AL  G ID I SDHTP   D KL PF EAS G+ GLE +LS  L+    ++ SL   +  
Sbjct: 298 ALADGTIDAICSDHTPVDDDEKLRPFGEASPGATGLELLLSLTLKWAAEEKRSLAYALTK 357

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           ++  PA +  LP G L+ G  AD+ + D    W V+   + S   NT F       +V  
Sbjct: 358 VTCAPAGLLGLPAGRLEPGVTADLCMFDPAAHWHVEPRALKSQGHNTPFLGYELPARVRA 417

Query: 419 TYISGKQVY 427
           T ++G+  Y
Sbjct: 418 TIVAGRVAY 426


>gi|148550075|ref|YP_001270177.1| dihydroorotase [Pseudomonas putida F1]
 gi|148514133|gb|ABQ80993.1| dihydroorotase [Pseudomonas putida F1]
          Length = 423

 Score =  213 bits (541), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 138/416 (33%), Positives = 209/416 (50%), Gaps = 5/416 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP+  +D+V  + ++ G I+A GA    A F  S  I    GLVA PG++D  V+
Sbjct: 7   GARVIDPNSGLDQVTDLHLDGGRIVAIGA--APAGFSASRTIQ-ADGLVAAPGLVDLGVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         NI + ++ AVAGG+TS+   P      LD     +  L+  R  +   VY
Sbjct: 64  LREPGYSRKGNIASETRAAVAGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAANSKVY 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   LT  +EG++++E+  L++ G V+F      I + + L  +++YA   +  V   + 
Sbjct: 123 PVGALTKGLEGEQLAELVALRDTGCVAFGNGLKEIPNNRTLARALEYAATFDLTVVFHSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ +EG +A++LGL GIP  +ETV LAR+LL+ + +G   H S I+  +   L
Sbjct: 183 DRDLAQGGLAHEGAMASFLGLPGIPESAETVALARNLLLVEQSGVRAHFSQITSARGARL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQALGLPVTADVALYQLILTDESLREFSSLYHVQPPLRTAADRDGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVQDGLLDLPTLLARLSSGPAAAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
            LP G L+ G AAD+ L D     TV  +   S  +N  F      G V  T + G
Sbjct: 363 RLPAGELKVGGAADLVLFDPQAS-TVAGEQWFSRGENCPFIGHCLPGAVRYTLVDG 417


>gi|124005864|ref|ZP_01690702.1| dihydroorotase [Microscilla marina ATCC 23134]
 gi|123988547|gb|EAY28188.1| dihydroorotase [Microscilla marina ATCC 23134]
          Length = 427

 Score =  213 bits (541), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 129/433 (29%), Positives = 225/433 (51%), Gaps = 14/433 (3%)

Query: 3   SFVLNNTRIIDPSRDID-EVGAIIVENGIILAAGADALNAKFPTSALIH----DCTGLVA 57
           +++++N  IID   + + +  +I++ENG+I       ++   PT +  H        L  
Sbjct: 2   NYLIHNVEIIDKHSEFNRQRKSILIENGVITQ-----ISDISPTQSTDHLTVISGQNLQL 56

Query: 58  VPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEE 117
             G  D R +      EY + ++T    A AGG T + ++P      +     + Y L+ 
Sbjct: 57  SAGWFDMRASFCDPGFEYKETLSTGCNAAQAGGFTEVAVLP-NTQPVIQTKNELAY-LKS 114

Query: 118 IRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHM 177
             ++ L+ +YP A ++ N EGKE++EM  L   G ++F      +  + +L+ +++Y   
Sbjct: 115 HNLRHLVQIYPIAAVSVNAEGKELTEMLDLHTHGAIAFSDGIQPVWHSDILVKTLQYLQK 174

Query: 178 LNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS 237
            + ++     D  L   G +NEG+ +  LGL G+P+++E + + RDL    + GG  H S
Sbjct: 175 FDGLLINRPEDLMLTRFGTMNEGVSSTMLGLKGMPALAEEMMIRRDLDFLAYAGGKIHFS 234

Query: 238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMV 297
            IS  +S+ LI+ AKA   + +C ++ + + +++  +  ++S  KV PP R +T+  +++
Sbjct: 235 AISSARSVQLIREAKAQGLQVSCDVAAHQIAIDDAALMSFDSFLKVNPPFRGKTDIEALL 294

Query: 298 EALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIR 357
           E L+ G ID++VSDH P+  ++K L F  A FG++GLET     L  F  + +SL+  I 
Sbjct: 295 EGLQDGTIDVVVSDHRPQDEESKNLEFDLAEFGALGLETAF-GVLNTFGKKHLSLEDKID 353

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            L+ RP QI  LP   ++ G  A++ L D   +WTV+   + S  KN+ F     TGK V
Sbjct: 354 KLTFRPRQILKLPQAHIKVGEEANLTLFDAQQEWTVEPKHIQSKSKNSPFLGTTLTGKPV 413

Query: 418 RTYISGKQVYTLE 430
             + SG Q    E
Sbjct: 414 AVF-SGAQTNWQE 425


>gi|330961166|gb|EGH61426.1| dihydroorotase [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 423

 Score =  213 bits (541), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 134/421 (31%), Positives = 210/421 (49%), Gaps = 5/421 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP   +D++  + +E G + A GA A     P   +  D +GLVA PG++D  V+
Sbjct: 7   GARVIDPVSGLDQITDLHIEAGKLAAIGA-APTGFQPVQTI--DASGLVAAPGLVDLNVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ A AGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAAAGGVTSVCCPPR-TKPVLDTSAVAELILDRAREAGFSKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++ 
Sbjct: 123 PVGALSKGLEGEQLAELIALRDAGCVAFGNGLNSFSNTRTLCRALEYAATFDLTVIFNSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ +EG  A++LGL GIP  +ETV LARDLL+ + +G   H S ++  +  AL
Sbjct: 183 DRDLAEGGLAHEGPTASFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADREGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVEDGLLDLPTLLARLSSGPADAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G+ ADI L D     T+  +   S  +N  F      G V  T + G+  Y
Sbjct: 363 RLPAGKLSAGSPADIVLFD-PAASTLAGETWLSKGENCPFIGHCLPGSVRYTLVDGRISY 421

Query: 428 T 428
           +
Sbjct: 422 S 422


>gi|148259744|ref|YP_001233871.1| dihydroorotase, multifunctional complex type [Acidiphilium cryptum
           JF-5]
 gi|146401425|gb|ABQ29952.1| dihydroorotase [Acidiphilium cryptum JF-5]
          Length = 428

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 132/423 (31%), Positives = 216/423 (51%), Gaps = 4/423 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           ++   RI+DP+   D VG ++V +G+I   GA       P  A++ D    +  PG++DA
Sbjct: 9   LIRGARIVDPATGHDAVGDLLVRDGVIADFGA---GLGRPDGAVMIDAAEQILCPGLVDA 65

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
           R +L     EY + I T ++ A A GIT+I ++P  + +  D+   ++           +
Sbjct: 66  RASLGEPGYEYRETIATAAEAANAAGITTIAVLPDNIPA-TDDPALVRALAGAGAATGRL 124

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
            + P    T   +G+ I+E  LL+  G V+F     +I    ++  ++ YA    A++  
Sbjct: 125 TIAPYGAATRGCKGEMIAEYGLLRAAGAVAFSDGARAIGPAGLMRRALSYARGFGAMIVQ 184

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              +  L + G    G  A  +GL GIP+ +E + +ARD+ +A+ TGG  H + +S  ++
Sbjct: 185 HPEEPSLAAGGAATAGARATLMGLPGIPACAEAMMVARDIRLAELTGGAVHFAHVSTGEA 244

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + LI+ AK      TC  +     LNEN +  + +  K+ PPLRSE +R+++  AL  G 
Sbjct: 245 LDLIRGAKRRGLAITCDTAPPYFDLNENAIGDFRTYAKLSPPLRSEADRLAVCAALADGT 304

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID +VSDH PR  D K LPFAEA+ G  GL T+L+  L       + L   +  L+ RPA
Sbjct: 305 IDAVVSDHQPRDADDKRLPFAEAAPGGAGLATLLAITLAQVQSGGLGLIAALSLLTDRPA 364

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++F L  G +  G  AD+ L      W ++A  +    +NT FD     G V  T+ +G+
Sbjct: 365 RLFGLEAGRIARGAPADLCLFAPERPWRIEAGALPGKAQNTPFDGRPVEGVVTGTWKAGR 424

Query: 425 QVY 427
           +V+
Sbjct: 425 RVH 427


>gi|308069857|ref|YP_003871462.1| dihydroorotase (DHOase) [Paenibacillus polymyxa E681]
 gi|305859136|gb|ADM70924.1| Dihydroorotase (DHOase) [Paenibacillus polymyxa E681]
          Length = 440

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 122/382 (31%), Positives = 197/382 (51%), Gaps = 2/382 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  G + +PG+ID  V L     EY + I T S+ AV GG T+I  MP       D    
Sbjct: 58  DAQGKLVIPGLIDMHVHLREPGFEYKETIETGSRAAVKGGFTTIACMP-NTRPVTDNVDT 116

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           ++  L++ +   L  V P A +T N  G+E+++   L+  G + F    + +   Q++ +
Sbjct: 117 VQLVLKKGQEAGLAKVLPYAAITKNELGRELTDFEALKAAGAIGFTDDGVGVQSAQMMKD 176

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +M  A  L+  V     D+ L     + +G  A   GL GIP+ SE + + RD+L+++ T
Sbjct: 177 AMARAKALDMPVIAHCEDNTLVEGAAVTDGEFAKRHGLKGIPNESEAIHVGRDILLSEAT 236

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G HYH   +S  QS+ LI+HAK+   K T  +  ++L+L++ D+   ++  K+ PPLRS 
Sbjct: 237 GAHYHVCHVSTEQSVRLIRHAKSFGIKVTAEVCPHHLVLSDEDIPGLDANWKMNPPLRSP 296

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQ-Q 349
            +  + +E LE G IDI+V+DH     + K      A FG +G ET        F    Q
Sbjct: 297 RDVQACIEGLEDGTIDIVVTDHAAHSEEEKARGMELAPFGIVGFETAFPLLYTKFVATGQ 356

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            +L  L+R ++  PA++F L  G L+ G  AD+ +IDL  + +V     +S  +NT F  
Sbjct: 357 WTLDFLVRRMTADPARVFRLDTGRLEEGAPADLTMIDLEQEQSVDPQTFASKGRNTPFTG 416

Query: 410 EFFTGKVVRTYISGKQVYTLES 431
               G  V+T++ GK V++ + 
Sbjct: 417 WKLKGWPVKTWVDGKLVWSADE 438


>gi|326403288|ref|YP_004283369.1| dihydroorotase [Acidiphilium multivorum AIU301]
 gi|325050149|dbj|BAJ80487.1| dihydroorotase [Acidiphilium multivorum AIU301]
          Length = 428

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 132/423 (31%), Positives = 216/423 (51%), Gaps = 4/423 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           ++   RI+DP+   D VG ++V +G+I   GA       P  A++ D    +  PG++DA
Sbjct: 9   LIRGARIVDPATGHDAVGDLLVRDGVIADFGA---GLGRPDGAVMIDAAEQILCPGLVDA 65

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
           R +L     EY + I T ++ A A GIT+I ++P  + +  D+   ++           +
Sbjct: 66  RASLGEPGYEYRETIATAAEAANAAGITTIAVLPDNIPA-TDDPALVRALAGAGAATGRL 124

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
            + P    T   +G+ I+E  LL+  G V+F     +I    ++  ++ YA    A++  
Sbjct: 125 TIAPYGAATRGCKGEMIAEYGLLRAAGAVAFSDGARAIGPAGLMRRALSYARGFGAMIVQ 184

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              +  L + G    G  A  +GL GIP+ +E + +ARD+ +A+ TGG  H + +S  ++
Sbjct: 185 HPEEPSLAAGGAATAGARATLMGLPGIPACAEAMMVARDIRLAELTGGAVHFAHVSTGEA 244

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + LI+ AK      TC  +     LNEN +  + +  K+ PPLRSE +R+++  AL  G 
Sbjct: 245 LDLIRGAKRRGLAITCDTAPPYFDLNENAIGDFRTYAKLSPPLRSEADRLAVCAALADGT 304

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           ID +VSDH PR  D K LPFAEA+ G  GL T+L+  L       + L   +  L+ RPA
Sbjct: 305 IDAVVSDHQPRDADDKRLPFAEAAPGGAGLATLLAITLAQVQSGGLGLIAALSLLTDRPA 364

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           ++F L  G +  G  AD+ L      W ++A  +    +NT FD     G V  T+ +G+
Sbjct: 365 RLFGLDAGRIARGAPADLCLFAPERPWRIEAGALPGKAQNTPFDGRPVEGVVTGTWKAGR 424

Query: 425 QVY 427
           +V+
Sbjct: 425 RVH 427


>gi|154148442|ref|YP_001406526.1| dihydroorotase (DHOase) [Campylobacter hominis ATCC BAA-381]
 gi|153804451|gb|ABS51458.1| dihydroorotase (DHOase) [Campylobacter hominis ATCC BAA-381]
          Length = 426

 Score =  212 bits (540), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 136/420 (32%), Positives = 224/420 (53%), Gaps = 19/420 (4%)

Query: 24  IIVENG-IILAAGADALNAKFPTSALIH------------DCTGLVAVPGIIDARVTLTG 70
           I+++NG +I A G   +N       ++             D    + +PG+ID  V    
Sbjct: 3   ILIKNGTVINATGRQKINVLIENDKILKLTNSDEKADKIIDAKEKLVMPGLIDMHVHFRD 62

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              EY  +I T S+ AVAGG+T+ + M    +   D  T  +  +++ + K LI++ P  
Sbjct: 63  PGFEYKDDINTGSECAVAGGVTTCMCMA-NTNPVNDNRTITEAMIKKAKAKGLIDLLPIG 121

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            +T + EGK+I EM  + E G V+F    + + D+ V+  +++Y+      V     D  
Sbjct: 122 AITKDFEGKKIVEMGDMIEGGCVAFSDDGLPVTDSSVMRQALEYSAYFGTFVINHCEDCS 181

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           L   GV+NEG ++  LGL G+ S  E + +ARDLL+A+ TGGH H + +S   S+ LI+ 
Sbjct: 182 LCHGGVMNEGKVSAILGLKGMASEKEEIMVARDLLLAKKTGGHIHIAHVSSLWSLKLIEQ 241

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AK      TC ++ ++   +EN +  Y++  K+ PPLR+  +  ++  AL+ G ID+I +
Sbjct: 242 AKKDGINVTCEVTPHHFSFDENRLITYDTNYKMSPPLRTNKDLAAIRTALKNGMIDVIAT 301

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLP 370
           DH P   D K + F +A FG +GL+T++   L L     ISL+K++   S RPA+I N+ 
Sbjct: 302 DHAPHSWDDKFVEFDKAPFGILGLQTLVPLTLNLVKEGIISLEKMVSLCSARPAEILNIK 361

Query: 371 G-GTLQTGTAADIALI--DLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
             G ++ G  ADIA+I  DL Y +    +   SI+ + +F+KE  TG  + T  +G+ V+
Sbjct: 362 NKGEIKAGNIADIAIIDPDLKYIYDKNLNKSKSIN-SPLFNKE-LTGAAICTIKNGRVVF 419


>gi|107021944|ref|YP_620271.1| dihydroorotase [Burkholderia cenocepacia AU 1054]
 gi|116688891|ref|YP_834514.1| dihydroorotase [Burkholderia cenocepacia HI2424]
 gi|105892133|gb|ABF75298.1| dihydroorotase [Burkholderia cenocepacia AU 1054]
 gi|116646980|gb|ABK07621.1| dihydroorotase [Burkholderia cenocepacia HI2424]
          Length = 425

 Score =  212 bits (540), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 138/419 (32%), Positives = 216/419 (51%), Gaps = 8/419 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP    +    + V +G I A G+    A F     I D +GL+  PG++D    L  
Sbjct: 10  LIDPVAGTEGQADVFVADGKIAALGS--APAGFNADQTI-DASGLIVAPGLVDLCARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL--INVYP 128
              E+   + +    AVAGG+T+++  P      LDE   ++  + + R ++L   NV+P
Sbjct: 67  PGYEHKATLASEMAAAVAGGVTTLVCPP-DTDPVLDEPGLVE--MLKFRARNLHQANVHP 123

Query: 129 TACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHD 188
              LT  ++G+ I+EM  L E G V F  + + + DTQVLL +++YA        L   D
Sbjct: 124 LGALTVGLKGEVITEMVALTESGCVGFTHANVPVRDTQVLLRALQYASTYGYTTWLRPLD 183

Query: 189 HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALI 248
            F+G  GV   G +A+ LGL G+P  +ET+ L     + + TG   H + +S    +AL+
Sbjct: 184 AFIGRGGVAASGALASRLGLSGVPVAAETIALHTIFELMRVTGARVHLARLSSAAGLALV 243

Query: 249 KHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDII 308
           + AKA     TC + +N++ L + D+  ++S  ++ PPLRSE +R ++  AL  G ID I
Sbjct: 244 REAKAEGLPVTCDVGVNHVHLIDVDIGYFDSQFRLDPPLRSERDREAIRVALADGTIDAI 303

Query: 309 VSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFN 368
            SDHTP   D KLLPF EA+ G+ GLE +LS  L+        L + +R +++ PA +  
Sbjct: 304 CSDHTPVDDDEKLLPFGEATPGATGLELLLSLTLKWADETGTPLAQALRRITSAPADVLQ 363

Query: 369 LPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           LP G L  G AAD+ + D    W V+   + S   N+ F        V  T ++G+  +
Sbjct: 364 LPAGRLAEGGAADLCVFDPRAHWRVEPRALKSQGHNSPFLGYELPATVRTTLVAGRVAF 422


>gi|319892193|ref|YP_004149068.1| Dihydroorotase [Staphylococcus pseudintermedius HKU10-03]
 gi|317161889|gb|ADV05432.1| Dihydroorotase [Staphylococcus pseudintermedius HKU10-03]
          Length = 425

 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 127/378 (33%), Positives = 192/378 (50%), Gaps = 2/378 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  G    PG ID  V L     EY + I T +K A  GG T++  MP       D    
Sbjct: 45  DAKGHFLAPGFIDVHVHLREPGGEYKETIETGTKAAARGGFTTVCPMP-NTKPVPDSLEH 103

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +    E I   + + V P A +T    GKE  + + L E G  +F    + +    ++  
Sbjct: 104 LTQLNELIDKNAQVRVLPYASITVRQAGKEHVDFKALAENGAFAFTDDGVGVQKAAMMYE 163

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +M+ A   N  V     D+ L   G ++EG  +  LG+ GIP+I E+V +ARD+L+++ T
Sbjct: 164 AMQQAKAQNKAVVAHCEDNSLIYGGAMHEGRRSQELGIPGIPNICESVQIARDVLLSEAT 223

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G HYH   +S  +S+ +I+ AK      T  ++ ++L+L E+DV   N++ K+ PPLRS+
Sbjct: 224 GCHYHVCHVSTKESVRVIRDAKKAGIPVTAEVTPHHLLLTEDDVPGDNAIYKMNPPLRSQ 283

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQ 349
            +R +++E L  G ID I +DH P   D K  P   A FG +G ET        F     
Sbjct: 284 EDRAALLEGLLDGTIDCIATDHAPHAADEKAQPMTRAPFGIVGSETAFPLLYTHFVKNGD 343

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            SL++L+  L+T+PA++F LP G L  G  AD+ LI+L+  + +KA+D  S   NT F  
Sbjct: 344 WSLQQLVDYLTTKPAEVFGLPYGKLAEGALADLTLINLDDAYEIKAEDFLSKASNTPFLG 403

Query: 410 EFFTGKVVRTYISGKQVY 427
           E   G  + T + G   Y
Sbjct: 404 ETVYGNPILTMVEGNIRY 421


>gi|310642962|ref|YP_003947720.1| dihydroorotase [Paenibacillus polymyxa SC2]
 gi|309247912|gb|ADO57479.1| Dihydroorotase [Paenibacillus polymyxa SC2]
          Length = 440

 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 122/382 (31%), Positives = 197/382 (51%), Gaps = 2/382 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  G + +PG+ID  V L     EY + I T S+ AV GG T+I  MP       D    
Sbjct: 58  DAQGKLVIPGLIDMHVHLREPGFEYKETIETGSRAAVKGGFTTIACMP-NTRPVTDNVDT 116

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           ++  L++ +   L  V P A +T N  G+E+++   L+E G + F    + +   Q++ +
Sbjct: 117 VQLVLKKGQEAGLAKVLPYAAITKNELGRELTDFEALKEAGAIGFTDDGVGVQSAQMMKD 176

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +M  A  L+  V     D+ L     + +G  A   GL GIP+ SE + + RD+L+++ T
Sbjct: 177 AMSRAKALDMPVIAHCEDNTLVVGAAVTDGEFAKRHGLKGIPNESEAIHVGRDILLSEAT 236

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G HYH   +S  QS+ LI+HAK+   K T  +  ++L+L++ D+   ++  K+ PPLRS 
Sbjct: 237 GAHYHVCHVSTEQSVRLIRHAKSFGIKVTAEVCPHHLVLSDEDIPGLDANWKMNPPLRSP 296

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQ-Q 349
            +  + +E L+ G IDIIV+DH     + K      A FG +G ET        F    Q
Sbjct: 297 RDVQACIEGLQDGTIDIIVTDHAAHSEEEKAKGMELAPFGIVGFETAFPLLYTKFVATGQ 356

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            +L  L+R ++  PA++F L  G ++ G  AD+ +IDL  +  V     +S  +NT F  
Sbjct: 357 WTLDFLVRRMTADPARVFRLDTGRMEEGAPADLTMIDLEQEQAVDPQTFASKGRNTPFTG 416

Query: 410 EFFTGKVVRTYISGKQVYTLES 431
               G  V+T++ GK V++ + 
Sbjct: 417 WKLKGWPVKTWVDGKLVWSADE 438


>gi|326315678|ref|YP_004233350.1| allantoinase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323372514|gb|ADX44783.1| Allantoinase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 431

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 134/428 (31%), Positives = 216/428 (50%), Gaps = 16/428 (3%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           ++ N R+IDP+   D+   + +  G ++A G  A     P   +  D TG V +PG++D 
Sbjct: 4   LIQNGRVIDPASGFDKNVDVAIAAGRVIALG-RAPQDFHPARTI--DATGCVVLPGLVDL 60

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL- 123
              L     E+   + +    AVAGG+TS++  P      LDE   ++  + + R + L 
Sbjct: 61  AARLREPGHEHEGMLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVE--MLKFRAEKLH 117

Query: 124 -INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              ++P   LT  + G  ++EM  L E G V F Q+ +++  TQVL  +++YA      V
Sbjct: 118 RARLFPLGALTRGLAGDVLTEMAELTESGCVGFGQADVALASTQVLQRALQYAATYGYTV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
            L   +  LG +GV   G +A  LGL G+P  +ET+ L     + +  G   H   +S  
Sbjct: 178 WLRPQELHLG-KGVAASGPLATRLGLSGVPVAAETIALHTIFELLKPIGARVHLCRLSSA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
             + L++ AKA   K TC +SIN+L+L + D+  ++S  ++ PPLR + +R +++ AL  
Sbjct: 237 AGVQLVRQAKAGGLKVTCDVSINSLLLTDTDIGYFDSRARLSPPLRQQRDRDALLAALAD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID +VSDHTP   D K LPFAEA  G+ GLE + S AL+      + L +    +++ 
Sbjct: 297 GTIDALVSDHTPVDEDAKTLPFAEAEPGATGLELLASIALKWSRDHGVPLDRAFATVTSE 356

Query: 363 PAQI-------FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK 415
           P+++       F    G L  G  AD+ + D    WTV+   + S  ++T F      G+
Sbjct: 357 PSRVLGSALGTFAASAGRLVEGGVADLCVFDPQAAWTVEPGALRSQGRHTPFSGYELPGR 416

Query: 416 VVRTYISG 423
           V  T + G
Sbjct: 417 VRWTLVGG 424


>gi|66043748|ref|YP_233589.1| dihydroorotase [Pseudomonas syringae pv. syringae B728a]
 gi|63254455|gb|AAY35551.1| Amidohydrolase [Pseudomonas syringae pv. syringae B728a]
          Length = 423

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 137/422 (32%), Positives = 212/422 (50%), Gaps = 7/422 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKF-PTSALIHDCTGLVAVPGIIDARV 66
             R+IDP   +D++  + +E G + A G+    A F PT  +  D TGLVA PG++D  V
Sbjct: 7   GARVIDPVSGLDQITDLHLEAGKLSAIGS--APAGFEPTQTI--DATGLVAAPGLVDLNV 62

Query: 67  TLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
           +L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V
Sbjct: 63  SLREPGYSRKGSIASETRAAVAGGVTSLCCPPR-TKPVLDTSAVAELILDRAREAGFSKV 121

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
           +P   L+  ++G++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++
Sbjct: 122 FPIGALSKGLDGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNS 181

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIA 246
            D  L   G+ ++G  A++LGL GIP  +ETV LARDLL+ + +G   H S ++  +  A
Sbjct: 182 QDRDLAEGGLAHDGPTASFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAA 241

Query: 247 LIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDID 306
           LI  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I 
Sbjct: 242 LIAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVIQ 301

Query: 307 IIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQI 366
            I S H P   D KL PF     G   +E +L  A+ L     + L  LI  LS+ PA  
Sbjct: 302 AISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVDDGLLDLPTLIARLSSGPAAA 361

Query: 367 FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
             LP G L  G  ADI L D     TV  +   S  +N  F      G V  T + G+  
Sbjct: 362 LRLPAGKLSAGAPADIVLFD-PAASTVAGETWLSKGENCPFIGHCLPGSVRYTLVDGRIS 420

Query: 427 YT 428
           Y+
Sbjct: 421 YS 422


>gi|330941622|gb|EGH44403.1| dihydroorotase [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 423

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 138/422 (32%), Positives = 211/422 (50%), Gaps = 7/422 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKF-PTSALIHDCTGLVAVPGIIDARV 66
             R+IDP   +D++  + +E G + A G+    A F PT  +  D TGLVA PG+ D  V
Sbjct: 7   GARVIDPVSGLDQITDLHLEAGKLSAIGS--APAGFEPTQTI--DATGLVAAPGLADLNV 62

Query: 67  TLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINV 126
           +L         +I + ++ AVAGG+TS+   P      LD     +  L+  R      V
Sbjct: 63  SLREPGYSRKGSIASETRAAVAGGVTSLCCPPR-TKPVLDTSAVAELILDRAREAGFSKV 121

Query: 127 YPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDT 186
           +P   L+  +EG++++E+  L++ G V+F     S  +T+ L  +++YA   +  V  ++
Sbjct: 122 FPIGALSKGLEGEQLAELIALRDAGCVAFGNGLSSFSNTRTLCRALEYAATFDLTVIFNS 181

Query: 187 HDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIA 246
            D  L   G+ ++G  A++LGL GIP  +ETV LARDLL+ + +G   H S ++  +  A
Sbjct: 182 QDRDLAEGGLAHDGPTASFLGLAGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGAA 241

Query: 247 LIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDID 306
           LI  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I 
Sbjct: 242 LIAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTRADRDGLREAVKSGVIQ 301

Query: 307 IIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQI 366
            I S H P   D KL PF     G   +E +L  A+ L     + L  LI  LS+ PA  
Sbjct: 302 AISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVDDGLLDLPTLIARLSSGPAAA 361

Query: 367 FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQV 426
             LP G L  G  ADI L D     TV  +   S  +N  F      G V  T + G+  
Sbjct: 362 LRLPAGKLSAGAPADIVLFD-PAASTVAGETWLSKGENCPFIGHCLPGSVRYTLVDGRIS 420

Query: 427 YT 428
           Y+
Sbjct: 421 YS 422


>gi|225175224|ref|ZP_03729220.1| dihydroorotase, multifunctional complex type [Dethiobacter
           alkaliphilus AHT 1]
 gi|225169400|gb|EEG78198.1| dihydroorotase, multifunctional complex type [Dethiobacter
           alkaliphilus AHT 1]
          Length = 428

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 135/422 (31%), Positives = 214/422 (50%), Gaps = 6/422 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
             V+    ++DPS++ID +  ++V  G I      A N +     +I D  G V VPG I
Sbjct: 2   EMVIRGGTVVDPSQNIDGIFDVLVAEGKIARI---AQNIEAEGREII-DAAGKVVVPGFI 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E  + + T S+ A AGG T I  +P      +D    +    E     +
Sbjct: 58  DLHTHLRQPGGEAKETVLTGSRAAAAGGYTGITALP-NTRPVIDNAQMVARQNELAAKAN 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+ V+P   +T   EG E++E+  + +QG  +       + D ++L N+M Y   L+  +
Sbjct: 117 LVRVWPVGAVTKGSEGNELAEIGGMVKQGARAVTDDGRGVPDARLLRNAMLYCRELDIPL 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                +  L   G ++EG+++  LGL G+P+ +ETV LARDL++A+ TG   H   +S  
Sbjct: 177 FEHCEEEALAGNGQLHEGVVSARLGLQGMPAAAETVMLARDLVLAKETGCRIHIMHVSCA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +++ LI+ AK      T  ++ ++L+L +  VE YN+  K+ PPLR+  +  ++ + L  
Sbjct: 237 EAVELIRKAKKEGIPVTAEVTPHHLLLTDEAVEGYNTNAKMKPPLRTAEDVAAVRKGLAD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALST 361
           G ID + +DH P     K   F  A FG +GLET        L     ISL +L+  +S 
Sbjct: 297 GTIDAVGTDHAPHTESEKANDFISAPFGIVGLETAFPLLYTHLVRPGVISLSQLVERMSW 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
           RPA I  +P GTL+ G AAD+A+ID   +  ++ +   S  KNT FD+   TG  V T +
Sbjct: 357 RPAAILGVPHGTLKPGGAADLAIIDTQQEQIIEKERFYSKGKNTPFDRWPVTGIPVLTMV 416

Query: 422 SG 423
           +G
Sbjct: 417 AG 418


>gi|282883332|ref|ZP_06291926.1| dihydroorotase [Peptoniphilus lacrimalis 315-B]
 gi|281296836|gb|EFA89338.1| dihydroorotase [Peptoniphilus lacrimalis 315-B]
          Length = 420

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 129/426 (30%), Positives = 224/426 (52%), Gaps = 12/426 (2%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R+IDPS++ID++  I +++G I    +D  + K      I D   L+A PG++D
Sbjct: 1   MIIKNARVIDPSQNIDKIADIQIKDGKINKIASDLTDDK-----EIIDAKNLIACPGLVD 55

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V        Y +++ + ++ A+AGG TS++ M    +  +D    +K   +  R K L
Sbjct: 56  VHVHFRDPGFTYKEDLYSGTQAAIAGGYTSVVCM-ANTNPVMDSPEKVKEFYK--RAKEL 112

Query: 124 -INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            INVY  + LT N E  ++ +M  L ++G V F    +   +++++L +MK A  LN ++
Sbjct: 113 PINVYTVSALTENFEDNKLVDMEKLLQEGAVGFTDDGIPNRNSKLILQAMKEAKKLNTLI 172

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           +    D  L     IN G ++    + G PS++E+  +ARD+  A +TG       IS  
Sbjct: 173 SFHEEDPNLIENNGINHGEVSEKFNIYGSPSLAESSFIARDVEYAINTGAKIDIQHISTK 232

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           + + L+++ K+        ++ ++  L +  +  Y  + K+ PPLR+E +R +++E ++ 
Sbjct: 233 RGVDLVRYGKSRGANVFAEVTPHHFTLTDKALLKYKQMAKMNPPLRTEEDRQAILEGIKD 292

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALST 361
           G +++I +DH P   + K     +A  G IGLET L   +R L     IS+ KLI  +ST
Sbjct: 293 GTLELIATDHAPHSQEEKNREITKAPSGIIGLETALGLGVRELVEKNIISINKLIELMST 352

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            P + +NLPGGTL+ G+ ADI + D   +++++     S   NT F  E   GKV+ T  
Sbjct: 353 NPCKKYNLPGGTLKEGSRADILIFDPKREYSIET--FKSKSSNTPFKGEKLIGKVIYTIS 410

Query: 422 SGKQVY 427
            G  +Y
Sbjct: 411 KGHIIY 416


>gi|289548893|ref|YP_003473881.1| dihydroorotase [Thermocrinis albus DSM 14484]
 gi|289182510|gb|ADC89754.1| dihydroorotase, multifunctional complex type [Thermocrinis albus
           DSM 14484]
          Length = 423

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 130/429 (30%), Positives = 219/429 (51%), Gaps = 9/429 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M+  +L   R++DPS+ +DE   ++++ G I A G D     F T  L+    G V  P 
Sbjct: 1   MSRILLKKGRVVDPSQGLDETLDVLIDKGKIKALGKDL----FETECLVLHVEGCVVAPA 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
            +D  V +      Y ++I T  + AVAGG T+++ MP      +D     +Y +++   
Sbjct: 57  FVDIHVHMRDPGQTYKEDIETACRSAVAGGFTTLVCMP-NTEPPIDNPHVARYVIQKGEK 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             L NV P   +T   +GKE+++   L+  G V+       + D+ ++  +++ A  L  
Sbjct: 116 IGLCNVLPAGAITKGRKGKELTDFYALKMAGCVALTDDGSPLTDSLLMKRALQLAKQLGL 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           +V     D  L + G INEG I++ LGL   P  +E + +ARD +++  TG   H   +S
Sbjct: 176 LVMNHCEDDKL-AYGSINEGSISDLLGLSVRPVEAEDILVARDCILSYRTGCPVHIQHVS 234

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S+ +I+  K      +C ++  +L+  E ++    +  KV PPLR E +R +++EA+
Sbjct: 235 SALSVEIIRFFKKLGAPVSCEVNPYHLLFTEKEILSSGADAKVNPPLRREEDRAALLEAV 294

Query: 301 EKGDIDIIVSDHTPRHMDTK-LLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
             G ID I +DH P H   K L+ FA    G IGL+T L  AL L     I++++++  +
Sbjct: 295 ADGTIDCIATDHAPHHTSEKELVSFALP--GMIGLQTALPIALSLVREGHITMQRMVELM 352

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           S  PA++  + GG+L+ G+ A++ + D   +WT+      S  KNT    +   GKV+ T
Sbjct: 353 SCNPARLLGIEGGSLRPGSEANVVVFDPEREWTLDQHTNLSRSKNTPLWGKKLKGKVLYT 412

Query: 420 YISGKQVYT 428
              GK VY+
Sbjct: 413 IYRGKVVYS 421


>gi|315303749|ref|ZP_07874255.1| dihydroorotase [Listeria ivanovii FSL F6-596]
 gi|313627881|gb|EFR96508.1| dihydroorotase [Listeria ivanovii FSL F6-596]
          Length = 426

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 134/425 (31%), Positives = 224/425 (52%), Gaps = 7/425 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
           +VL N +I++ + ++ E   I+++NG +    AD+++    TS  + D +  V  PG ID
Sbjct: 2   YVLKNGQILNEAGEL-ESKDILIQNGKVNLI-ADSIDV---TSGEVFDASEKVIAPGFID 56

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T ++ A  GG T+I  MP       D    ++     I+  + 
Sbjct: 57  VHVHLREPGGEHKETILTGTEAAARGGYTTICSMP-NTKPVPDSKARMESLQALIQETAK 115

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V P A +T+++   E+ +M  L + G  +F    + +     +  +MK A  L+  + 
Sbjct: 116 VRVLPYASITTSLGTDELVDMEALTQAGAFAFTDDGVGVQLAGTMYEAMKQAAKLDKAIV 175

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D+ L   GV+++G  A   GL GIP+I+E+V +ARD+L+A+  G HYH   IS  +
Sbjct: 176 AHCEDNSLIYGGVVHDGTFAKKEGLKGIPNIAESVQIARDVLLAEAAGCHYHVCHISTKE 235

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +++ AK    + T  +S ++LIL+E D+   +   K+ PPLRS+ +R +++  L  G
Sbjct: 236 SVRVVRDAKRAGIRVTAEVSPHHLILDEEDIPGNDGNWKMNPPLRSKEDRAALLAGLLDG 295

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLIRALSTR 362
            ID I +DH P   + K +P  +A+FG +GLET        F   ++ +LK+LI  ++ +
Sbjct: 296 TIDFIATDHAPHAAEEKNVPMEKAAFGIVGLETAFPLLYTHFVKTKEWTLKQLIDWMTVK 355

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ F LP G L+ G  ADI ++DL  +  +      S  +NT F  E   G  V T+  
Sbjct: 356 PAECFQLPYGKLEEGRVADIVVLDLAKESKIDPTTFYSKGRNTPFTGETCFGWPVATFAE 415

Query: 423 GKQVY 427
           GK VY
Sbjct: 416 GKLVY 420


>gi|218779220|ref|YP_002430538.1| dihydroorotase, multifunctional complex type [Desulfatibacillum
           alkenivorans AK-01]
 gi|218760604|gb|ACL03070.1| dihydroorotase, multifunctional complex type [Desulfatibacillum
           alkenivorans AK-01]
          Length = 433

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 132/424 (31%), Positives = 201/424 (47%), Gaps = 1/424 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +     I+DP   ID    IIVE   I +         +P    + DCTGL AVPG++D
Sbjct: 7   LIFRGAHIVDPINRIDAAMDIIVEGDCIHSLVYPGSENSWPQPCEVMDCTGLTAVPGLVD 66

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+ + I T +  A +GG T++  MP   S   D    ++  L   + +  
Sbjct: 67  MHVHLREPGQEHKETIETGTHAAASGGFTAVCCMP-NTSPANDSPEILRQILSTAKNQGH 125

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             VY    +T  + G+ + +   L ++G V+F    M + D   +  ++K A  L   + 
Sbjct: 126 CKVYAACAVTRGLSGQTLVDFETLAQEGAVAFTDDGMPVKDPDAMRQALKRASALGLPIL 185

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               +  L   GV+N G  A  LG  GIP+ +E+V + RD+ +++ TG   H   +S  +
Sbjct: 186 SHCEEMPLVGGGVMNLGPAAEKLGQKGIPNTAESVMVERDIELSRETGAAVHICHVSTRE 245

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+  ++ AK      T   + +  +L ++ V    +  K+ PPLRSE +R ++  AL +G
Sbjct: 246 SVLALEKAKDEGLPVTAETAPHYFMLTDDAVAEKGANAKMNPPLRSEKDRQAIRTALAEG 305

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID I +DH P   + K  PF  A  G IGLET L  AL L H   I+L  ++  +S  P
Sbjct: 306 TIDAIATDHAPHSPEEKNAPFENAPNGIIGLETALPLALSLVHDGVITLADMVMKMSVNP 365

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           ++I  L    L  G  ADI  IDL+  + V  D  +S  +NT FD    TG    T + G
Sbjct: 366 SRILGLAPSGLCKGAPADITFIDLDKVYEVNPDRFASKSRNTPFDGMKLTGAAAMTVVDG 425

Query: 424 KQVY 427
           K  Y
Sbjct: 426 KITY 429


>gi|258515566|ref|YP_003191788.1| dihydroorotase, multifunctional complex type [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257779271|gb|ACV63165.1| dihydroorotase, multifunctional complex type [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 429

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 137/424 (32%), Positives = 219/424 (51%), Gaps = 6/424 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++    ++D    I+    I++ +G I A G+D LN K    A I D  G +  PG+ID
Sbjct: 3   LLVKGGTVVDSLGQIETKADILIADGKIEAVGSD-LNVK---GAEIIDAGGKIVTPGLID 58

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E  + I T ++ A  GG TS+  MP       D+ T IK+ +E  +   +
Sbjct: 59  MHVHLREPGFEAKETIATGTRAAARGGFTSVACMP-NTRPVADDQTVIKFIVERAKETGI 117

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NV+P   +T   +G+E+SEM  L+  G V+F      +  + V+  +M+YA ML   V 
Sbjct: 118 VNVFPIGAVTKGSKGEELSEMADLKAYGAVAFSDDGSPVSSSAVMRRAMQYAKMLGLPVI 177

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  L + G+++EG ++  LGL GIPS +E + ++RD+L+A+ TG   H + IS   
Sbjct: 178 SHCEDKDLVAGGLMHEGYMSTVLGLRGIPSAAEEIMVSRDILLAELTGCPLHLAHISTAG 237

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ L++ AKA     T   + ++  L +N V  YN+  KV PPLR++ +  ++ + L  G
Sbjct: 238 SVRLVREAKARGLAVTAEATPHHFTLTDNVVVDYNTATKVNPPLRTDEDVAAVRQGLADG 297

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTR 362
            ID+I +DH P   + K + +  A FG +GLET +      L     ++L + I+ ++  
Sbjct: 298 TIDVIATDHAPHTAEEKDVEYQYAPFGMVGLETAVGLIFTELIAPGFLTLSEAIKKITVN 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+I  +  GTL  G  ADI +ID + +  V A    S  KN+ F      G  V T + 
Sbjct: 358 PAKILGINKGTLAVGADADITVIDPDLEENVDAGKFLSKGKNSPFTGRRLRGLPVMTVVG 417

Query: 423 GKQV 426
           G+ V
Sbjct: 418 GRIV 421


>gi|291561120|emb|CBL39919.1| dihydroorotase [butyrate-producing bacterium SS3/4]
          Length = 424

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 131/426 (30%), Positives = 219/426 (51%), Gaps = 7/426 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R++D   + DE+  ++++ G I   G    +  +     + D  G V  PG+ID
Sbjct: 2   ILIKNGRVVDAKSNTDEILDVVIDGGKIKTIGKVEDDGSYEQ---VIDADGCVVAPGLID 58

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V        Y ++I T S  A  GG T+++ M       +D    +KY +EE + K+ 
Sbjct: 59  VHVHFRDPGLTYKEDIQTGSAAAKKGGYTTVVTMA-NTKPPVDNVETVKYIIEEGK-KTG 116

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           INV P AC++  M+G+E+++M  L+  G V F    + + + +++  +MK A  LN  ++
Sbjct: 117 INVLPAACVSVGMKGQELTDMGALKAAGAVGFTDDGIPLMNEKLVYEAMKKAKELNVPLS 176

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D    S   IN G +A  LG+ G P+++E   +ARD +IA HTG   +   IS   
Sbjct: 177 FHEEDPAFISENGINAGAVAKELGITGSPALAEDSLVARDCMIALHTGASVNIQHISSAT 236

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+  +K AK      T  ++ ++  L+E  V  + ++ K+ PPLR+  +R  ++E ++ G
Sbjct: 237 SVKAVKLAKELGANVTAEVTPHHFTLDETAVLEHGAMAKMNPPLRTAKDREGIIEGIKDG 296

Query: 304 DIDIIVSDHTPRHMDTK-LLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALST 361
            ID+I +DH P   + K +LP  +A  G IGLET L  A+  L     ++  +L+  +  
Sbjct: 297 SIDMIATDHAPHSAEEKAVLPVWKAPSGIIGLETALGLAVTELVKKGHLTTMQLVEKMCV 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA++++   G L  G  ADI + + N +WTV  D+++S   NT F      G+V  T  
Sbjct: 357 NPAKLYHFDKGYLTEGGDADIVIFNENEEWTVTDDEIASKSHNTPFIGTKLFGRVKYTIC 416

Query: 422 SGKQVY 427
            GK VY
Sbjct: 417 GGKIVY 422


>gi|323464706|gb|ADX76859.1| dihydroorotase [Staphylococcus pseudintermedius ED99]
          Length = 424

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/378 (33%), Positives = 193/378 (51%), Gaps = 2/378 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  G    PG ID  V L     EY + I T +K A  GG T++  MP       D    
Sbjct: 44  DAKGHFLAPGFIDVHVHLREPGGEYKETIETGTKAAARGGFTTVCPMP-NTKPVPDSLEH 102

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +    E I   + + V P A +T    GKE  + + L E G  +F    + + +  ++  
Sbjct: 103 LTQLNELIDKNAQVRVLPYASITVRQAGKEHVDFKALAENGAFAFTDDGVGVQEAAMMYE 162

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +M+ A   N  V     D+ L   G ++EG  +  LG+ GIP+I E+V +ARD+L+++ T
Sbjct: 163 AMQQAKAQNKAVVAHCEDNSLIYGGAMHEGRRSQELGIPGIPNICESVQIARDVLLSEAT 222

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G HYH   +S  +S+ +I+ AK      T  ++ ++L+L E+DV   +++ K+ PPLRS+
Sbjct: 223 GCHYHVCHVSTKESVRVIRDAKKAGIPVTAEVTPHHLLLTEDDVPGDHAIYKMNPPLRSQ 282

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQ 349
            +R +++E L  G ID I +DH P   D K  P   A FG +G ET        F     
Sbjct: 283 EDRAALLEGLLDGTIDCIATDHAPHAADEKAQPMTRAPFGIVGSETAFPLLYTHFVKNGD 342

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            SL++L+  L+T+PA++F LP G L  G  AD+ LI+L+  + +KA+D  S   NT F  
Sbjct: 343 WSLQQLVDYLTTKPAEVFGLPYGKLAEGALADLTLINLDDAYEIKAEDFLSKASNTPFLG 402

Query: 410 EFFTGKVVRTYISGKQVY 427
           E   G  + T + G   Y
Sbjct: 403 ETVYGNPILTMVEGNIRY 420


>gi|196230582|ref|ZP_03129444.1| dihydroorotase, multifunctional complex type [Chthoniobacter flavus
           Ellin428]
 gi|196225512|gb|EDY20020.1| dihydroorotase, multifunctional complex type [Chthoniobacter flavus
           Ellin428]
          Length = 429

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 130/430 (30%), Positives = 227/430 (52%), Gaps = 4/430 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT+ + N   IIDP+  ID VG + + +G I     +           I D TGLV  PG
Sbjct: 1   MTTLITNG-HIIDPANGIDRVGDVYITDGKIAKIDLEGSARHVEKDETIIDATGLVVTPG 59

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +ID  V          + I T +K A AGG TS++ MP    S +D  + + + LE+ + 
Sbjct: 60  LIDLHVHFREPGQSAKETIATGAKAAAAGGFTSVVCMPNTAPS-VDSPSVVTWILEKAKA 118

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           ++ +NV+PT  +T  + G+E++ +  +++ GIV+       I + +++  +++YA M N 
Sbjct: 119 EACVNVFPTGAITKGIAGEELAPIGSMRKAGIVALTDDGHCIQNPEIMRRALEYARMFNL 178

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V     D+ L  +GV++EG  +  LGL G P++ E + ++R+  +A+ TG   H   +S
Sbjct: 179 TVMDHCQDYALVGKGVMHEGYWSTVLGLPGWPALGEEIIVSRNAQLAELTGTAIHCQHLS 238

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S+ +++ A++     +  I  +++ L +  +  Y++  K+ PPLR++ +   ++E +
Sbjct: 239 SGGSVRILREARSRGVPISGEICPHHIALTDESIRTYDTNFKMNPPLRTQRDIDLLIEGV 298

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQ-ISLKKLIRA 358
             G I ++ SDH P     K + F +A FG +GLET +   L  L H ++ ISL + +  
Sbjct: 299 ADGTITVLASDHAPHCSYEKEVEFDQAPFGILGLETEVGLFLDILMHKKKAISLARFVAM 358

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
            +  PA++  L  GTL  G  ADI L+D + +WTV  +   S  +NT F      G+ VR
Sbjct: 359 FTIEPARLLGLDRGTLSVGAPADITLLDPDREWTVDKEQSFSRSRNTPFQGWQLKGRAVR 418

Query: 419 TYISGKQVYT 428
           T + G+ V++
Sbjct: 419 TIVGGETVWS 428


>gi|114566809|ref|YP_753963.1| dihydroorotase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114337744|gb|ABI68592.1| dihydroorotase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 431

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 127/421 (30%), Positives = 215/421 (51%), Gaps = 6/421 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++   R+IDP   ID +  ++VE+G I + G    NA   +   I D +G +  PG ID
Sbjct: 3   LLIKGGRLIDPFNHIDAIQDLLVEDGKIRSRG----NALDDSGCEIIDASGKIVCPGFID 58

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     EY ++I + ++ A  GG T++  MP      +D    + +  E+ R   +
Sbjct: 59  IHVHLREPGFEYKEDIASGTRAAACGGFTTVCCMP-NTEPVIDNEAVVGFVREKARKVGI 117

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NV P   ++    G E+SE+  L   G V+       +    ++ N++ YA M    V 
Sbjct: 118 VNVLPVGSISKKQAGLELSEIAELVTAGCVAISDDGKPVMKANIMRNALDYAKMFGLPVL 177

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  L + G+++EG  +   GL GIP+ +E V +ARD+++A+ TGGH H    S   
Sbjct: 178 SHCEDLNLVNGGLMHEGYYSTIYGLRGIPAAAEEVMVARDIILARLTGGHLHICHASTAG 237

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+AL++ AKA     TC ++ ++L L++  ++ Y++  KV PPLRSE   +++ EAL  G
Sbjct: 238 SMALVRQAKAEGLNVTCEVTPHHLTLSDEIIDGYDADTKVNPPLRSEEHLLALREALLDG 297

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTR 362
            +D I +DH P H + K   +  A+ G  GLET ++  + +L     + +K +++  ++ 
Sbjct: 298 TVDCIATDHAPHHFEAKDCEYELAACGISGLETAIAVIMDKLVRPGLLDIKDMVKLFTSG 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA +  +  G+L+ G +ADI +ID     TV      S  +NT +      G    T ++
Sbjct: 358 PAGVMGIDKGSLEEGKSADITIIDSEIVKTVDPRTFKSKGRNTPYKGMELQGWPCMTLVN 417

Query: 423 G 423
           G
Sbjct: 418 G 418


>gi|323525010|ref|YP_004227163.1| dihydroorotase, multifunctional complex type [Burkholderia sp.
           CCGE1001]
 gi|323382012|gb|ADX54103.1| dihydroorotase, multifunctional complex type [Burkholderia sp.
           CCGE1001]
          Length = 426

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 134/418 (32%), Positives = 214/418 (51%), Gaps = 5/418 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+   ++   I ++ G I+A G     A F  +  + D  GL   PG++D    L  
Sbjct: 10  LIDPAAGPEQQQDIFIDAGKIVALGN--APAGFEATQTL-DARGLHIAPGLVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    A+AGG+TS++  P      LDE   ++      R     +VYP  
Sbjct: 67  PGYEHKATLESEMAAALAGGVTSLVCPP-DTDPTLDEPGLVEMLKFRARNLDQAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+   + DTQVL+ +++YA      V L   D +
Sbjct: 126 ALTVGLKGQVITEMVELTEAGCIGFSQADAPVVDTQVLMRALQYAKTYGFTVWLRPVDAY 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           LG  GV   G +A+ LGL G+P  +ET+ L     + + TG   H S +S    IAL++ 
Sbjct: 186 LGKGGVAASGALASRLGLSGVPVAAETIALHTIFELVRVTGARVHLSHVSSAAGIALVRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     +C +++N++ L + D+  +++  ++ PPLR + +R ++   L  G ID I S
Sbjct: 246 AKAEGLPVSCDVTVNHVHLIDLDIGYFDAQFRLDPPLRQQRDREAIRAGLVDGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNL- 369
           DHTP   D KLLPFAEA+ G+ GLE  LS  ++      + L K +  ++  PAQ+ NL 
Sbjct: 306 DHTPVDDDEKLLPFAEATPGATGLELFLSLTVKWADEAGLPLAKALNRITAAPAQVLNLD 365

Query: 370 PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
             G +  G+ AD+ + D +  W V+   + S   NT F       +V  T +SG+  +
Sbjct: 366 AAGRVAVGSVADLCVFDRHAHWRVEPRALKSQGHNTPFLGYELPARVRATIVSGRVAF 423


>gi|304316992|ref|YP_003852137.1| dihydroorotase [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
 gi|302778494|gb|ADL69053.1| dihydroorotase, multifunctional complex type [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 431

 Score =  210 bits (535), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 133/411 (32%), Positives = 213/411 (51%), Gaps = 9/411 (2%)

Query: 19  DEVGAIIVENGIILAAGAD-ALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSK 77
           +E   I+V+NG I A      LN      ALI D  G   +PG +D    L     E  +
Sbjct: 17  NEKADILVDNGKIKAIEKTIELN-----DALIIDANGKYVLPGFVDMHTHLRQPGFEEKE 71

Query: 78  NITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNME 137
            I T +  AVAGG T++  MP   +  +D    ++Y     +      V P   +T  M 
Sbjct: 72  TIKTGTHAAVAGGFTTVACMP-NTNPVIDNEVVVEYIKSIAKRDGYSKVIPIGSMTKGMM 130

Query: 138 GKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVI 197
           G+EISEM  L++ GIV+       I +  ++   M Y  M + ++     D  L   GV+
Sbjct: 131 GEEISEMAKLKDAGIVALSDDGHPIMNAGLMKRIMTYGSMYDLLMITHCEDKMLSGEGVM 190

Query: 198 NEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTK 257
           N G+I+  +GL GIP  +E V +AR++++A+ TG   H + +S   S+ LI+ AKA    
Sbjct: 191 NNGLISTMIGLRGIPHEAEEVMVARNIILAKSTGARLHIAHVSTKDSVELIRRAKADGVN 250

Query: 258 ATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHM 317
            T  ++ +NL L E+ V+ +++  K  PPLR++ +  ++++ L+ G ID+I +DH P   
Sbjct: 251 VTAEVTPHNLCLTEDIVDGFDTNTKAYPPLRTKEDVDALIDGLKDGTIDVIATDHAPHTK 310

Query: 318 DTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALSTRPAQIFNLPGGTLQT 376
           D K +P+  A+FG  G+E   S     L     I+L+ L+  +S  PA++     G ++ 
Sbjct: 311 DDKKVPYEIAAFGISGIEIAFSVIYTYLVKNGLITLEDLVSFMSINPAKLLKTSYG-IKV 369

Query: 377 GTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           G AADI ++D N ++TV  D+  S  KN+ F+ +  TG V  T + GK +Y
Sbjct: 370 GNAADITVVDTNKEYTVNVDNFKSKGKNSPFNGKRLTGVVEYTLVDGKIIY 420


>gi|308173512|ref|YP_003920217.1| dihydroorotase [Bacillus amyloliquefaciens DSM 7]
 gi|307606376|emb|CBI42747.1| dihydroorotase [Bacillus amyloliquefaciens DSM 7]
 gi|328911652|gb|AEB63248.1| dihydroorotase [Bacillus amyloliquefaciens LL3]
          Length = 428

 Score =  210 bits (535), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 134/431 (31%), Positives = 212/431 (49%), Gaps = 17/431 (3%)

Query: 3   SFVLNNTRIIDP-----SRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVA 57
           S+++ N  +++      ++DI   G II E GI+ A   +           + D +GL  
Sbjct: 2   SYLIKNGWMLNEQGEKVAQDIRVTGEIIAETGILTAKDGET----------VIDASGLFV 51

Query: 58  VPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEE 117
            PG++D  V       E  + I T SK A  GG T++  MP       D    +++    
Sbjct: 52  SPGLVDLHVHFREPGGEKKETIETGSKAAARGGFTTVAAMP-NTRPVPDTKEQMEWLQNR 110

Query: 118 IRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHM 177
           I+  S + V P A +T    G+++++  +L E G  +F    + +    ++  +MK A  
Sbjct: 111 IKETSSVRVLPYASITIRQTGEQMTDFEVLHEAGAFAFTDDGVGVQTAGMMYEAMKRAAS 170

Query: 178 LNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS 237
           +N  +     D+ L   G ++EG  +   GL GIPSI E V +ARD+L+A+  G HYH  
Sbjct: 171 MNKAIVAHCEDNSLIYGGSVHEGAFSKANGLNGIPSICEAVHIARDVLLAEAAGCHYHVC 230

Query: 238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMV 297
            IS  +S+  ++ AK    + T  +S ++L+L + D+   ++  K+ PPLRS+ +R +++
Sbjct: 231 HISTKESVRAVRDAKKAGIRVTAEVSPHHLLLCDEDIPGLDTNFKMNPPLRSKEDRAALI 290

Query: 298 EALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLI 356
           E L +G ID I +DH P   + K      A FG +GLET        F      +LK+L+
Sbjct: 291 EGLLEGTIDFIATDHAPHTEEEKNTDMKLAPFGIVGLETAFPLLYTHFVKSGSWTLKQLV 350

Query: 357 RALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
             ++ +P + F LP GTL  G  ADI LIDL  +  +  D   S  KNT F+K    G  
Sbjct: 351 DFMTKKPCEAFGLPYGTLAPGAPADITLIDLEKEAAIDKDTFLSKGKNTPFNKMKCFGWP 410

Query: 417 VRTYISGKQVY 427
           V T   GK  Y
Sbjct: 411 VATMAGGKLAY 421


>gi|260892278|ref|YP_003238375.1| dihydroorotase, multifunctional complex type [Ammonifex degensii
           KC4]
 gi|260864419|gb|ACX51525.1| dihydroorotase, multifunctional complex type [Ammonifex degensii
           KC4]
          Length = 436

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 133/429 (31%), Positives = 208/429 (48%), Gaps = 9/429 (2%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILA--AGADALNAKFPTSALIHDCTGLVAV 58
           M   +  +  ++DP         ++VE G I A  +G  A     P    + +  G +  
Sbjct: 1   MKRILFKSGTLVDPGSGRVWQADLLVEEGRIKAIDSGMAA-----PRGTEVVNADGCLIF 55

Query: 59  PGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           PG +D  V L     EY + I T  + AV GG  ++  MP       D    + Y     
Sbjct: 56  PGCVDVHVHLREPGFEYKETIATGVRAAVRGGFVAVAAMP-NTRPVADSAAVVGYVRARG 114

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
             + L  V+P   L+   EGKE++ +  +++ G V+F      + D Q++   M+YA ML
Sbjct: 115 EEEGLARVFPVGALSRGSEGKEMAPLGEMRQAGAVAFSDDGRWLADAQLMRRVMEYARML 174

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
            A V     +  L   GV+NEGI A  LGL G+P+ +E + +ARD+++A+ TG H H + 
Sbjct: 175 KAPVISHCEEPTLTKGGVMNEGITATVLGLRGMPAAAEEIAVARDIILAEFTGCHLHVAH 234

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           IS   ++ L++ AK+   K T  ++ ++  L E  V+ Y +  KV PPLR+  +  ++ E
Sbjct: 235 ISTAGAVRLVREAKSRGLKVTAEVTPHHFTLTEEAVQGYATCAKVNPPLRTRADVEALRE 294

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIR 357
           AL  G IDII +DH P   + K + F +A FG  GLET ++     L H   ++L +   
Sbjct: 295 ALADGTIDIIATDHAPHAREEKEVEFDQAPFGISGLETAIALVFTELVHKGILNLPQAAA 354

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            LS  P ++  LPGG L  G  A++ LID   +  V     +S  +NT F      G  V
Sbjct: 355 KLSLNPRRLLGLPGGVLAEGEPAELTLIDPEREEEVDPAAFASKGRNTPFAGWRLKGWPV 414

Query: 418 RTYISGKQV 426
              + GK +
Sbjct: 415 GVVVRGKWI 423


>gi|255658271|ref|ZP_05403680.1| dihydroorotase [Mitsuokella multacida DSM 20544]
 gi|260849584|gb|EEX69591.1| dihydroorotase [Mitsuokella multacida DSM 20544]
          Length = 428

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 127/424 (29%), Positives = 218/424 (51%), Gaps = 6/424 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L   R+I+P+   DEV  +++E+G I A G D L+A+    A ++D  G +  PG+ID
Sbjct: 3   LILKGGRVINPAEHFDEVADVLIEDGKIAAVGKD-LSAE---GAEVYDAAGKIVTPGLID 58

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
                     E  ++  + SK A AGG T++  MP      +D    ++   +     + 
Sbjct: 59  MHTHFREPGQEAKEDFESGSKAAAAGGYTTVATMP-NTKPVVDTAALVRSLEKRAEDVAK 117

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +++     +T   +G+E++E+  +   G V+F          +VLLN+  Y H  + ++ 
Sbjct: 118 VHIRIIGAVTKGQKGQELAELGDMVAAGAVAFSDDGHFDPTAKVLLNAYDYLHTFDKVII 177

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               +  L   GV+NEG  +  LG+ G P+++E + +ARD+L+A++ G   H + IS  +
Sbjct: 178 NHEEEPSLVEDGVMNEGHCSAMLGMKGRPTVAEDIAVARDILLAEYAGARVHVAHISSGR 237

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ L++ AK H  + T  ++ ++L + +  V +Y+S  K  PPLRS+++  +MVE L+ G
Sbjct: 238 SVELVREAKKHGIRVTTEVTPHHLTMTDECVNLYDSSTKTNPPLRSQSDVDAMVEGLKDG 297

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTR 362
            ID IV+DH+P   + K   +  A  G  GLET +      L    ++ +  +I  ++  
Sbjct: 298 TIDAIVTDHSPHAQEEKDREYIYAPSGFPGLETAIGVLFTDLCKTGKVDIPTIIEKMTWG 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+ F L  GTL  G  AD+ +ID +  WTV      +   ++ F     TGK V T + 
Sbjct: 358 PAKAFKLDAGTLSVGANADVTVIDPDLVWTVDPKKFYTRGSHSPFVGRELTGKPVLTIVD 417

Query: 423 GKQV 426
           GK V
Sbjct: 418 GKVV 421


>gi|296160321|ref|ZP_06843139.1| dihydroorotase, multifunctional complex type [Burkholderia sp.
           Ch1-1]
 gi|295889532|gb|EFG69332.1| dihydroorotase, multifunctional complex type [Burkholderia sp.
           Ch1-1]
          Length = 426

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 136/418 (32%), Positives = 213/418 (50%), Gaps = 5/418 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+   ++   I +  G I A G     A F     I D  GL  +PG++D    L  
Sbjct: 10  LIDPAAGTEQQQDIYIAAGKIAAIGN--APADFNADKTI-DAQGLHVMPGLVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    A+AGG+TS++  P      LDE   ++      R  +  +VYP  
Sbjct: 67  PGYEHKATLESEMAAALAGGVTSLVCPP-DTDPTLDEPGLVEMLKFRARNLNQAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+ + + DTQVLL +++YA     IV L   D +
Sbjct: 126 ALTVGLKGQVITEMVELTEAGCIGFSQADVPVVDTQVLLRALQYAKTYGYIVWLRPVDAY 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           LG  GV   G +A+ LGL G+P  +ET+ L     + + TG   H S +S    IAL++ 
Sbjct: 186 LGKGGVAASGALASRLGLSGVPVSAETIALHTIFELVRVTGARVHLSHVSSAAGIALMRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     +C +++N++ L + D+  +++  ++ PPLR + +R ++   L  G ID I S
Sbjct: 246 AKAEGLPVSCDVTVNHVHLIDLDIGYFDAQFRLDPPLRQQRDREAIRAGLVDGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNL- 369
           DHTP   D KLLPFAEA+ G+ GLE  LS  ++     ++ L K +  ++  PA++  L 
Sbjct: 306 DHTPVDDDEKLLPFAEATPGATGLELFLSLTVKWADEARVPLAKALNRITAAPAKVLELD 365

Query: 370 PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
             G +  G  AD+ + D N  W V+   + S   NT F       +V  T +SG   +
Sbjct: 366 AAGRIAVGGVADLCVFDRNAHWRVEPRALKSQGHNTPFLGYELPARVRATIVSGHVAF 423


>gi|71909500|ref|YP_287087.1| dihydroorotase [Dechloromonas aromatica RCB]
 gi|71849121|gb|AAZ48617.1| dihydroorotase [Dechloromonas aromatica RCB]
          Length = 415

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 129/425 (30%), Positives = 208/425 (48%), Gaps = 13/425 (3%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + V+ N R+IDP   +D   ++ V +G +  AG   + A F     I D  G V  PG I
Sbjct: 2   NIVIENGRVIDPKNGVDRRASLYVADGKV--AGIGQVPAGFVADRSI-DAAGCVVCPGFI 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E +  +       V         +P      LDE       +       
Sbjct: 59  DLGARLNSIEAELAAAVAGGVTTVV---------VPPDADPPLDEPELADRLVHRGEEIG 109

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              V P   LT  ++G+ ++E+  L++ G V+F Q+  ++ DT+ LL +++YA   +  V
Sbjct: 110 KARVLPLGALTLGLKGERLAELAGLKKAGCVAFSQANKTVVDTEALLRALEYAATFDFAV 169

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
            L   D++L   G+ +EG +A+ LGL GIP  +ET+ +   + + + TG   H + IS  
Sbjct: 170 WLQPQDYWLSRNGIAHEGEVASRLGLAGIPVAAETIAIGTIIQLVRDTGCRIHLTRISSA 229

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
             +AL+  A+      +C + +++L+L END+  +N   +  PPLR++T+R ++ +A+  
Sbjct: 230 AGMALVHRAQHDGLPISCDVGVHHLLLTENDIGFFNPHARFCPPLRAQTDRQALSDAVVA 289

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G    I SDHTP   D KLLPF EA  G+ GLE +L   L+     ++ L   +  +++ 
Sbjct: 290 G-WAAICSDHTPVGADDKLLPFGEAKPGATGLEVLLPLTLKWADAAKVDLPTALARITSA 348

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA +  L  G L  GT ADI + D    W +  D + S  KN+ +     TGKV  T + 
Sbjct: 349 PAAVLGLASGQLAIGTTADICIFDPEANWQLTPDALKSRGKNSPWLGYVMTGKVKATLVG 408

Query: 423 GKQVY 427
           G+ VY
Sbjct: 409 GRPVY 413


>gi|307728799|ref|YP_003906023.1| dihydroorotase, multifunctional complex type [Burkholderia sp.
           CCGE1003]
 gi|307583334|gb|ADN56732.1| dihydroorotase, multifunctional complex type [Burkholderia sp.
           CCGE1003]
          Length = 426

 Score =  209 bits (533), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 134/418 (32%), Positives = 213/418 (50%), Gaps = 5/418 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+   ++   I +  G I+A G     A F  +  I D  GL   PG++D    L  
Sbjct: 10  LIDPAAGTEKQQDIFIAAGKIVALGN--APADFEATQTI-DARGLHIAPGLVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    A+AGG+TS++  P      LDE   ++      R     +VYP  
Sbjct: 67  PGYEHKATLESEMAAALAGGVTSLVCPP-DTDPTLDEPGLVEMLKFRARNLDQAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+   + DTQVL+ +++YA      V L   D +
Sbjct: 126 ALTVGLKGQVITEMVELTEAGCIGFSQADAPVVDTQVLMRALQYAKTYGFTVWLRPVDAY 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           LG  GV   G +A+ LGL G+P  +ET+ L     + + TG   H S +S    IAL++ 
Sbjct: 186 LGKGGVAASGALASRLGLSGVPVAAETIALHTIFELVRVTGARVHLSHVSSAAGIALVRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     +C +++N++ L + D+  +++  ++ PPLR + +R ++   L  G ID I S
Sbjct: 246 AKAEGLPVSCDVTVNHVHLIDLDIGYFDAQFRLDPPLRQQRDREAIRAGLVDGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNL- 369
           DHTP   D KLLPFAEA+ G+ GLE  LS  ++      + L K +  ++  PAQ+ +L 
Sbjct: 306 DHTPVDDDEKLLPFAEATPGATGLELFLSLTVKWADEAGLPLAKALNRITASPAQVLDLE 365

Query: 370 PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
             G +  G+ AD+ + D +  W V+   + S   NT F       +V  T +SG+  +
Sbjct: 366 AAGRVAVGSVADLCVFDRHAHWRVEPRALKSQGHNTPFLGYELPARVRATLVSGRVAF 423


>gi|253576159|ref|ZP_04853491.1| dihydroorotase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251844502|gb|EES72518.1| dihydroorotase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 435

 Score =  209 bits (533), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 134/430 (31%), Positives = 212/430 (49%), Gaps = 5/430 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGII--LAAGADALNAKFPTSALIHDCTGLVAVPGI 61
            V+ N +I++   +  E   I++ENG+I  +                + D  G +  PG 
Sbjct: 3   LVVINAKILNEQGE-QEFAQIVIENGVISNIEKTGPIEQPVAEEGTQVIDAGGRLVTPGF 61

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           ID  V L     E+ + I T S+ A  GG T+I  MP       D    ++Y  ++    
Sbjct: 62  IDMHVHLREPGYEHKETIETGSRSAAKGGFTTIACMP-NTRPVTDNPDTVRYVKQKAEEA 120

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
            L+NV P A +T +  G+E+++   L+E G + F    + +   Q++ ++M+ A  L   
Sbjct: 121 GLVNVLPYAAITKSELGRELTDFAALKEAGAIGFTDDGVGVQSAQMMKDAMRQAAALGMP 180

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V     D+ L     + EG  A   GL GIP+ SE + + RD+L+A+ TG HYH   +S 
Sbjct: 181 VIAHCEDNSLVEGAPVAEGEFARKHGLKGIPNESEAIHVGRDILLAEATGVHYHVCHVST 240

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
            QSI LI+ AK      T  +  ++L+L+E D+   ++  K+ PPLRS  +  + + ALE
Sbjct: 241 EQSIRLIRQAKQLGINVTAEVCPHHLVLSEEDIPGLDANWKMNPPLRSRRDVEACIAALE 300

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQ-QISLKKLIRALS 360
            G IDIIV+DH P   + K      A FG +G ET        F    + SL+ L++ ++
Sbjct: 301 DGTIDIIVTDHAPHSEEEKAKGMQLAPFGIVGFETAFPLLYTKFVATGRWSLEMLVQRMT 360

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA++F L  G L  G  AD+ ++DL  + TV  +D +S  +NT F      G  V T 
Sbjct: 361 ADPARVFGLEAGRLVPGAPADLTIVDLEAERTVDPEDFASKGRNTPFAGWKLKGWPVATI 420

Query: 421 ISGKQVYTLE 430
           + G+ V+  E
Sbjct: 421 VRGRLVWNDE 430


>gi|120609605|ref|YP_969283.1| dihydroorotase [Acidovorax citrulli AAC00-1]
 gi|120588069|gb|ABM31509.1| dihydroorotase [Acidovorax citrulli AAC00-1]
          Length = 431

 Score =  209 bits (533), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 132/428 (30%), Positives = 216/428 (50%), Gaps = 16/428 (3%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           ++ N R+IDP+   D+   + +  G ++A G  A     P   +  D T  + +PG++D 
Sbjct: 4   LIQNGRVIDPASGFDKTVDVAIAAGRVIAVG-RAPQDFHPARTI--DATDCIVLPGLVDL 60

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL- 123
              L     E+   + +    AVAGG+TS++  P      LDE   ++  + + R + L 
Sbjct: 61  AARLREPGHEHEGMLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVE--MLKFRAEKLH 117

Query: 124 -INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              ++P   LT  + G+ ++EM  L E G V F Q+ +++  TQVL  +++YA      V
Sbjct: 118 RARLFPLGALTRGLAGEVLTEMAELTESGCVGFGQADVALASTQVLQRALQYAATYGYTV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
            L   +  LG +GV   G +A  LGL GIP  +ET+ L     + +  G   H   +S  
Sbjct: 178 WLRPQELHLG-KGVAASGPLATRLGLSGIPVAAETIALHTIFELLKPIGARVHLCRLSSA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
             + L++ AKA   + TC +SIN+L+L + D+  ++S  ++ PPLR + +R +++ AL  
Sbjct: 237 AGVQLVRQAKAEGLQVTCDVSINSLLLTDTDIGYFDSRARLSPPLRQQRDRDALLAALAD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID +VSDHTP   D K LPFAE+  G+ GLE + S AL+      + L +    +++ 
Sbjct: 297 GTIDALVSDHTPVDEDAKTLPFAESEPGATGLELLASIALKWSRDHGVPLDRAFATVTSA 356

Query: 363 PAQI-------FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK 415
           PA++       F    G L  G  AD+ + D    WTV+   + S  ++T F      G+
Sbjct: 357 PARVLGSALGTFAASAGRLVEGGVADLCVFDPQAAWTVEPGALRSQGRHTPFSGYELPGR 416

Query: 416 VVRTYISG 423
           V  T + G
Sbjct: 417 VRWTLVGG 424


>gi|258645187|ref|ZP_05732656.1| dihydroorotase [Dialister invisus DSM 15470]
 gi|260402536|gb|EEW96083.1| dihydroorotase [Dialister invisus DSM 15470]
          Length = 429

 Score =  209 bits (533), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 119/424 (28%), Positives = 225/424 (53%), Gaps = 6/424 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N  II+P     E G +++E+G I++ G  A      + A ++D  G    PG+ID
Sbjct: 3   LIIKNGTIINPVHHQHEKGDVVIEDGKIVSLGGIA----DVSGAEVYDAEGFFVTPGLID 58

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E  ++I T ++ A AGGIT ++ M       +D    ++   + +    +
Sbjct: 59  MHVHLREPGQEAKEDIHTGTQAAAAGGITHVVTMA-NTKPVIDNMAVLRAVQKRVEEDGV 117

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           + V     ++  ++G+++SEM  L   G V+F      + +   +  +M+YA  L  ++ 
Sbjct: 118 VKVSIIGSVSKRLKGEQLSEMGDLSAAGAVAFSDDGHYVENANFMRRAMEYAGQLGKMII 177

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  +   G +NEGII+  +G+ G P++ E + ++RDLL++Q TG H H + +S  +
Sbjct: 178 DHAEDMTMCGDGFMNEGIISYQMGVAGRPAVGEDIAVSRDLLLSQLTGCHIHIAHVSSAK 237

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           ++ LI+ AK      +  ++  +L   ++ ++ Y S  K+ PP+R+E +R +++  L  G
Sbjct: 238 AVELIRDAKKKGIDCSTEVTAQHLYFTDDYLKNYESAFKMAPPIRTEKDRQALINGLLDG 297

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALSTR 362
            ID I++DH P   + K +PF  A  G  GLET L++ L  L+H  ++S+ +++  ++  
Sbjct: 298 TIDAIMTDHAPHADEEKDVPFNCAPNGIAGLETSLASTLTVLYHTGKMSIDRIVELMAVN 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA++ ++ GG L+    ADI +ID + +W V+ +++ +    T ++     GK V T + 
Sbjct: 358 PAKLLHISGGVLEEEGTADITVIDPDKEWVVRGNELYTKSLFTPYEGISLKGKAVLTIVD 417

Query: 423 GKQV 426
           G+ V
Sbjct: 418 GEIV 421


>gi|170692126|ref|ZP_02883290.1| dihydroorotase, multifunctional complex type [Burkholderia graminis
           C4D1M]
 gi|170143410|gb|EDT11574.1| dihydroorotase, multifunctional complex type [Burkholderia graminis
           C4D1M]
          Length = 426

 Score =  209 bits (532), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 132/418 (31%), Positives = 213/418 (50%), Gaps = 5/418 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+   ++   + + +G I+A G     A F  +  I D  GL   PG++D    L  
Sbjct: 10  LIDPAAGTEQQQDVFIADGKIVALGN--APADFEATQTI-DARGLHIAPGLVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    A+AGG+TS++  P      LDE   ++      R     +VYP  
Sbjct: 67  PGFEHKATLESEMAAALAGGVTSLVCPP-DTDPTLDEPGLVEMLKFRARNLDQAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+   + DTQVL+ +++YA      V L   D +
Sbjct: 126 ALTVGLKGQVITEMVELTEAGCIGFSQADAPVVDTQVLMRALQYAKTYGFTVWLRPVDAY 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           LG  GV   G +A+ LGL G+P  +ET+ L     + + TG   H S +S    IAL++ 
Sbjct: 186 LGKGGVAASGALASRLGLSGVPVAAETIALHTIFELVRVTGARVHLSHVSSAAGIALMRE 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     +C +++N++ L + D+  +++  ++ PPLR + +R ++   L  G ID I S
Sbjct: 246 AKAEGLPVSCDVTVNHVHLIDLDIGYFDAQFRLDPPLRQQRDREAIRAGLVDGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNL- 369
           DHTP   D KLLPF EA+ G+ GLE  LS  ++      + L K +  ++  PAQ+ +L 
Sbjct: 306 DHTPVDDDEKLLPFGEATPGATGLELFLSLTVKWADEAGVPLAKALNRITAAPAQVLDLD 365

Query: 370 PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
             G +  G+ AD+ + D +  W V+   + S   NT F       +V  T +SG+  +
Sbjct: 366 AAGRVAVGSVADLCVFDRHAHWRVEPRALKSQGHNTPFLGYELPARVRATIVSGRVAF 423


>gi|157692230|ref|YP_001486692.1| dihydroorotase [Bacillus pumilus SAFR-032]
 gi|167011959|sp|A8FD15|PYRC_BACP2 RecName: Full=Dihydroorotase; Short=DHOase
 gi|157680988|gb|ABV62132.1| dihydroorotase [Bacillus pumilus SAFR-032]
          Length = 428

 Score =  209 bits (532), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 128/378 (33%), Positives = 196/378 (51%), Gaps = 2/378 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  GL   PG+ID  V L     E  + I T SK A  GG T+I  MP       D    
Sbjct: 45  DAKGLFVSPGLIDLHVHLREPGGEKKETIETGSKAAARGGYTTIAAMP-NTRPVPDTKEQ 103

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +++ +  I   S + V P A +T+   G+E+++   L+E G  +F    + I    ++  
Sbjct: 104 MEWLMNRIEETSSVRVLPYASITTRQIGEEMTDFAALKEAGAFAFTDDGVGIQTAGMMYE 163

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +MK A  L+  +     D+ L   G ++EG  +   GL GIPSI E+V +ARD+L+A+  
Sbjct: 164 AMKKAASLDQAIVAHCEDNSLIYGGCVHEGEFSKANGLNGIPSICESVHIARDVLLAEAA 223

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
             HYH   IS  +S+ +++ AK    + T  +S ++L+L + D+   ++  K+ PPLR +
Sbjct: 224 NCHYHVCHISTKESVRVVRDAKKAGIRVTAEVSPHHLLLCDADIPGLDTNYKMNPPLRGK 283

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQ 349
            +R +++E L  G ID I +DH P   + K      A FG +GLET       R     +
Sbjct: 284 EDREALIEGLLDGTIDFIATDHAPHTEEEKNETMQRAPFGIVGLETAFPLLYTRFVKTGE 343

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            +LK+L+  ++ +PA+ F+LP G L+ G  ADI LIDLN +  +      S  +NT FDK
Sbjct: 344 WTLKELVDYMTIKPAEAFSLPYGKLEKGQIADITLIDLNKEMAIDKKSFLSKGQNTPFDK 403

Query: 410 EFFTGKVVRTYISGKQVY 427
              +G  V T  SGK VY
Sbjct: 404 LTVSGWPVMTLASGKVVY 421


>gi|169831465|ref|YP_001717447.1| dihydroorotase, multifunctional complex type [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169638309|gb|ACA59815.1| dihydroorotase, multifunctional complex type [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 429

 Score =  209 bits (531), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 132/423 (31%), Positives = 210/423 (49%), Gaps = 9/423 (2%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPT-SALIHDCTGLVAVPGII 62
            ++    ++DP+        I+V++G + A     L  K     A + D  G + VPG+I
Sbjct: 3   LLIRGGTVVDPAAGRTFQSDILVKDGRVAA-----LEKKITARGARVLDAAGKLVVPGLI 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     E+ + + + +  AV GG T++  MP       D    I+Y LE+ R   
Sbjct: 58  DMHVHLREPGQEHKETVASGTLAAVHGGFTAVAAMP-NTDPVADTPGVIRYVLEKAREAG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              VYP   LT    G+E++EM  L+  G V+F      + D  V+  +++YA ML   V
Sbjct: 117 RARVYPVGALTVGSRGRELTEMGALRAAGAVAFSDDGRPVADAHVMRRALEYARMLGVPV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                +  L + GV++EG+++  LGL G P+ +E V +ARDL++A+ TG H H + ++  
Sbjct: 177 ISHCEEPAL-AVGVMHEGLVSTRLGLKGTPAAAEDVAVARDLILAEMTGCHLHVAHVTTA 235

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++ LI+ AKA   + T   + ++  L +  V  +N+  KV PPLR++ +  ++ E L  
Sbjct: 236 GAVRLIREAKARGVRVTAETTPHHFTLTDRAVVGFNTNAKVNPPLRTDADVAAVREGLAD 295

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALST 361
           G ID+I +DH P     K + F  A FG +GLET +      L  G  + L   +  LST
Sbjct: 296 GTIDVIATDHAPHAAHEKEVEFDLAPFGLVGLETAVGLVFTELVAGGVLDLVAAVAKLST 355

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA++  L  G ++ G  AD+ +ID    WTV   ++    KNT F      G    T I
Sbjct: 356 NPARVLGLSAGVIEPGAVADLTVIDPAAAWTVDRGELVGKSKNTPFHGYRLKGLPHATII 415

Query: 422 SGK 424
            G+
Sbjct: 416 GGE 418


>gi|323702043|ref|ZP_08113711.1| dihydroorotase, multifunctional complex type [Desulfotomaculum
           nigrificans DSM 574]
 gi|323532925|gb|EGB22796.1| dihydroorotase, multifunctional complex type [Desulfotomaculum
           nigrificans DSM 574]
          Length = 437

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 134/423 (31%), Positives = 212/423 (50%), Gaps = 7/423 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
            +++    ++DP     +   ++V+ G+++A G D +  +    A++ D       PG  
Sbjct: 2   QYLIKGGIVVDPVAATMQQLDLLVDQGLVVALGTDLVAPE----AVVIDAVDRYVCPGFF 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     EY ++I + ++ A  GG T++  MP   +   D    I Y LE+ R ++
Sbjct: 58  DLHVHLREPGYEYKEDIASGTRAAAMGGFTAVACMP-NTNPVADNAAVISYILEKAR-QA 115

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              VYP   +T   +G+E++EM  L+  G V+       + D  ++   M+YA ML   V
Sbjct: 116 ATRVYPIGAMTKGSQGQELTEMADLKAAGAVALSDDGKPVMDAGLMRRIMQYAGMLGLPV 175

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L + G ++EG +A  LGL GIP+ +E V +ARD+L+A+HTG   H + IS  
Sbjct: 176 ISHCEDINLAAGGQMHEGAVATMLGLKGIPAAAEEVMVARDILLAEHTGCRLHLAHISTA 235

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S+ L++ AK    K T   + ++  L E+ V+ +N+  KV PPLR + +  ++ E L  
Sbjct: 236 GSVRLVRQAKERGVKVTAEATPHHFTLTEDAVQGFNTNAKVNPPLRRKIDVEAIKEGLAD 295

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALST 361
           G ID+I +DH P     K + F  A  G IGLET +      L     +++ + +  LS 
Sbjct: 296 GTIDVIATDHAPHAYHEKDVEFQYAPTGLIGLETAVGLVFTELVQTGILTVPQAVAKLSY 355

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            P ++  L GG L+ G  ADI +ID N    V    M S  KNT F     TG  V T +
Sbjct: 356 HPRRVLGLDGGVLEPGAVADITIIDPNLTEIVDPGKMQSKSKNTPFTGWRLTGLPVITMV 415

Query: 422 SGK 424
           +GK
Sbjct: 416 AGK 418


>gi|209518626|ref|ZP_03267444.1| dihydroorotase, multifunctional complex type [Burkholderia sp.
           H160]
 gi|209500909|gb|EEA00947.1| dihydroorotase, multifunctional complex type [Burkholderia sp.
           H160]
          Length = 426

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 135/418 (32%), Positives = 210/418 (50%), Gaps = 5/418 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+   ++   I +E G I A G     A F     I D  GL   PG++D    L  
Sbjct: 10  LIDPAAGTEQQQDIFIEAGKIAALGN--APAGFQAERTI-DARGLSIAPGLVDLCARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    A+AGG+TS++  P      LDE   ++      R  +  +VYP  
Sbjct: 67  PGYEHKATLGSEMAAALAGGVTSLVCPP-DTDPTLDEPGLVEMLKFRARNLNQAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+   I DTQVL+ +++YA      V L   D +
Sbjct: 126 ALTVGLKGQVITEMVQLTEAGCIGFSQADTPIVDTQVLMRALQYAKTYGFTVWLRPVDAY 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           LG  GV   G +A+ LGL G+P  +ET+ L     + + TG   H S +S    +AL++ 
Sbjct: 186 LGKGGVAASGALASRLGLSGVPVAAETIALHTIFELVRVTGARVHVSHVSSAAGVALVRE 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     +C +++N++ L + D+  +++  ++ PPLR + +R ++   L  G ID I S
Sbjct: 246 AKAEGLPVSCDVTVNHVHLIDLDIGYFDAQFRLDPPLRQQRDREAIRAGLVDGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNL- 369
            HTP   D KLLPFAEA+ G+ GLE  LS  ++      + L   ++ ++  PAQ+  L 
Sbjct: 306 AHTPVDDDEKLLPFAEATPGATGLELFLSLTVKWADEAGVPLATALKRITAAPAQVLGLE 365

Query: 370 PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
             G L  G  AD+ + D +  W V+   + S   NT F       +V  T +SG+  Y
Sbjct: 366 AAGRLAVGAVADLCVFDRHAHWYVEPRALKSQGHNTPFLGYELPAQVRATIVSGQLAY 423


>gi|319795844|ref|YP_004157484.1| dihydroorotase [Variovorax paradoxus EPS]
 gi|315598307|gb|ADU39373.1| dihydroorotase [Variovorax paradoxus EPS]
          Length = 427

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 141/431 (32%), Positives = 221/431 (51%), Gaps = 16/431 (3%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           ++ N R+IDP+   D+   I + +G I  AG     A F     I D TG +  PG++D 
Sbjct: 4   LITNGRVIDPASGTDKKTDIAIADGKI--AGIGNTPAGFKADRTI-DATGCIVAPGLVDL 60

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFI---KYALEEIRVK 121
              L     E+   + +    A+AGG+TS++  P      LDE   +   K+  E+++  
Sbjct: 61  AARLREPGYEHEGMLESEMAAAIAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRAEKLQRA 119

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
            L   +P   LT N+ G  ++EM  L E G + F Q+ + + DTQVL  ++ YA      
Sbjct: 120 RL---FPLGALTRNLAGGVLTEMAELTEAGCIGFSQADVPLADTQVLQRALLYASTFGYT 176

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V L   D  LG +GV   G +A  LGL G+P  +ET+ +   + + + TG   H   IS 
Sbjct: 177 VWLRPQDRDLG-KGVAASGPLATRLGLSGVPVSAETIAIFTIVELMKSTGARVHLCRISS 235

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
              +AL++ AKA     TC +SIN+L L + D+  ++S  ++ PPLR + +R ++  AL 
Sbjct: 236 AAGVALVRAAKAQGLPLTCDVSINSLHLADTDIGYFDSRARLNPPLRQQGDRDALSAALA 295

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID +VSDHTP   D K LPFAEA  G+ GLE +L  AL+        + + I  +++
Sbjct: 296 DGTIDALVSDHTPVEADAKTLPFAEAEPGATGLELLLPLALQWGERSGAGIARAIEVITS 355

Query: 362 RPAQIF-NLPGGT----LQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
            PA++   +  GT    L  G  AD+ ++D   +W V+ D + S  K+T F      G+ 
Sbjct: 356 APARLLATVDAGTGIGRLVEGGVADLCVVDSALEWQVQPDQLKSQGKHTPFAGYPVQGRA 415

Query: 417 VRTYISGKQVY 427
             T ++G+ V+
Sbjct: 416 RHTLVAGRVVH 426


>gi|121535610|ref|ZP_01667416.1| dihydroorotase, multifunctional complex type [Thermosinus
           carboxydivorans Nor1]
 gi|121305780|gb|EAX46716.1| dihydroorotase, multifunctional complex type [Thermosinus
           carboxydivorans Nor1]
          Length = 429

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 124/425 (29%), Positives = 221/425 (52%), Gaps = 6/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
             +L N R+I+P+   D +  I++  G I A G + L+A     A   +  GLV  PG +
Sbjct: 2   KLLLKNGRVINPADGTDTIKDILIAEGKIAAIGEE-LSAD---GAECFNAAGLVVAPGFV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     E  +++ + +  A AGG T+I  MP      +D    +   ++  +V+ 
Sbjct: 58  DMHTHLREPGLEAKEDVVSGTNAAAAGGFTTIACMP-NTKPVVDNAILVAGLIQRAQVEG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           ++N+     L+   EGKE++E+  +   G V+       +   ++L  +++Y  M +  +
Sbjct: 117 IVNLKVIGALSKGQEGKELAEIGDMILAGAVAISDDGHYVDSARLLKTALEYTGMFDKPI 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L S G ++EG ++  LG+ G P+++E + +ARD+++A++ G   H + +S  
Sbjct: 177 ISHAEDESLVSDGYMHEGAVSAMLGMKGRPAVAEDIAVARDIMLAEYVGAPIHIAHVSTK 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            ++ LI+ AK    K T  ++ ++L L +  V+ +++  KV PPLRS+    +++E ++ 
Sbjct: 237 GAVELIRQAKNRGVKVTAEVTPHHLSLTDEAVKGFDTATKVNPPLRSQEHVAALIEGVKD 296

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALST 361
           G ID I +DH P   + K + +  A  G  GLET L   L  L+H  Q+SL ++IR ++ 
Sbjct: 297 GTIDAIATDHAPHAYEEKDMEYRYAPSGFAGLETALGVVLTALYHTGQLSLMEIIRLMAY 356

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA+I  L  G ++ G AAD+ + D +  W V +    +  K+T F+ +   GK V T +
Sbjct: 357 NPARILGLDAGVIRVGGAADLTIFDPDLDWIVDSKKFYTKGKHTPFEGKKLKGKAVATIV 416

Query: 422 SGKQV 426
            GK V
Sbjct: 417 GGKIV 421


>gi|239636319|ref|ZP_04677321.1| dihydroorotase [Staphylococcus warneri L37603]
 gi|239597674|gb|EEQ80169.1| dihydroorotase [Staphylococcus warneri L37603]
          Length = 425

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 127/382 (33%), Positives = 199/382 (52%), Gaps = 2/382 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  G +  PG +D  V L     E+ + I T +K A  GG T+I  MP       D    
Sbjct: 45  DAKGNLIAPGFVDVHVHLREPGGEHKETIETGTKAAARGGFTTICPMP-NTRPVPDSVEN 103

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           I+   E+I+  + I V P A +T+   GKE+ + + L ++G+ +F    + +    ++  
Sbjct: 104 IRALREKIKDSAQIRVLPYASITTRQAGKELVDFQALADEGVFAFTDDGVGVQQASMMYA 163

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +MK A  +   +     D+ L   G +++G  +  LG+ GIP++ E+V +ARD+L+A+ T
Sbjct: 164 AMKQAAKVKKPIVAHCEDNSLIYGGAMHKGKRSEELGIPGIPNVCESVQIARDVLLAEAT 223

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G HYH   +S  +S+ +I+ AK      T  ++ ++L+L ENDV   ++  K+ PPLRS 
Sbjct: 224 GCHYHVCHVSTKESVRVIRDAKKAGIHVTAEVTPHHLLLTENDVPGDDANYKMNPPLRST 283

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQ 349
            +R +++E L  G ID I +DH P   + K  P  +A FG +G ET        F     
Sbjct: 284 EDRDALLEGLLDGTIDCIATDHAPHAKEEKEQPMTKAPFGIVGSETAFPLLYTHFVRNGN 343

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            SLK+LI  L+ +PA IFNL  G L   + ADI +IDL  +  +K++D  S   NT F  
Sbjct: 344 WSLKQLIDYLTIKPATIFNLNYGKLHKDSYADITIIDLENEKEIKSEDFLSKADNTPFIG 403

Query: 410 EFFTGKVVRTYISGKQVYTLES 431
           E   G  V T + G+ V+  E 
Sbjct: 404 EKVFGHPVLTMVKGEVVFKEEK 425


>gi|210633952|ref|ZP_03297923.1| hypothetical protein COLSTE_01840 [Collinsella stercoris DSM 13279]
 gi|210158996|gb|EEA89967.1| hypothetical protein COLSTE_01840 [Collinsella stercoris DSM 13279]
          Length = 429

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 128/425 (30%), Positives = 207/425 (48%), Gaps = 7/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + +L N  ++DP+ D+D V  ++VE  +I A G + L  +    A + D TG   VPG++
Sbjct: 2   ALLLKNAHVVDPAVDLDGVMDVLVEGDVIAAVG-EGLACE---GAEVIDLTGKYLVPGLV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     E   +I + +  A  GG T +  MP   +   D    ++Y       K 
Sbjct: 58  DMHVHLREPGFEAKGDIESETAAAAKGGFTGVCSMP-NTNPVTDNGVVVEYIKSVAAAKG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              VYP   +T  ++G+ I+EM  + E G V+F      I    ++  +M Y  M     
Sbjct: 117 HCRVYPAGAMTKGLKGEIIAEMGDMVEHGAVAFTDDGRGIQGAGMVRRAMDYGQMFGKTF 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G INEG ++  LGL+G P+  E + +ARD+ IA+ TG   H   IS  
Sbjct: 177 MSHCQDDDLVGDGQINEGAVSTRLGLLGWPAEGEELQIARDITIAELTGAKLHIQHISTA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVE-MYNSLRKVLPPLRSETERMSMVEALE 301
           + + +++ AKA     TC  + ++L L E+ ++  YN+  KV PPLR+  +  +++  + 
Sbjct: 237 KGLDMVRAAKAKGLPVTCEATPHHLFLTEDAIDGTYNTCFKVNPPLRTAADAEALIAGVV 296

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALS 360
            G +D I +DH P     K   F  A FG  GLET L   +  L    ++S  +++  ++
Sbjct: 297 DGSVDAIATDHAPHSDWEKSREFELAPFGMTGLETALGLVITNLVKTGKMSFGRMVELMA 356

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             P +I  L   T+  G+ AD+ + D +  WTV  DD +S  KN+ F     TG+    +
Sbjct: 357 IAPRKILGLDQVTIAEGSVADLTVFDADAAWTVSEDDFASHAKNSGFKGVELTGRATDVF 416

Query: 421 ISGKQ 425
           + GK+
Sbjct: 417 VGGKR 421


>gi|254452311|ref|ZP_05065748.1| dihydroorotase [Octadecabacter antarcticus 238]
 gi|198266717|gb|EDY90987.1| dihydroorotase [Octadecabacter antarcticus 238]
          Length = 338

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 111/319 (34%), Positives = 176/319 (55%)

Query: 105 LDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHD 164
           +D    +++      + + +NV P A LT    G+E++E+  L + G V+F      + +
Sbjct: 10  IDTPETLEFVERRASIDAAVNVLPMAALTKGRAGREMTEIGFLLDAGAVAFTDCDRVVTN 69

Query: 165 TQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDL 224
           T++    + YAH L A+V     +  L + G +  G  A   GL G+  ++E + L RD+
Sbjct: 70  TKIFSRVLTYAHSLGALVIGHVQEPGLSAGGSVTSGKFATLRGLSGVSPMAERMGLDRDI 129

Query: 225 LIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVL 284
            + + TG  YH   I+  +++  ++ AKA+    T G+ +++L LNE DV  Y +  K+ 
Sbjct: 130 ALLEMTGAAYHVDQITTARALPALERAKANGLDITAGVGVHHLTLNELDVADYRTFFKLK 189

Query: 285 PPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRL 344
           PPLRSE +R+++V A+  G IDII S HTP+  ++K LP+ EA+ G++ LET+L AALRL
Sbjct: 190 PPLRSEDDRLAVVAAVASGLIDIICSMHTPQDEESKRLPYEEAASGAVALETLLPAALRL 249

Query: 345 FHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKN 404
            H   + L  L RAL+  PA    L  G L  G  AD+ L D +  + +    + S  KN
Sbjct: 250 VHAGHMDLPHLFRALALNPANRLGLACGRLSVGAPADLVLFDPDASYRLDRFALLSKSKN 309

Query: 405 TVFDKEFFTGKVVRTYISG 423
           T FD     GKV+ TY++G
Sbjct: 310 TPFDGAILQGKVIATYVAG 328


>gi|225420157|ref|ZP_03762460.1| hypothetical protein CLOSTASPAR_06500 [Clostridium asparagiforme
           DSM 15981]
 gi|225041214|gb|EEG51460.1| hypothetical protein CLOSTASPAR_06500 [Clostridium asparagiforme
           DSM 15981]
          Length = 438

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 130/424 (30%), Positives = 216/424 (50%), Gaps = 6/424 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           ++   R++DP+   DE   +++E G+I    A    A+     +I D   LVA PG++D 
Sbjct: 17  LIRGGRVVDPATGRDERADLVLEGGVIREICAPGQAAETDFDQVI-DAKNLVAAPGLVDV 75

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V        Y ++I + ++ A  GG T+++ M       +D    ++Y L E + K+ I
Sbjct: 76  HVHFRDPGLTYKEDIHSGARAAARGGFTTVVCMA-NTKPIVDNEETLRYVLAEGK-KTGI 133

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           +V   A ++   EG+E+++M  L   G   F    + + D   +  +M+ A  L+ +++ 
Sbjct: 134 HVLSCAAVSRGFEGRELTDMEGLLAAGAAGFTDDGIPLMDGVFVKKAMEEAARLDTVLSF 193

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D        IN G +++ LG+ G P+++E   +ARD +IA  TG       IS   +
Sbjct: 194 HEEDKSFIVNNGINHGAVSDRLGIYGSPALAEDALVARDCMIALETGAKVDIQHISSGHA 253

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + +++ AK         ++ ++  L E  V  Y +L K+ PPLR+ET+R  ++E L+ G 
Sbjct: 254 VRMVRLAKNLGANVWAEVTPHHFALTEEAVLKYGTLAKMNPPLRTETDRAMLIEGLKDGT 313

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALSTRP 363
           ID+I +DH P   + K  P  EA  G IGLET L+  +  L     +SL +L++ +S  P
Sbjct: 314 IDMIATDHAPHSAEEKARPLTEAPSGIIGLETALALGITCLVKPGHLSLCELMKKMSFNP 373

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+++ L  G L+ G  AD+ L D N +WTV   D +S   N+ F  E  TG+V  T   G
Sbjct: 374 ARLYKLDCGRLEAGAPADLVLFDENEEWTVT--DFASRAANSPFVGERLTGRVKYTICEG 431

Query: 424 KQVY 427
           K VY
Sbjct: 432 KVVY 435


>gi|257063895|ref|YP_003143567.1| dihydroorotase, multifunctional complex type [Slackia
           heliotrinireducens DSM 20476]
 gi|256791548|gb|ACV22218.1| dihydroorotase, multifunctional complex type [Slackia
           heliotrinireducens DSM 20476]
          Length = 430

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 127/423 (30%), Positives = 207/423 (48%), Gaps = 7/423 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + +L N  I+DP+  +D V  +++E G+I A  A+ + A+    A + D TG   +PG++
Sbjct: 2   ALILKNAHIVDPAAQLDGVADVLIEGGMI-AKVAENIEAE---GAEVRDLTGKYLIPGLV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V       EY + I T S+ A  GG T +  M        D    + Y +       
Sbjct: 58  DLHVHFRDPGLEYKETIETGSRAAAHGGFTDVCTMA-NTDPICDTGATVAYQIARGEEAG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              ++P    T  ++G+ ISEM  +   G V+F      + D  ++   M Y  M + +V
Sbjct: 117 KCRIHPAGSCTKGLKGEIISEMGDMVANGAVAFTDDGRGVQDAGMMRRVMDYGKMFDKVV 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G INEG ++  LGL+G P+  E + + RD+ IA+ TG   H   I+  
Sbjct: 177 MSHCQDEGLVGDGQINEGAVSTRLGLLGWPAAGEEIQIGRDIAIAELTGCPLHIQHITTA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEM-YNSLRKVLPPLRSETERMSMVEALE 301
             + +++ AKA   + TC ++ ++L L+E D+++ Y++  KV PPLR++ +  +++E + 
Sbjct: 237 AGLDMVRRAKAKGLEVTCEVTPHHLFLSEEDLDVTYDTNLKVNPPLRTKEDSAALLEGIL 296

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALS 360
            G +D IV+DH P     K   F  A FG  GLET L+  L  L     I   K++  +S
Sbjct: 297 DGTVDCIVTDHAPHAAWEKAREFELAPFGMTGLETSLALILTNLVDKGVIDYAKMVELMS 356

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
            RP +I  +   ++  G  ADI + D N +WTV  D   S   N+ F      G+    Y
Sbjct: 357 IRPREILRIAPVSIAEGNVADITVFDPNAEWTVTEDIFESKAANSGFLGAQLKGRATDVY 416

Query: 421 ISG 423
           ++G
Sbjct: 417 LAG 419


>gi|221194349|ref|ZP_03567406.1| dihydroorotase [Atopobium rimae ATCC 49626]
 gi|221185253|gb|EEE17643.1| dihydroorotase [Atopobium rimae ATCC 49626]
          Length = 435

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 130/425 (30%), Positives = 210/425 (49%), Gaps = 6/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           +++L     IDP   +D++  +++E+G I   G D      P  A + D  G   VPG++
Sbjct: 2   AYLLKAAHAIDPQLHLDDICDVLIEDGEIAQIGKDLAT---PKDARVIDAAGKYLVPGLV 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V       EY + I T S+ AV GG T +  MP   +   D    I+Y L+  R   
Sbjct: 59  DMHVHFRDPGFEYKETIETGSRAAVHGGFTDVATMP-NTNPVTDTGAEIRYQLDHGREVG 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+++ P   LT   +G+ ++E+  +  +G  +F      +    ++   M+Y    N +V
Sbjct: 118 LVHIRPIGALTKESKGETLAEIGDMVMEGACAFSDDGHGVQSAGMMRTCMEYVSQFNRVV 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           A       L + GVINEG  +  LG+ G P+++E + ++RD+ + + TG   H   IS  
Sbjct: 178 AAHCEVESLSANGVINEGRASTRLGMFGWPALAEELEISRDIELCRLTGCPLHICHISTA 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDV-EMYNSLRKVLPPLRSETERMSMVEALE 301
           +   L++ AKA     T  +  ++L LNE D+   YN+  K+ PPLR+  +  ++ EA+ 
Sbjct: 238 RGADLVRQAKAEGLPVTAEVCPHHLFLNEEDITTTYNTNLKMNPPLRTADDARALQEAVV 297

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALS 360
            G ID IV+DH P     K   +  A FG+IGLET L   L R+    ++S  +L+  ++
Sbjct: 298 DGTIDCIVTDHAPHAAHEKDTEWEIAYFGTIGLETSLPLMLTRMVALNKLSWTRLVELMA 357

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             P +I  L    L+ G AAD+ LID N +  V  D   S  KN+ F  E   G     +
Sbjct: 358 VNPRRILRLEPIRLEAGCAADLTLIDPNLKIDVTEDYFESKSKNSAFIGEKLCGVATDVF 417

Query: 421 ISGKQ 425
           + G++
Sbjct: 418 VGGRR 422


>gi|91782037|ref|YP_557243.1| dihydroorotase [Burkholderia xenovorans LB400]
 gi|91685991|gb|ABE29191.1| dihydroorotase [Burkholderia xenovorans LB400]
          Length = 426

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 135/418 (32%), Positives = 212/418 (50%), Gaps = 5/418 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+   ++   I +  G I A G     A F     I D  GL  +PG++D    L  
Sbjct: 10  LIDPAAGTEQQQDIFIAAGKIAAIGN--APADFNADKTI-DAQGLHVMPGLVDLSARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    A+AGG+TS++  P      LDE   ++      R  +  +VYP  
Sbjct: 67  PGYEHKATLESEMTAALAGGVTSLVCPP-DTDPTLDEPGLVEMLKFRARNLNQAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G + F Q+ + + DTQVLL +++YA      V L   D +
Sbjct: 126 ALTVGLKGQVITEMVELTEAGCIGFSQADVPVVDTQVLLRALQYAKTYGYTVWLRPVDAY 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           LG  GV   G +A+ LGL G+P  +ET+ L     + + TG   H S +S    IAL++ 
Sbjct: 186 LGKGGVAASGALASRLGLSGVPVSAETIALHTIFELVRVTGARVHLSHVSSAAGIALMRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     +C +++N++ L + D+  +++  ++ PPLR + +R ++   L  G ID I S
Sbjct: 246 AKAEGLPVSCDVTVNHVHLIDLDIGYFDAQFRLDPPLRQQRDREAIRAGLVDGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNL- 369
           DHTP   D KLLPFAEA+ G+ GLE  LS  ++     ++ L K +  ++  PA++  L 
Sbjct: 306 DHTPVDDDEKLLPFAEATPGATGLELFLSLTVKWADEARVPLAKALNRITAAPAKVLELD 365

Query: 370 PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
             G +  G  AD+ + D N  W V+   + S   NT F       +V  T +SG   +
Sbjct: 366 AAGRIAVGGVADLCVFDRNAHWRVEPRALKSQGHNTPFLGYELPARVHATIVSGHVAF 423


>gi|328553556|gb|AEB24048.1| dihydroorotase [Bacillus amyloliquefaciens TA208]
          Length = 428

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 133/431 (30%), Positives = 211/431 (48%), Gaps = 17/431 (3%)

Query: 3   SFVLNNTRIIDP-----SRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVA 57
           S+++ N  +++      ++DI   G II E GI+ A   +           + D +GL  
Sbjct: 2   SYLIKNGWMLNEQGEKVAQDIRVTGEIIAETGILTAKDGET----------VIDASGLFV 51

Query: 58  VPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEE 117
            PG++D  V       E  + I T SK A  GG T++  MP       D    +++    
Sbjct: 52  SPGLVDLHVHFREPGGEKKETIETGSKAAARGGFTTVAAMP-NTRPVPDTKEQMEWLQNR 110

Query: 118 IRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHM 177
           I+  S + V P A +T    G+++++  +L E G  +F    + +    ++  +MK A  
Sbjct: 111 IKETSSVRVLPYASITIRQTGEQMTDFEVLHEAGAFAFTDDGVGVQTAGMMYEAMKRAAS 170

Query: 178 LNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS 237
           +N  +     D+ L   G ++EG  +   GL GIPSI E V +ARD+L+A+    HYH  
Sbjct: 171 MNKAIVAHCEDNSLIYGGSVHEGAFSKANGLNGIPSICEAVHIARDVLLAEAAACHYHVC 230

Query: 238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMV 297
            IS  +S+  ++ AK    + T  +S ++L+L + D+   ++  K+ PPLRS+ +R +++
Sbjct: 231 HISTKESVRAVRDAKKAGIRVTAEVSPHHLLLCDEDIPGLDTNFKMNPPLRSKEDRAALI 290

Query: 298 EALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLI 356
           E L +G ID I +DH P   + K      A FG +GLET        F      +LK+L+
Sbjct: 291 EGLLEGTIDFIATDHAPHTEEEKNTDMKLAPFGIVGLETAFPLLYTHFVKSGSWTLKQLV 350

Query: 357 RALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
             ++ +P + F LP GTL  G  ADI LIDL  +  +  D   S  KNT F+K    G  
Sbjct: 351 DFMTKKPCEAFGLPYGTLAPGAPADITLIDLEKEAAIDKDTFLSKGKNTPFNKMKCFGWP 410

Query: 417 VRTYISGKQVY 427
           V T   GK  Y
Sbjct: 411 VATMAGGKLAY 421


>gi|300813841|ref|ZP_07094146.1| dihydroorotase [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|300512028|gb|EFK39223.1| dihydroorotase [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 420

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 127/426 (29%), Positives = 223/426 (52%), Gaps = 12/426 (2%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R+IDP ++ID++  I +++G I    +D  + K      I D   L+A PG++D
Sbjct: 1   MIIKNARVIDPWQNIDKIADIQIKDGKINKIASDLTDDK-----EIIDAKNLIACPGLVD 55

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V        Y +++ + ++ A+AGG TS++ M    +  +D    +K   +  R K L
Sbjct: 56  VHVHFRDPGFTYKEDLYSGTQAAIAGGYTSVVCM-ANTNPVMDSPEKVKEFYK--RAKEL 112

Query: 124 -INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
            INVY  + LT N E  ++ +M  L ++G V F    +   +++++L +MK A  LN ++
Sbjct: 113 PINVYTVSALTENFEDNKLVDMEKLLQEGAVGFTDDGIPNRNSKLILQAMKEAKRLNTLI 172

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
           +    D  L     IN G ++    + G PS++E+  +ARD+  A +TG       IS  
Sbjct: 173 SFHEEDPNLIENNGINHGEVSEKFNIYGSPSLAESSFIARDVEYAINTGAKIDIQHISTK 232

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           + + L+++ K+        ++ ++  L +  +  Y  + K+ PPLR++ +R +++E ++ 
Sbjct: 233 RGVDLVRYGKSRGANVFAEVTPHHFTLTDKALLKYKQMAKMNPPLRTKEDRQAILEGIKD 292

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALST 361
           G +++I +DH P   + K     +A  G IGLET L   +R L     IS+ KLI  +ST
Sbjct: 293 GTLELIATDHAPHSQEEKNRELTKAPSGIIGLETALGLGVRELVEKNIISINKLIELMST 352

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            P + +NLPGGTL+ G+ ADI + D   +++++     S   NT F  E   GKV+ T  
Sbjct: 353 NPCKKYNLPGGTLKEGSRADILIFDPKREYSIET--FKSKSSNTPFKGEKLIGKVIYTIS 410

Query: 422 SGKQVY 427
            G  +Y
Sbjct: 411 KGHIIY 416


>gi|152986268|ref|YP_001345896.1| dihydroorotase [Pseudomonas aeruginosa PA7]
 gi|150961426|gb|ABR83451.1| noncatalytic dihydroorotase-like protein [Pseudomonas aeruginosa
           PA7]
          Length = 423

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 135/418 (32%), Positives = 206/418 (49%), Gaps = 5/418 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           +   R+IDP+  +D+VG + +E G I+A GA    A F     + D  GLVA PG++D  
Sbjct: 5   IRGARVIDPASGLDQVGDLHIEAGRIVAIGA--APAGFSAQKTL-DGAGLVAAPGLVDLS 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L         N+ + ++ A AGG TS+   P      LD     +  L+  R      
Sbjct: 62  VALREPGYGRKGNVESETRAAAAGGTTSLCCPPY-TRPVLDTPAVAELILDRAREAGNAK 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           VYP   LT    G+++SE+  L++ G V+F          ++L  +++YA   +  V   
Sbjct: 121 VYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASNRILRRALEYAATFDLTVIFT 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
           + D  L   G+ +EG  A++LGL GIP  +ETV LAR+LL+ + +G   H S ++  + I
Sbjct: 181 SQDPDLAEGGLAHEGPTASFLGLAGIPETAETVALARNLLLVEQSGVRAHFSQLTSARGI 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            L+  A+A     TC +++  LIL +  +  ++SL  V PPLR+  +R ++ EA++ G +
Sbjct: 241 ELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLYHVQPPLRTRADREALREAVKSGVV 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
             I S H P   D K  PFA    G  G E +L  AL L     + L  L+  L+  PAQ
Sbjct: 301 QAIASHHQPHEADAKNAPFAATEPGISGAELLLPLALTLVQDGLLDLPTLLARLAHGPAQ 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
              LP G L  G  AD+ L D     T+  +   S  +N+ F      G+V  T + G
Sbjct: 361 ALRLPAGRLAVGQTADLVLFDPQGS-TLAGESWYSKGQNSPFIGHCLPGRVRYTLVDG 417


>gi|229822748|ref|ZP_04448818.1| hypothetical protein GCWU000282_00036 [Catonella morbi ATCC 51271]
 gi|229787561|gb|EEP23675.1| hypothetical protein GCWU000282_00036 [Catonella morbi ATCC 51271]
          Length = 425

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 133/405 (32%), Positives = 212/405 (52%), Gaps = 7/405 (1%)

Query: 24  IIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLS 83
           I+++   ILA   + LNA   T+  + D  G +  PG ID  V       EY +NI   S
Sbjct: 20  ILIDGDKILAMDKE-LNA---TADQVFDLKGKLLAPGFIDVHVHWREPGFEYKENIYHAS 75

Query: 84  KEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISE 143
           + A  GG T+ + MP  ++   D Y  +K  L+ I   S+I   P   +T    G++ ++
Sbjct: 76  RAAARGGFTTAMPMP-NLNPVPDSYEHLKPQLDIIARDSVIRAIPYGAITKGELGEDYAQ 134

Query: 144 MRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIA 203
              L  Q + +F      + +  ++  SM  A  LN  +     D+ L   G ++ G  +
Sbjct: 135 FDELA-QHVFAFSDDGRGVQNANMMYESMCVAARLNKAIVAHCEDNSLIRGGCMHCGCRS 193

Query: 204 NYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGIS 263
             LGL GIPS+ E+V +ARD+L+A+  G HYH   +S  +S+ L++ AKA+  K TC + 
Sbjct: 194 RELGLPGIPSVCESVQIARDILLAEAAGCHYHVCHVSTKESVRLVREAKANGIKVTCEVC 253

Query: 264 INNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLP 323
            ++L+ +E+D+   +   K+ PPLR+  +R +++  L  G IDII +DH P  M  K LP
Sbjct: 254 PHHLLSDEDDIPHNHGFWKMNPPLRAAEDRRALIAGLLDGTIDIIATDHAPHAMTEKDLP 313

Query: 324 FAEASFGSIGLETMLSAALRLFHGQQI-SLKKLIRALSTRPAQIFNLPGGTLQTGTAADI 382
             EA+FG +G ET  S     F    I SL+ L+  +ST  A+IF+LP G+L  G  AD+
Sbjct: 314 MQEAAFGIVGSETAFSQLYTHFVKPGIMSLEFLLDKMSTDVAKIFDLPYGSLAVGQPADL 373

Query: 383 ALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            +IDL+   T++ ++  S  +NT +  +   G  + T   G+  Y
Sbjct: 374 VVIDLDKVATIEPENFLSKGRNTPYAGQEVYGWPILTISQGRIAY 418


>gi|225017613|ref|ZP_03706805.1| hypothetical protein CLOSTMETH_01542 [Clostridium methylpentosum
           DSM 5476]
 gi|224949578|gb|EEG30787.1| hypothetical protein CLOSTMETH_01542 [Clostridium methylpentosum
           DSM 5476]
          Length = 415

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 130/378 (34%), Positives = 199/378 (52%), Gaps = 4/378 (1%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  GL   PG++D  V L      Y  +I T    A AGG+TS+  MP      +D    
Sbjct: 36  DLHGLAVFPGLVDMHVHLRDPGLTYKSDIYTGCCAAAAGGVTSVACMP-NTKPAIDSPET 94

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           I+Y +++    +   VYP A +T  +EG E+ +   L+E G V+F      + +   L  
Sbjct: 95  IQYIVDKAST-AKARVYPIASVTKGLEGSELVDFAALKEAGAVAFSDDGRPVENAAYLQR 153

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +M+ A  L   V     D  +   G+IN+G ++  LG+ G+   SE    AR++ IA  T
Sbjct: 154 AMEAADKLGTRVISHCEDLAIIDGGIINKGQVSEQLGVKGMDRTSEDSITAREIAIAAAT 213

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
               H + +S   S+ALI+ AK    + T     +  IL E  +   ++  ++ PPLR E
Sbjct: 214 HTPIHIAHVSTRGSVALIRDAKRRGVRVTAETCPHYFILTEEQLLKKDADYRMNPPLREE 273

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQ 349
            +R ++VE +  G ID IV+DH P H   + L F  A  G IGLET ++A L  L+H  +
Sbjct: 274 KDRQAIVEGIIDGTIDCIVTDHAP-HAPKEKLDFETAPNGVIGLETSMAATLTSLYHTGR 332

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
           ++L+++ + +S  PA+I  +PGG +  G  ADIA+++L+++WTV  D + S  KNTVF  
Sbjct: 333 LTLERIAQLMSGNPARILGIPGGQIAPGRDADIAVVNLHHKWTVDPDKLHSKSKNTVFKG 392

Query: 410 EFFTGKVVRTYISGKQVY 427
             FTGK V T   G+ VY
Sbjct: 393 MTFTGKPVMTICRGEIVY 410


>gi|293376108|ref|ZP_06622358.1| dihydroorotase [Turicibacter sanguinis PC909]
 gi|292645262|gb|EFF63322.1| dihydroorotase [Turicibacter sanguinis PC909]
          Length = 426

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 201/386 (52%), Gaps = 6/386 (1%)

Query: 45  TSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMP--LGMS 102
           TSA ++D  G +  PG+ID  V L     E  + I T ++ A  GG T+I  M   + + 
Sbjct: 38  TSATVYDLKGKLVAPGLIDVHVHLREPGYERKETIETGTEAAARGGYTTIAAMANTIPVP 97

Query: 103 SFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSI 162
             L+  ++I+     I+  + + V P   +T    G+EI ++  L    I+ F      I
Sbjct: 98  DTLENVSYIENL---IKQSAKVRVLPYGAITIGERGEEIVDVEGLSNTSILGFSDDGRGI 154

Query: 163 HDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLAR 222
            +  V+  +M+ A  +N  +     D  L   G ++EG  A   G  GI S+SE+  +AR
Sbjct: 155 QEAGVMYQAMQRAKAVNKPIVAHCEDDSLLFGGYLHEGEYAKANGHRGILSVSESAQIAR 214

Query: 223 DLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRK 282
           D+++AQ TG HYH   IS  +S+ L++ AK+     T  +S ++LIL + D++  +   K
Sbjct: 215 DIMLAQATGVHYHICHISTKESVELVRFAKSQGINVTAEVSPHHLILCDMDIQNDDPNFK 274

Query: 283 VLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL 342
           + PPLRS+ +R + +  L  G ID+I +DH P H D K      A FG +GLET      
Sbjct: 275 MNPPLRSDEDRAACIAGLLDGTIDVIATDHAPHHEDEKAWGLETAPFGIVGLETAFPLLY 334

Query: 343 RLF-HGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSI 401
             F    ++SLK+L+  +ST+PAQIF+LP GTL  G +ADI +IDL+ +  +      S 
Sbjct: 335 THFVKTNKMSLKQLLDCMSTKPAQIFDLPYGTLNIGVSADITVIDLDKEREIDPKTFKSK 394

Query: 402 HKNTVFDKEFFTGKVVRTYISGKQVY 427
            KNT F      G  V T + GK VY
Sbjct: 395 GKNTPFTGYKTMGWPVMTLVEGKIVY 420


>gi|325845278|ref|ZP_08168582.1| dihydroorotase [Turicibacter sp. HGF1]
 gi|325488719|gb|EGC91124.1| dihydroorotase [Turicibacter sp. HGF1]
          Length = 426

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 201/386 (52%), Gaps = 6/386 (1%)

Query: 45  TSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMP--LGMS 102
           TSA ++D  G +  PG+ID  V L     E  + I T ++ A  GG T+I  M   + + 
Sbjct: 38  TSATVYDLKGKLVAPGLIDVHVHLREPGYERKETIETGTEAAARGGYTTIAAMANTIPVP 97

Query: 103 SFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSI 162
             L+  ++I+     I+  + + V P   +T    G+EI ++  L    I+ F      I
Sbjct: 98  DTLENVSYIENL---IKQSAKVRVLPYGAITIGERGEEIVDVEGLSNTSILGFSDDGRGI 154

Query: 163 HDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLAR 222
            +  V+  +M+ A  +N  +     D  L   G ++EG  A   G  GI S+SE+  +AR
Sbjct: 155 QEAGVMYQAMQRAKAVNKPIVAHCEDDSLLFGGYLHEGEYAKANGHRGILSVSESAQIAR 214

Query: 223 DLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRK 282
           D+++AQ TG HYH   IS  +S+ L++ AK+     T  +S ++LIL + D++  +   K
Sbjct: 215 DIMLAQATGVHYHICHISTKESVELVRFAKSQGINVTAEVSPHHLILCDMDIQNDDPNFK 274

Query: 283 VLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL 342
           + PPLRS+ +R + +  L  G ID+I +DH P H D K      A FG +GLET      
Sbjct: 275 MNPPLRSDEDRAACIAGLLDGTIDVIATDHAPHHEDEKAWGLETAPFGIVGLETAFPLLY 334

Query: 343 RLF-HGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSI 401
             F    ++SLK+L+  +ST+PAQIF+LP GTL  G +ADI +IDL+ +  +      S 
Sbjct: 335 THFVKTNKMSLKQLLDCMSTKPAQIFDLPYGTLNIGVSADITVIDLDKEREIDPKTFKSK 394

Query: 402 HKNTVFDKEFFTGKVVRTYISGKQVY 427
            KNT F      G  V T + GK VY
Sbjct: 395 GKNTPFTGYKTMGWPVMTLVEGKIVY 420


>gi|312963618|ref|ZP_07778099.1| dihydroorotase [Pseudomonas fluorescens WH6]
 gi|311282127|gb|EFQ60727.1| dihydroorotase [Pseudomonas fluorescens WH6]
          Length = 423

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 133/420 (31%), Positives = 206/420 (49%), Gaps = 5/420 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP+  +D V  + +E G I+A GA      F T+    D TGLVA PG++D  V 
Sbjct: 7   GARVIDPATGLDAVTDLHLEAGKIIAIGA--APGGF-TAVETLDATGLVAAPGLVDLNVA 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         +I + ++ A AGG+TS+   P      LD     +  L+  R      V+
Sbjct: 64  LREPGYSRKGSIASETRAAAAGGVTSLCCPP-HTKPVLDTSAVTELILDRAREAGNCKVF 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   L+  +EG++++E+  L++ G V+F         T+ L  +++YA   +  V   + 
Sbjct: 123 PIGALSKGLEGEQLAELIALRDAGCVAFGNGLQGFRSTRTLCRALEYAATFDLTVIFHSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ +EG +A++LGL GIP  +ETV LARDLL+ + +G   H S ++  + +AL
Sbjct: 183 DRDLAEGGLAHEGAVASFLGLPGIPETAETVALARDLLLVEQSGVRAHFSQLTSARGVAL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  +  A++ G +  
Sbjct: 243 IAQAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPPLRTLADREGLRAAVKSGVVSA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS  PA+  
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVEDGLLDLPTLLTRLSAGPAEAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
            LP G L  G AAD+ L D     T+  +   S  +N  F        V  T + G+  Y
Sbjct: 363 RLPAGKLAVGAAADLVLFD-PASSTIAGEHWLSKGENCPFIGHSLPASVRYTLVDGRISY 421


>gi|268678967|ref|YP_003303398.1| dihydroorotase [Sulfurospirillum deleyianum DSM 6946]
 gi|268616998|gb|ACZ11363.1| dihydroorotase, multifunctional complex type [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 425

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 122/379 (32%), Positives = 211/379 (55%), Gaps = 4/379 (1%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  G   +PG+ID  V       EY  ++ + S+ AVA G+T+   +P+  +  +++ + 
Sbjct: 43  DACGNYIMPGLIDMHVHFRDPGQEYKDDVISGSETAVASGVTT--CLPMANTFPINDNSS 100

Query: 111 IKYAL-EEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLL 169
           I  A+ ++ + + LI++ P   ++  + G  I EM  + E G V+F    + + D+ V+ 
Sbjct: 101 ITRAMIQKAKQRGLIDLLPIGAISQGLHGDRIVEMGDMIEAGAVAFSDDGLPVSDSSVMR 160

Query: 170 NSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQH 229
           ++++Y+   N+ V   + D  L  +GV++EG I+  LGL G+ S  E + ++RD+L+A+ 
Sbjct: 161 DALEYSRGFNSFVISHSEDCSLCRQGVMHEGEISTILGLKGMASEKEEIMISRDMLLAKL 220

Query: 230 TGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRS 289
           T GH H + +S   S+ LI+ AK      TC ++ ++   ++ ++  YN+  K+ PPLRS
Sbjct: 221 TKGHIHIAHVSSAWSLKLIELAKQEGINITCEVTPHHFSFSDKNLLSYNTHFKMSPPLRS 280

Query: 290 ETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQ 349
           E +  ++ EAL+ G +D+I +DH P H D K + F  A FG +GL+T++   L+L +   
Sbjct: 281 ENDIKAIREALKSGLVDVIATDHAPHHNDDKFVEFDNAPFGILGLQTLVPLTLKLVNEGI 340

Query: 350 ISLKKLIRALSTRPAQIFNLP-GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFD 408
           ISL++++   S  PA+I NL   G +  G  ADIA+ID N ++        S  KN+   
Sbjct: 341 ISLERMVELTSANPAKILNLKTKGKIAKGMLADIAIIDPNKEYIYDESINKSKSKNSPLF 400

Query: 409 KEFFTGKVVRTYISGKQVY 427
            E  TG  V T  +G+ VY
Sbjct: 401 GEKLTGAAVMTLKNGRVVY 419


>gi|154685966|ref|YP_001421127.1| hypothetical protein RBAM_015330 [Bacillus amyloliquefaciens FZB42]
 gi|154351817|gb|ABS73896.1| PyrC [Bacillus amyloliquefaciens FZB42]
          Length = 428

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 133/431 (30%), Positives = 211/431 (48%), Gaps = 17/431 (3%)

Query: 3   SFVLNNTRIIDP-----SRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVA 57
           S+++ N  +++      ++DI   G  I E G++ A   +           + D  GL  
Sbjct: 2   SYLIKNGWMLNEQGEKVAQDIRVTGEFISETGLLTAKDGET----------VIDAEGLFV 51

Query: 58  VPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEE 117
            PG++D  V       E  + I T SK A  GG T++  MP       D    +++    
Sbjct: 52  SPGLVDLHVHFREPGGEKKETIETGSKAAARGGFTTVAAMP-NTRPVPDTKEQMEWLQNR 110

Query: 118 IRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHM 177
           I+  S + V P A +T    G+E+++ + L E G  +F    + +    ++  +MK A  
Sbjct: 111 IKETSSVRVLPYASITIRQTGEEMTDFKALHEAGAFAFTDDGVGVQTAGMMYEAMKRAAS 170

Query: 178 LNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHAS 237
           +N  +     D+ L   G ++EG  +   GL GIPSI E V +ARD+L+A+  G HYH  
Sbjct: 171 MNKAIVAHCEDNSLIYGGSVHEGSFSKANGLNGIPSICEAVHIARDVLLAEAAGCHYHVC 230

Query: 238 VISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMV 297
            IS  +S+  ++ AK    + T  +S ++L+L + D+   ++  K+ PPLRS+ +R +++
Sbjct: 231 HISTKESVRAVRDAKKAGIRVTAEVSPHHLLLCDEDIPGLDTNFKMNPPLRSKEDREALI 290

Query: 298 EALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQISLKKLI 356
           E L  G ID I +DH P   + K      A FG +GLET        F    + +LK+L+
Sbjct: 291 EGLLDGTIDFIATDHAPHTEEEKNTDMKLAPFGIVGLETAFPLLYTHFVKNGEWTLKQLV 350

Query: 357 RALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
             ++ +P + F LP GTL  G  ADI LIDL  +  +  D   S  KNT F+K    G  
Sbjct: 351 DFMTVKPCEAFALPYGTLAPGAPADITLIDLEKEAAIDKDTFLSKGKNTPFNKMKCFGWP 410

Query: 417 VRTYISGKQVY 427
           V T  +GK  Y
Sbjct: 411 VATMAAGKLAY 421


>gi|330685510|gb|EGG97163.1| dihydroorotase [Staphylococcus epidermidis VCU121]
          Length = 425

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 125/382 (32%), Positives = 199/382 (52%), Gaps = 2/382 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  G +  PG +D  V L     E+ + I T +K A  GG T+I  MP       D    
Sbjct: 45  DAKGNLIAPGFVDVHVHLREPGGEHKETIETGTKAAARGGFTTICPMP-NTRPVPDSVEN 103

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           ++   E+I+  + I V P A +T+   GKE+ + + L ++G+ +F    + +    ++  
Sbjct: 104 VRALREKIKDSAQIRVLPYASITTRQAGKELVDFQALADEGVFAFTDDGVGVQQASMMYA 163

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +MK A  +   +     D+ L   G +++G  +  LG+ GIP++ E+V +ARD+L+A+ T
Sbjct: 164 AMKQAAKVKKPIVAHCEDNSLIYGGAMHKGKRSEELGIPGIPNVCESVQIARDVLLAEAT 223

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G HYH   +S  +S+ +I+ AK      T  ++ ++L+L ENDV   ++  K+ PPLRS 
Sbjct: 224 GCHYHVCHVSTKESVRVIRDAKKAGIHVTAEVTPHHLLLTENDVPGDDANYKMNPPLRST 283

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQ 349
            +R +++E L  G ID I +DH P   + K  P  +A FG +G ET        F     
Sbjct: 284 EDRDALLEGLLDGTIDCIATDHAPHAKEEKEQPMTKAPFGIVGSETAFPLLYTHFVRNGN 343

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            SLK+LI  L+ +PA IFNL  G L   + ADI +IDL  +  ++++D  S   NT F  
Sbjct: 344 WSLKQLIDYLTIKPATIFNLNYGKLHKDSYADITIIDLENEKEIRSEDFLSKADNTPFIG 403

Query: 410 EFFTGKVVRTYISGKQVYTLES 431
           E   G  V T + G+ V+  E 
Sbjct: 404 EKVYGHPVLTMVKGEVVFKEEK 425


>gi|239826547|ref|YP_002949171.1| dihydroorotase [Geobacillus sp. WCH70]
 gi|259547444|sp|C5D8P8|PYRC_GEOSW RecName: Full=Dihydroorotase; Short=DHOase
 gi|239806840|gb|ACS23905.1| dihydroorotase, multifunctional complex type [Geobacillus sp.
           WCH70]
          Length = 427

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 129/403 (32%), Positives = 208/403 (51%), Gaps = 5/403 (1%)

Query: 26  VENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKE 85
           +ENG I A G+  L+++     +  D  G +   G ID  V L     E  + I T +  
Sbjct: 24  IENGFITAIGSK-LHSEEADEVI--DVQGKLISAGFIDLHVHLREPGGEAKETIATGTLA 80

Query: 86  AVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMR 145
           A  GG T++  MP       D    +++  + IR  + ++V P A +T   +G E+++  
Sbjct: 81  AAKGGFTTVAAMP-NTRPVPDTKEQMEWLCKRIRETAYVHVLPYAAITVGQQGTELTDFA 139

Query: 146 LLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANY 205
            L+E G  +F    + +    ++  +MK A  L+  +     D+ L +RGV+++G  A+ 
Sbjct: 140 ALKEAGAFAFTDDGVGVQSAGMMYEAMKRAAALDMAIVAHCEDNTLANRGVVHDGEFAHR 199

Query: 206 LGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISIN 265
            GL GIPS+ E+V +ARD+L+A+ TG HYH   IS  +S+ +++ AK    + T  ++ +
Sbjct: 200 YGLYGIPSVCESVHIARDVLLAEATGCHYHVCHISTKESVRVVRDAKRAGIRVTAEVTPH 259

Query: 266 NLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFA 325
           +L+L + D+   ++  K+ PPLRS+ +R +++E L  G ID I +DH P     K     
Sbjct: 260 HLLLCDEDIPGPDANYKMNPPLRSKEDREALIEGLLDGTIDFIATDHAPHTEAEKQKGIN 319

Query: 326 EASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIAL 384
            A FG +GLET        L     ++LK+LI  L+ +PA+ F LP G L  G  ADI +
Sbjct: 320 AAPFGIVGLETAFPLLYTHLVETNILTLKQLIDLLTVKPAECFGLPLGKLAVGERADITI 379

Query: 385 IDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           IDL  +  +      S  KNT F      G  V T++ GK V+
Sbjct: 380 IDLETEEAIDPQTFVSRGKNTPFAGWKCKGWPVMTFVGGKLVW 422


>gi|147678146|ref|YP_001212361.1| dihydroorotase and related cyclic amidohydrolases [Pelotomaculum
           thermopropionicum SI]
 gi|189038404|sp|A5D1A4|PYRC_PELTS RecName: Full=Dihydroorotase; Short=DHOase
 gi|146274243|dbj|BAF59992.1| dihydroorotase and related cyclic amidohydrolases [Pelotomaculum
           thermopropionicum SI]
          Length = 427

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 132/425 (31%), Positives = 218/425 (51%), Gaps = 9/425 (2%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++    ++DP     E   + + +G I  AGA    A     A + D +G + VPG+ID
Sbjct: 3   LLIKGGTVVDPVAGKIEEKDVFIVDGKIARAGAHVNTA----GAEVLDASGKLVVPGLID 58

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E  + I T ++ A  GG TS+  MP   S   D    I + ++   +K  
Sbjct: 59  MHVHLREPGFEARETIYTGTRAAARGGFTSVACMP-NTSPVADNGAVISF-IKACGLKGA 116

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NVYP   +T   +G+E++EM  ++E G V+F    M + +  ++  +++YA ML  +V 
Sbjct: 117 VNVYPIGAITRGSKGEELAEMGDMKEAGAVAFSDDGMPVMNAGLMRRALQYAGMLGMVVI 176

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  L + GV++EG ++  LGL GIP+ +E V +ARD+L+A+ TG   H + +S   
Sbjct: 177 SHCEDKNLSAGGVMHEGYVSTMLGLKGIPASAEEVMVARDILLAEETGSRVHIAHVSTAG 236

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ LI+ AKA   + T  ++ ++  L +  V  Y++  KV PPLRS  +  ++ E L  G
Sbjct: 237 SVRLIREAKARGVRVTAEVAPHHFTLTDEAVLGYDTSTKVNPPLRSAGDVAAVREGLADG 296

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR--LFHGQQISLKKLIRALST 361
            ID+I +DH P   + K + +  A FG +GLET +       +  G    L+ +++ ++ 
Sbjct: 297 TIDVIATDHAPHTEEEKDVEYDLAPFGMVGLETAVGLVWTELVAAGVLTPLQAVVK-MTL 355

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            PA++  +P GTL+ G  ADI +ID +    V     +S  +NT F      G    T +
Sbjct: 356 NPARVLGIPKGTLEPGADADITIIDPDLSEPVDPARFASKGRNTPFRGRLLKGLPWATIV 415

Query: 422 SGKQV 426
            G+ V
Sbjct: 416 GGRVV 420


>gi|30249628|ref|NP_841698.1| dihydroorotase [Nitrosomonas europaea ATCC 19718]
 gi|30138991|emb|CAD85575.1| Dihydroorotase:Dihydroorotase multifunctional complex type
           [Nitrosomonas europaea ATCC 19718]
          Length = 423

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 137/424 (32%), Positives = 208/424 (49%), Gaps = 8/424 (1%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGA--DALNAKFPTSALIHDCTGLVAVPGIID 63
           + N R+IDP   +D    + +  G I++ G+  D  +      A      G++  PG++D
Sbjct: 5   IRNGRLIDPGSGMDRTDDLYLAEGKIVSIGSRPDGFHDDREIEA-----GGMIVCPGLVD 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L     EY   + +  + AVAGG+TS+   P      LDE   ++      R    
Sbjct: 60  LSARLREPGLEYMATLESELEAAVAGGVTSLACPP-DTDPPLDEPGLVEMLKHRARNLDQ 118

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             VYP   LT  ++G  ++EM  L + G V+F Q    I +  VL+ +M+YA      V 
Sbjct: 119 ARVYPVGALTQGLKGARLTEMVELHDAGCVAFSQVDAPIANLHVLMRAMQYAATFGFKVW 178

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   D  L + GV +EG IA  LGL  IP  +ET+ LA  L + + TG   H   IS  +
Sbjct: 179 LRPQDIHLANHGVAHEGEIATRLGLPAIPVCAETIALASILSLMKETGASVHLCRISSAE 238

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
             AL++ AK      TC +SIN++ L + D+  +++   ++PPLRS  +R ++   L  G
Sbjct: 239 GTALVRAAKRQGLPLTCDVSINHVHLTDMDIGFFDANCHLMPPLRSLADRDALCVGLMDG 298

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID I SDH P   D K LPFA+A  G+ GLE +L   L+     ++SL + +  ++  P
Sbjct: 299 TIDAICSDHAPVDEDAKSLPFAQAESGATGLELLLPLTLKWAVENRLSLPEALARITFHP 358

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+I  +  G L  G  AD+ + D +  W V   ++ S  KNT F      G+   T I G
Sbjct: 359 ARILGIETGQLAIGAVADLCIFDPDANWVVSHTELRSQGKNTPFLGMELYGRTRFTLIGG 418

Query: 424 KQVY 427
           + VY
Sbjct: 419 RIVY 422


>gi|312111743|ref|YP_003990059.1| dihydroorotase [Geobacillus sp. Y4.1MC1]
 gi|311216844|gb|ADP75448.1| dihydroorotase, multifunctional complex type [Geobacillus sp.
           Y4.1MC1]
          Length = 427

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 130/403 (32%), Positives = 207/403 (51%), Gaps = 5/403 (1%)

Query: 26  VENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKE 85
           +ENGII   G +  + +   +  I D  G     G+ID  V L     E  + I T +  
Sbjct: 24  IENGIITETGPELHSGE---ADEIIDVQGKFISAGLIDLHVHLREPGGEQKETIATGTLA 80

Query: 86  AVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMR 145
           A  GG T++  MP   +   D    +++  E IR  + + V P A +T   +G E+++  
Sbjct: 81  AAKGGFTTVAAMP-NTNPVPDTKEQMEWLHERIRETAYVRVLPYAAITMRQQGTELTDFA 139

Query: 146 LLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANY 205
            L++ G  +F    + +    ++  +MK A  LN  +     D+ L + G +++G  A  
Sbjct: 140 ALKQAGAFAFTDDGVGVQSAGMMYEAMKRAAALNMAIVAHCEDNTLTNGGAVHDGEFACR 199

Query: 206 LGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISIN 265
            GL GIPS+SE+V +ARD+L+A+ TG HYH   IS  +S+ +++ AK    + T  ++ +
Sbjct: 200 HGLNGIPSVSESVHIARDVLLAEATGCHYHVCHISTKESVRVVRDAKRAGIRVTAEVTPH 259

Query: 266 NLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFA 325
           +L+L + D+   ++  K+ PPLRS+ +R +++E L  G ID I +DH P     K     
Sbjct: 260 HLLLCDEDIPGPDANYKMNPPLRSKEDRAALIEGLLDGTIDFIATDHAPHTEAEKQKGMR 319

Query: 326 EASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIAL 384
            A FG +GLET        L     ++LK+LI  L+ +PA+ F LP G L  G  ADI +
Sbjct: 320 AAPFGIVGLETAFPLLYTHLVETNILTLKQLIDLLTVKPAECFGLPLGKLAVGARADITV 379

Query: 385 IDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           IDL+ + T+      S  KNT F      G  V T++ GK V+
Sbjct: 380 IDLDAEETIDPQTFVSKGKNTPFAGWTCKGWPVMTFVGGKLVW 422


>gi|254491008|ref|ZP_05104189.1| Amidohydrolase family, putative [Methylophaga thiooxidans DMS010]
 gi|224463521|gb|EEF79789.1| Amidohydrolase family, putative [Methylophaga thiooxydans DMS010]
          Length = 425

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 131/422 (31%), Positives = 223/422 (52%), Gaps = 4/422 (0%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDAR 65
           + N R+IDP+  +D    + +++G I+A G D     F    +I D  GL+  PG++D  
Sbjct: 5   IKNGRVIDPASQLDGRHDVFIKDGKIVAIG-DHFE-DFTADRVI-DANGLIVAPGLVDLN 61

Query: 66  VTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLIN 125
           V L     E++  I + +  A AGG+T++ + P      +D    ++   +  +      
Sbjct: 62  VRLREPGQEHTATILSETAAAAAGGVTTLCVPP-DTDPVIDNPAVVELIEDRAKKSGRSM 120

Query: 126 VYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALD 185
           V     +T N+E + ++EM  L++ G V+      +I ++ +L  +M YA  L+  V ++
Sbjct: 121 VLTAGAMTQNLECELLAEMARLKDAGCVAISNGLSTIKNSVILQRAMAYAATLDMTVFIN 180

Query: 186 THDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSI 245
             D +L S+G ++EG +++ LGL GIP  +ET+ ++RDL++ + TG   H   +S  +++
Sbjct: 181 PVDPWLQSQGCVHEGAVSSRLGLGGIPESAETIAVSRDLILIEQTGVRAHFHSLSSGKAV 240

Query: 246 ALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDI 305
            LI+ A+      T  +S ++L L+E+D+  Y++L  VLPP RS  +R  + + +  G I
Sbjct: 241 KLIRDAQNRGLPVTADVSAHHLHLSEHDLGNYDALSHVLPPFRSIRDREQLQQGVRDGII 300

Query: 306 DIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQ 365
             I S H P   D KL PFAE   G  GLET+L   ++L    +I L K + AL+  PA 
Sbjct: 301 AAISSHHQPLDKDDKLGPFAETQAGISGLETLLPLTMKLVEDDEIDLPKALAALTCNPAD 360

Query: 366 IFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQ 425
           I  +  G L+ G  AD+ LID + ++  +  +  S  KN+ F+   F  +V  T   G+ 
Sbjct: 361 ILGIDSGQLKVGAVADVCLIDPDSEYECQPLNFVSAGKNSPFEGWLFNHQVSHTIFHGRL 420

Query: 426 VY 427
           VY
Sbjct: 421 VY 422


>gi|187922876|ref|YP_001894518.1| dihydroorotase [Burkholderia phytofirmans PsJN]
 gi|187714070|gb|ACD15294.1| dihydroorotase, multifunctional complex type [Burkholderia
           phytofirmans PsJN]
          Length = 425

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 196/378 (51%), Gaps = 2/378 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  GL   PG++D    L     E+   + +    A+AGG+TS++  P      LDE   
Sbjct: 46  DARGLHIAPGLVDLSARLREPGYEHKATLESEMAAALAGGVTSLVCPP-DTDPTLDEPGL 104

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           ++      R  +  +VYP   LT  ++G+ I+EM  L E G + F Q+ M + DTQVL+ 
Sbjct: 105 VEMLKFRARNLNQAHVYPLGALTVGLKGQVITEMVELTEAGCIGFSQADMPVVDTQVLMR 164

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +++YA+     V L   D +LG  GV   G +A+ LGL G+P  +ET+ L     + + T
Sbjct: 165 ALQYANTYGYTVWLRPVDAYLGKGGVAASGALASRLGLSGVPVSAETIALHTIFELVRVT 224

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G   H S +S    IAL++ AKA     +C +++N++ L + D+  +++  ++ PPLR +
Sbjct: 225 GARVHLSHVSSAAGIALMRAAKAEGLPVSCDVTVNHVHLIDLDIGYFDAQFRLDPPLRQQ 284

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQI 350
            +R ++   L  G ID I SDHTP   D KLLPFAEA+ G+ GLE  LS  ++     ++
Sbjct: 285 RDREAIRAGLVDGTIDAICSDHTPVDDDEKLLPFAEATPGATGLELFLSLTVKWADEARV 344

Query: 351 SLKKLIRALSTRPAQIFNL-PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            L K +  ++T PA +  L   G +  G  AD+ + D N  W V+   + S   NT F  
Sbjct: 345 PLAKALNRITTAPADVLKLDAAGRVAVGGVADLCVFDRNAHWRVEPRALKSQGHNTPFLG 404

Query: 410 EFFTGKVVRTYISGKQVY 427
                +V  T +SG   +
Sbjct: 405 YELPARVRATIVSGHVAF 422


>gi|227824464|ref|ZP_03989296.1| dihydroorotase [Acidaminococcus sp. D21]
 gi|226904963|gb|EEH90881.1| dihydroorotase [Acidaminococcus sp. D21]
          Length = 430

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 122/420 (29%), Positives = 223/420 (53%), Gaps = 6/420 (1%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           ++    ++DPS+ +D V  I+VE+GII    AD++      +   +D +G V  PG ID 
Sbjct: 4   LIKKGHLVDPSQHLDAVKDILVEDGIIKRV-ADSIEEAADET---YDASGKVVAPGFIDL 59

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
              L     E  ++I + +  A  GGIT I  MP   +  +D    +    +    +  +
Sbjct: 60  HTHLREPGLEAKEDIVSGTMAAAHGGITRIACMP-NTNPVIDTSIVVSGIKKRAAEEGYV 118

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           +V     +T   +GKE+SEM  +  +G ++F      + D  ++L + +Y +  +  + +
Sbjct: 119 HVEVIGAITKGEKGKELSEMGDMAMRGAMAFSDDGHFVEDPLMMLKAARYVNSFDKALIV 178

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              +  +   G ++EG ++  LG+ GIPSI+E + +ARD +IA++TG H H + I+   +
Sbjct: 179 HAIEEHMNHSGYMHEGAVSARLGVPGIPSIAEDMAVARDAIIAEYTGTHVHIAHIASKGA 238

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + +++ AK      TC +++++L L +     +++  +V PPLRS     ++ +AL+ G 
Sbjct: 239 VDIVRQAKKRGVPITCEVTVHHLTLTDEACASFSTATRVSPPLRSRDHVEALRDALKDGT 298

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRP 363
           ID IV+DH P   + K + F  A  G  GLET +   L  L+H    ++ +++  +S RP
Sbjct: 299 IDAIVTDHAPHAPEEKDVEFRNAPNGFCGLETSVGVILTELYHTGLFTINEIVDKMSCRP 358

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A++F+L GGTL+ G++A+I ++DL+  W V +    +  K T F+ +   G+   T + G
Sbjct: 359 AELFHLDGGTLREGSSANITILDLDKDWVVDSSKFYTRGKVTPFNGKHCKGQAAATMVDG 418


>gi|302391675|ref|YP_003827495.1| dihydroorotase [Acetohalobium arabaticum DSM 5501]
 gi|302203752|gb|ADL12430.1| dihydroorotase [Acetohalobium arabaticum DSM 5501]
          Length = 429

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 127/427 (29%), Positives = 225/427 (52%), Gaps = 6/427 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M   ++ N +++ P+  ++E   I+V  G I   G+  L  K    A + D  G V  PG
Sbjct: 1   MKRLLIKNGKVVSPADGLNEELDILVAEGRIEKIGS-GLEDK---EAEVIDAIGKVVTPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +ID  V L     E+ + I T ++ A AGG TS+  MP   +  +D  + +   +++   
Sbjct: 57  LIDMHVHLREPGFEHKETIKTGTEAAAAGGFTSVACMP-NTNPVIDNSSIVDSVIKKAEF 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
           +  +N++P   +T  +EG+E+SE+  ++E GIV       ++ +++++  +++Y    + 
Sbjct: 116 EGKVNLFPIGSITKGLEGEELSEIGSMKEAGIVGISDDGETVMNSELMRLALEYVTAFDL 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V     D  L   GV+NEG  +   GL  IP+ +E + +ARD+ +A+ TG   H + +S
Sbjct: 176 PVISHAEDQVLSGDGVVNEGYYSTVTGLDPIPAAAEDIIVARDIRLAELTGAPLHIAHVS 235

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++ L++ AK    + T   + ++  L +  V  +++  KV PPLRSE +  ++ E L
Sbjct: 236 TKRAVELVRDAKERGLEVTAEATPHHFTLTDEAVISFDTNTKVNPPLRSEEDVAAIKEGL 295

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRAL 359
             G ID+I +DH P   + K + + +A FG  GLET L   +  L     ISL++ +  L
Sbjct: 296 ADGTIDVIATDHAPHAFEEKNVEYDDAPFGISGLETALPLVITELVKPGIISLEEAVEKL 355

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           ++ PA++ N   G L+ G+ ADI ++DL+ ++ V  D   S  KN+ FD    +G+   T
Sbjct: 356 TSNPAEVLNSDVGRLKEGSRADITVLDLDEEYEVDVDKFYSKGKNSPFDGFRLSGRPKVT 415

Query: 420 YISGKQV 426
            + GK V
Sbjct: 416 IVDGKVV 422


>gi|194014456|ref|ZP_03053073.1| dihydroorotase (DHOase) [Bacillus pumilus ATCC 7061]
 gi|194013482|gb|EDW23047.1| dihydroorotase (DHOase) [Bacillus pumilus ATCC 7061]
          Length = 428

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 127/378 (33%), Positives = 195/378 (51%), Gaps = 2/378 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  GL   PG+ID  V L     E  + I T SK A  GG T+I  MP       D    
Sbjct: 45  DAKGLFVSPGLIDLHVHLREPGGEKKETIETGSKAAARGGYTTIAAMP-NTRPVPDTKEQ 103

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +++ +  I   S + V P A +T+   G+E+++   L+E G  +F    + I    ++  
Sbjct: 104 MEWLMNRIEETSSVRVLPYASITTRQIGEEMTDFAALKEAGAFAFTDDGVGIQTAGMMYE 163

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +MK A  L+  +     D+ L   G ++EG  +    L GIPSI E+V +ARD+L+A+  
Sbjct: 164 AMKKAASLDQAIVAHCEDNSLIYGGCVHEGEFSKANELNGIPSICESVHIARDVLLAEAA 223

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
             HYH   IS  +S+ +++ AK    + T  +S ++L+L + D+   ++  K+ PPLR +
Sbjct: 224 NCHYHVCHISTKESVRVVRDAKKAGIRVTAEVSPHHLLLCDADIPGLDTNYKMNPPLRGK 283

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQ 349
            +R +++E L  G ID I +DH P   + K      A FG +GLET       R     +
Sbjct: 284 EDREALIEGLLDGTIDFIATDHAPHTEEEKNETMQRAPFGIVGLETAFPLLYTRFVKTGE 343

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            +LK+L+  ++ +PA+ F+LP G L+ G  ADI LIDLN +  +      S  +NT FDK
Sbjct: 344 WTLKELVDYMTIKPAEAFSLPYGKLEEGQTADITLIDLNKEMAIDKKSFLSKGQNTPFDK 403

Query: 410 EFFTGKVVRTYISGKQVY 427
              +G  V T  SGK VY
Sbjct: 404 LTVSGWPVMTLASGKVVY 421


>gi|260220098|emb|CBA27297.1| Dihydroorotase-like protein [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 431

 Score =  206 bits (524), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 137/435 (31%), Positives = 218/435 (50%), Gaps = 18/435 (4%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++   R+IDP+   D V  + + +G ILA G     A F    +I +  G +  PG++D
Sbjct: 3   ILIQGGRVIDPASGTDTVADVAISSGRILAIGT--APAGFAPQTII-NAQGCIVAPGLVD 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFI---KYALEEIRV 120
             V L     E+   + +    AVAGG+TS++  P      LDE   +   +Y  E +  
Sbjct: 60  LSVRLREPGHEHEGMLASEMAAAVAGGVTSVVCPP-DTEPVLDEAGLVEMLRYRAERLHQ 118

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
                V+P   LT N++G+ ++EM  L + G V+F Q+ + + +TQV   +++YA     
Sbjct: 119 A---RVFPLGALTRNLQGEVLTEMLQLTQAGCVAFSQAEVPLLNTQVTQRALQYASTFGY 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V L   + +LG +GV   G +A  +GL G+P  +ET+ L     + + T    H   IS
Sbjct: 176 TVWLRPQEAYLG-KGVAASGPLATRMGLSGVPVAAETIALHTIFELVRATKARVHLCRIS 234

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
               + L++ AKA     TC +SIN+L L + D+  ++S  ++ PPLR + +R ++  AL
Sbjct: 235 SAAGVELVRQAKAEGLPVTCDVSINSLHLTDVDIGYFDSRMRLNPPLRQQRDRDALRAAL 294

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID +VSDH P   D K LPFAEA  G+ GLE +LS AL+      + + + +  ++
Sbjct: 295 ADGTIDALVSDHNPVSADEKTLPFAEAEPGATGLELLLSLALKWAQESGLGVAEAVATVT 354

Query: 361 TRPAQI-------FNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFT 413
           +R A +       F    G L  G AADI + D    W V+   + S  ++T F      
Sbjct: 355 SRSALVLGGALGTFAASAGRLTAGGAADICVFDPAAHWVVEPSALVSQGQHTPFGGYELP 414

Query: 414 GKVVRTYISGKQVYT 428
           G+V  T + G+  YT
Sbjct: 415 GRVKATLVGGRVAYT 429


>gi|296122516|ref|YP_003630294.1| dihydroorotase [Planctomyces limnophilus DSM 3776]
 gi|296014856|gb|ADG68095.1| dihydroorotase, multifunctional complex type [Planctomyces
           limnophilus DSM 3776]
          Length = 425

 Score =  206 bits (524), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 122/431 (28%), Positives = 219/431 (50%), Gaps = 7/431 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M + ++   R+IDP+  +D++  +++E+G+I       +    P +  +    G++  PG
Sbjct: 1   MATMLIQGGRVIDPANQLDQLLNLVIEDGVIAE-----ITTGIPRTDEVIMAQGMIVSPG 55

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D  V L     E  +   + +K A+AGG T+I  +P   +  +D     ++ + +   
Sbjct: 56  LVDLHVALRDPGGEEDEGTASGTKAALAGGFTTIAALP-DTNPVVDNRASAEFVILQAER 114

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
                V P   +T N +G+E++++  L   G   F  +  ++   +++  +++YA MLN 
Sbjct: 115 AGYCRVVPLGAITRNHQGEELADLGQLAAGGAGGFTDANRAVQSAEIMRRALEYARMLNR 174

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +     D  L + G+++EG  +  LGL GIP+ +E + + RD+ +A+ TGGH H   IS
Sbjct: 175 PIFAVPQDATLSAGGLMHEGYYSTVLGLRGIPAAAEEIIVGRDIALAELTGGHVHLMNIS 234

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              S+  +K AK    + T  ++ ++L + +  +  Y++  KVLPPLRS+    +++E L
Sbjct: 235 TRNSVEELKRAKGMGIRVTADVTPHHLAMTDASLVTYDTNLKVLPPLRSQEHVDALIEGL 294

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLS-AALRLFHGQQISLKKLIRAL 359
             G ID I SDH P   + K   F +  FG   +ET L+  A  L  G  +    L+R L
Sbjct: 295 RDGTIDSISSDHRPFASEKKSREFDQVPFGVSSIETALAVVATVLVDGGLLDWPDLLRLL 354

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           +  PA+I  +  GTL  G  AD+ALID    W V      S   NT F  +    +V++T
Sbjct: 355 TVNPAKILGIEAGTLDIGRPADLALIDPAAHWIVDTRQFYSRGHNTPFKGKTLRSRVMKT 414

Query: 420 YISGKQVYTLE 430
            ++G+  ++ +
Sbjct: 415 IVAGEVRFSRQ 425


>gi|139439776|ref|ZP_01773167.1| Hypothetical protein COLAER_02198 [Collinsella aerofaciens ATCC
           25986]
 gi|133774926|gb|EBA38746.1| Hypothetical protein COLAER_02198 [Collinsella aerofaciens ATCC
           25986]
          Length = 429

 Score =  206 bits (524), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 124/425 (29%), Positives = 208/425 (48%), Gaps = 7/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + +L N  ++DPS ++D V  +++++  I   G +         A + D +G   VPG++
Sbjct: 2   ALLLKNAHVVDPSVELDGVVDVLIDSDKIAEVGENLA----VEGAEVRDLSGKYLVPGLV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     E  ++I + ++ A  GG T +  MP       D  T +++         
Sbjct: 58  DMHVHLREPGYEVKEDIESGTRAAAKGGFTGVCAMP-NTDPVTDNGTVVEFVKSRAAEVG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              VYP+  +T  ++G+ +SEM  +   G V+F      +    +L   M Y  M   + 
Sbjct: 117 HCRVYPSGAMTRGLKGEAMSEMGDMVAHGAVAFTDDGRGVQGAGMLRRCMDYGKMFGKVF 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G INEG ++  L L G P+  E + +ARD+ IA+ TG   H   IS  
Sbjct: 177 MSHCQDEDLVGHGQINEGKVSTRLALEGWPAAGEELQIARDIEIAKLTGAKLHIQHISTA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDV-EMYNSLRKVLPPLRSETERMSMVEALE 301
             + +++  KA   + TC  + +++ L END+ E YN+  KV PPLR+E +  ++ + + 
Sbjct: 237 HGLEIVRAGKAAGVQVTCEATPHHMFLTENDLDETYNTSLKVNPPLRTEEDAEAIRQGVI 296

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALS 360
            G +D IV+DH P     K   F  A FG IGLET LS  L  L +  ++S+ +++  ++
Sbjct: 297 DGTVDAIVTDHAPHTPWEKAREFELAPFGMIGLETSLSLVLTELVNTGKMSMGRMVELMA 356

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
            +P +I  L    ++ G+ AD+ + D +  WTV  D   S  +N+ F     TG+    +
Sbjct: 357 IKPREILGLDQVQVKAGSVADLTVFDPSATWTVGEDGYESRAENSGFAGRTLTGRATDVF 416

Query: 421 ISGKQ 425
           + GKQ
Sbjct: 417 VGGKQ 421


>gi|251797848|ref|YP_003012579.1| dihydroorotase [Paenibacillus sp. JDR-2]
 gi|247545474|gb|ACT02493.1| dihydroorotase, multifunctional complex type [Paenibacillus sp.
           JDR-2]
          Length = 430

 Score =  206 bits (524), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 120/383 (31%), Positives = 199/383 (51%), Gaps = 2/383 (0%)

Query: 46  SALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFL 105
           SA + D  G +   G ID  V L     EY ++I T ++ A  GG T+I  MP      +
Sbjct: 44  SAEVIDAAGKLVSAGFIDMHVHLRDPGFEYKEDIATGTRSAAKGGFTTIACMP-NTRPAV 102

Query: 106 DEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDT 165
           D    +KY L++   + ++ V P A +T N  G+E+++   L+E G + F    + +   
Sbjct: 103 DTPETVKYILDKNAAEGVVKVLPYAAITKNQLGRELTDFAALKEAGAIGFTDDGVGVQSA 162

Query: 166 QVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLL 225
           Q++ ++M  A  +N  +     D+ L     ++EG  +   GL GIP+ SE + + RD+L
Sbjct: 163 QMMKDAMALAESMNMPIIAHCEDNTLVEGLYVSEGSFSRKHGLKGIPNESEAIHVGRDVL 222

Query: 226 IAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLP 285
           +++ TG HYH   +S  QS+ LI+ AK    + T  +  ++L+L++ D+  ++S  K+ P
Sbjct: 223 LSEATGAHYHVCHVSTEQSVRLIRLAKQIGVRVTAEVCPHHLVLSDEDIPGFDSNWKMNP 282

Query: 286 PLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF 345
           PLR+  +  +++EALE G ID+IV+DH P   + K      A FG +G ET        F
Sbjct: 283 PLRTPRDVEAVIEALEDGTIDMIVTDHAPHSAEEKARDMQLAPFGIVGFETAFPLLYTKF 342

Query: 346 -HGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKN 404
               + +L  L+  ++  PA++F LP G ++ G  AD+ ++DL+ +  V     +S   N
Sbjct: 343 VQTGKWTLGFLLDRMTADPARVFGLPTGRIKAGAPADLTIVDLDNERAVDPSTFASKSNN 402

Query: 405 TVFDKEFFTGKVVRTYISGKQVY 427
           T F      G  V T + GK VY
Sbjct: 403 TPFGGWKLQGWPVATIVDGKIVY 425


>gi|323706440|ref|ZP_08118002.1| dihydroorotase, multifunctional complex type [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534225|gb|EGB24014.1| dihydroorotase, multifunctional complex type [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 431

 Score =  206 bits (523), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 136/426 (31%), Positives = 218/426 (51%), Gaps = 14/426 (3%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGAD---ALNAKFPTSALIHDCTGLVAVP 59
             V+ +  +ID     +E   I++ENG I   G D   +LN      A+  D  G    P
Sbjct: 2   KLVIKDGILID-GEGFNEKADILIENGKI--KGIDKRISLN-----DAISIDAKGKHVFP 53

Query: 60  GIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIR 119
           G ID    L     E  + I T +  AVAGG T++  MP   +  +D    ++Y      
Sbjct: 54  GFIDMHTHLRQPGFEEKETIKTGTHAAVAGGYTTVACMP-NTNPVIDNEVVVEYIKSIAE 112

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
            +    V P   +T  M G+EISEM  L++ G+V+       I ++ ++   M Y  M +
Sbjct: 113 REGYCKVIPIGAMTKGMLGEEISEMAKLKDVGVVALSDDGFPIMNSGLMKRIMTYGSMYD 172

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
            ++     D  L   GV+N GII+  +GL GIP  +E V LAR++++A+ TG   H + +
Sbjct: 173 LLMITHCEDKMLSGEGVMNNGIISTKIGLRGIPHEAEEVMLARNIILAKSTGARLHVAHV 232

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           S   S+ LI+ AKA     T  ++ +NL L E+ V+ +++  K  PPLR+  +  +++E 
Sbjct: 233 STKDSVELIRRAKADGVNITAEVTPHNLCLTEDIVDGFDTNTKAYPPLRTREDVNALIEG 292

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRA 358
           L+ G ID+I +DH P   D K +P+  A+FG  G+E   S     L     I++  L++ 
Sbjct: 293 LKDGTIDVIATDHAPHTKDDKKVPYEIAAFGISGIEIAFSVVYTYLVKNGLIAIDDLVKH 352

Query: 359 LSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           +ST P+++  L  G  + G  ADI +IDL  ++TV AD+  S  KN+ F+ +   G V  
Sbjct: 353 MSTEPSKLLKLTHG-FKIGNDADITIIDLAKEFTVDADNFKSKGKNSPFNGQKLYGMVEY 411

Query: 419 TYISGK 424
           T ++G+
Sbjct: 412 TIVNGE 417


>gi|315651736|ref|ZP_07904741.1| dihydroorotase [Eubacterium saburreum DSM 3986]
 gi|315485991|gb|EFU76368.1| dihydroorotase [Eubacterium saburreum DSM 3986]
          Length = 432

 Score =  206 bits (523), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 133/430 (30%), Positives = 218/430 (50%), Gaps = 11/430 (2%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGAD-ALNAKFPTSA-----LIHDCTGLVAV 58
           +L N R++DP    D++  I++  G +     +  L+A     A      ++DC+GL A 
Sbjct: 3   MLKNVRLLDPQTRTDDIRDILISEGKVRKIERELYLDATLMARANGERLKVYDCSGLCAA 62

Query: 59  PGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEI 118
           PG +D  V L     EY ++I + ++ A  GG T+I+ M    +  +D    +   L++ 
Sbjct: 63  PGFVDVHVHLREPGFEYKEDIESGARAAAKGGFTTIVAMA-NTNPPIDTPQRVFEVLKKG 121

Query: 119 RVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHML 178
           R K+LINV   AC+T  M+G+E ++M+ L+E G + F      + D  +    M+YA  +
Sbjct: 122 R-KALINVKTCACITKGMKGEEPADMKELREAGAIGFTDDGRPLLDENLAREVMRYARSI 180

Query: 179 NAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASV 238
              ++    D        IN G  ++ + + G   ++E   +ARD  +A+ TG       
Sbjct: 181 KMPLSFHEEDPAYIKENGINHGYASDEMHIYGSDRMAEISMVARDCKLARETGATISIQH 240

Query: 239 ISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVE 298
           IS  +S+ L++ AK    +     + ++  L + DV  Y +L K+ PPLR E +RM+++E
Sbjct: 241 ISAKESVELVRKAKKMGLRVFAEATPHHFSLIDKDVIKYGTLAKMNPPLREEEDRMAIIE 300

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLS-AALRLFHGQQISLKKLIR 357
            L  G IDII +DH P   + K   F +A  G IGLET  S   + L     +SL +LI 
Sbjct: 301 GLRDGTIDIIATDHAPHSKEEKDRDFVDAPSGIIGLETSFSLGIMNLVKPGYLSLMELIN 360

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            +S +PA+++N+  G L+ G  ADI + D+N +W  K D   S   N+ +  +   GK+V
Sbjct: 361 KMSYQPAKLYNMDRGVLREGETADIVVFDVNSEW--KYDKSESKSCNSPWLGDTLQGKIV 418

Query: 418 RTYISGKQVY 427
            T   G  VY
Sbjct: 419 YTICHGNVVY 428


>gi|297617025|ref|YP_003702184.1| dihydroorotase [Syntrophothermus lipocalidus DSM 12680]
 gi|297144862|gb|ADI01619.1| dihydroorotase, multifunctional complex type [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 429

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 133/424 (31%), Positives = 210/424 (49%), Gaps = 6/424 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++   RIIDP   ID VG I+VE+G++    + A+  K    A + D  G +  PG ID
Sbjct: 3   LMIKGGRIIDPVNSIDLVGDILVEDGLVQEI-SPAIRTK---KAEVLDANGKIVCPGFID 58

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     EY ++I + ++ A  GG T++  MP   +  +D      +     R   +
Sbjct: 59  MHVHLREPGFEYKEDIASGTRAAAVGGFTTVCCMP-NTNPVIDNGAVAAFVCSRARQVGV 117

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
           +NV+P   +T   +G EISEM  L + G V+       + + +++  +++Y+ M +  V 
Sbjct: 118 VNVFPIGSITKKQQGTEISEMADLVQAGCVAVSDDGRPVMNAEIMRRALEYSRMFDIPVI 177

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
               D  L   G ++EG  +   GL GIP+ +E V +ARD+L+A+ T    H + IS   
Sbjct: 178 SHCEDLDLSEDGQMHEGFYSTLYGLKGIPAAAEEVMVARDILLAETTKSRVHFAHISTRG 237

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ LIK AK      TC ++ ++L L +  V  Y+   KV PPLRS  +  ++ + L +G
Sbjct: 238 SVELIKMAKRKGLAVTCEVTPHHLTLTDEMVRDYDPDTKVNPPLRSREDVEALRQGLIEG 297

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALSTR 362
            ID IV+DH P  ++ K   +  AS G  GLET ++  L  L +   + +  ++R +S  
Sbjct: 298 VIDCIVTDHAPHEVEAKDCEYNLASCGISGLETAVAVILNDLVNSGIVDISDVVRLMSVN 357

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA I  L  G L  G  ADI ++DL  +  V+     S  KN  F      G    T + 
Sbjct: 358 PANILKLDRGNLAPGKVADITILDLELERRVEPSRFLSKGKNNPFKGRVLKGWPWATIVR 417

Query: 423 GKQV 426
           G+ V
Sbjct: 418 GRLV 421


>gi|295675692|ref|YP_003604216.1| dihydroorotase, multifunctional complex type [Burkholderia sp.
           CCGE1002]
 gi|295435535|gb|ADG14705.1| dihydroorotase, multifunctional complex type [Burkholderia sp.
           CCGE1002]
          Length = 426

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 134/418 (32%), Positives = 209/418 (50%), Gaps = 5/418 (1%)

Query: 11  IIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTG 70
           +IDP+   ++   I +E G I A G     A F     + D  GL   PG++D    L  
Sbjct: 10  LIDPAAGTEQQQDIFIEAGKIAALGQ--APAGFRAERTL-DAHGLSIAPGLVDLCARLRE 66

Query: 71  SPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTA 130
              E+   + +    A+AGG+TS++  P      LDE   ++      R  +  +VYP  
Sbjct: 67  PGYEHKATLGSEMAAALAGGVTSLVCPP-DTDPTLDEPGLVEMLKFRARNLNKAHVYPLG 125

Query: 131 CLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHF 190
            LT  ++G+ I+EM  L E G V F Q+   I DTQVL+ +++YA      V L   D +
Sbjct: 126 ALTVGLKGQVITEMVQLTEAGCVGFSQADTPIVDTQVLMRALQYAKTYGFTVWLRPVDAY 185

Query: 191 LGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKH 250
           LG  GV   G +A+ LGL G+P  +ET+ L     + + TG   H S +S    +AL++ 
Sbjct: 186 LGKGGVAASGALASRLGLSGVPVSAETIALHTIFELVRVTGARVHVSHVSSAAGVALVRA 245

Query: 251 AKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVS 310
           AKA     +C +++N++ L + D+  +++  ++ PPLR + +R ++   L  G ID I S
Sbjct: 246 AKAEGLPVSCDVTVNHVHLIDLDIGYFDAQFRLDPPLRQQRDREAIRAGLVDGTIDAICS 305

Query: 311 DHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNL- 369
            HTP   D KLLPFAEA+ G+ GLE  LS  ++      + L   +  ++  PAQ+  L 
Sbjct: 306 AHTPVDDDEKLLPFAEATPGATGLELFLSLTVKWADEAGVPLASALNRITAAPAQVLGLE 365

Query: 370 PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
             G +  G  AD+ + D +  W V+   + S   NT F       +V  T +SG+  Y
Sbjct: 366 AAGRIAVGAVADLCVFDRHAHWRVEPRALKSQGHNTPFLGYELPAQVRATVVSGQLAY 423


>gi|312885513|ref|ZP_07745151.1| dihydroorotase, multifunctional complex type [Mucilaginibacter
           paludis DSM 18603]
 gi|311301981|gb|EFQ79012.1| dihydroorotase, multifunctional complex type [Mucilaginibacter
           paludis DSM 18603]
          Length = 417

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 122/418 (29%), Positives = 224/418 (53%), Gaps = 12/418 (2%)

Query: 3   SFVLNNTRIIDPSRDIDEVGA-IIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGI 61
           + ++ +  I DP+   ++  A I++E+GII+    D       + A + D  G    PG 
Sbjct: 2   NLLIKSGTITDPNSPFNQQTADILIEDGIIVKIAKD-----IQSDAEVFDALGKSVSPGF 56

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
            D    +     E  +++ + SK A AGG T + LMP  +   +   + +++ + + +  
Sbjct: 57  FDLNCNIGELGLETKEDLQSGSKAAAAGGFTGLALMPNTLPP-VHSKSEVEFIVNKAK-G 114

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
           +L++++P   ++   EGK+++EM  + + G  +F      + D  ++  ++ YA   N +
Sbjct: 115 NLVDIFPLGTISHKCEGKDMAEMYDMYQSGAKAFTDGKYPVQDAGLMERALLYAQGFNGL 174

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V     D  +  +  ++EG I+  LG+ GIPS++E + +ARDL +A++TG + H + +S 
Sbjct: 175 VFSYPEDKAIAGKAKVHEGEISTLLGMKGIPSLAEELMIARDLYLAEYTGSNIHFTTVST 234

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
            +S+ LI+ AK+   K TC +++++L+L   D+  ++SL KV PPLR+  +  +++E L+
Sbjct: 235 ARSVDLIRQAKSKGLKVTCDVAVHHLVLTHRDLLGFDSLYKVKPPLRTSEDVDALIEGLK 294

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID IVS HTP  ++ K + F  A FG IGL+T LS AL+      + ++ L+  L+ 
Sbjct: 295 DGTIDAIVSQHTPHEIEFKDVEFEVAEFGIIGLQTTLSLALQ----AGLPVELLVEKLAI 350

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
            P +I NL    +  G  A++ + D   +W     +  S   N+ F  +  TGKV+ T
Sbjct: 351 NPRKILNLEVPAIGEGQQANLVVFDSQQEWAYTKQNNQSKSYNSPFIGKQLTGKVLLT 408


>gi|261885996|ref|ZP_06010035.1| dihydroorotase [Campylobacter fetus subsp. venerealis str. Azul-94]
          Length = 426

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 130/413 (31%), Positives = 217/413 (52%), Gaps = 8/413 (1%)

Query: 22  GAIIVENGI----ILAAGA--DALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEY 75
           G II +NG     IL  G    ++ A+ P + L+ D T  + +PG+ID  V       EY
Sbjct: 8   GTIINQNGTLKANILIDGEMIKSITAEEPKADLVIDATNKLVMPGLIDMHVHFRDPGLEY 67

Query: 76  SKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSN 135
             +I T S  AVAGG+T+   M    +   D     +  + + + + LI++ P   +T  
Sbjct: 68  KDDIITGSMSAVAGGVTTACPMA-NTNPVNDNAVVTRDMIAKAKKRGLIDLLPIGAITKG 126

Query: 136 MEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRG 195
           MEGK I+EM  + E G V+F    + +  + V+  ++ Y+    + +   + D  L   G
Sbjct: 127 MEGKGITEMGDMSEAGCVAFSDDGLPVSSSDVMRAALLYSAFHKSFIINHSQDCSLCRGG 186

Query: 196 VINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHN 255
            +NEG ++  LG+ G+P   E + ++RD+L+A+ TGGH H + +S   S+ LI+ AK   
Sbjct: 187 HMNEGKMSMLLGIKGMPREQEEIMISRDMLLAKLTGGHIHVAHVSSAYSLKLIEQAKNEG 246

Query: 256 TKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPR 315
              TC ++ ++   +E+++  Y++  K+ PPLR+  +  +M   L+ G ID+I +DH P 
Sbjct: 247 VNITCEVTPHHFTFSEDELINYDTNFKMSPPLRTNNDVEAMRNGLKNGLIDVICTDHAPH 306

Query: 316 HMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPG-GTL 374
           H D K L F +A FG +GL+T++   L L     I  +++++  S  PA+I NL   G +
Sbjct: 307 HTDEKFLEFDKAPFGILGLQTLVPLTLNLVREGVIDYEQMVKLTSFNPAKILNLKNKGAI 366

Query: 375 QTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           + G  ADIA+ID + ++    +   S  KN+    +   G  V T  SGK V+
Sbjct: 367 KEGFLADIAIIDPDLEYIYDENLNKSKSKNSPLLGKKLKGASVVTIKSGKVVF 419


>gi|229541177|ref|ZP_04430237.1| dihydroorotase, multifunctional complex type [Bacillus coagulans
           36D1]
 gi|229325597|gb|EEN91272.1| dihydroorotase, multifunctional complex type [Bacillus coagulans
           36D1]
          Length = 428

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 130/408 (31%), Positives = 209/408 (51%), Gaps = 6/408 (1%)

Query: 24  IIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLS 83
           I +++G I   G++   A       ++D TGL  +PG +D  V L     E  + I T +
Sbjct: 22  IRIKDGKIAETGSELKEA----GEQVYDATGLTVLPGFVDLHVHLREPGFEQKETIRTGT 77

Query: 84  KEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISE 143
             A  GG T++  MP       D    +    E+I   +++ V P A +T + +G E+ +
Sbjct: 78  MAAAKGGFTTVAAMP-NTKPVTDRPARLLSLKEKISRDAVVRVLPYAAITLDEKGGELVD 136

Query: 144 MRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIA 203
              L+  G  +F    + + +   +L +M+ A  L   V     D+ L   G +++G  A
Sbjct: 137 FAGLKAAGAFAFTDDGVGVQEAGQMLAAMEQAKALGMAVVAHCEDNSLIRGGCVHDGSFA 196

Query: 204 NYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGIS 263
              GL GIPS+ E+V +ARD+L+A+HTG HYH   IS  +S+ +++ AK      T  ++
Sbjct: 197 AAHGLKGIPSVCESVQIARDVLLAEHTGCHYHVCHISTKESVRVVRDAKRAGIPVTAEVT 256

Query: 264 INNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLP 323
            ++L+L+E+D+   ++  K+ PPLRS+ +R +++E L  G ID I +DH P   + K   
Sbjct: 257 PHHLLLSEDDIPGPDANWKMNPPLRSKRDRDALIEGLLDGTIDFIATDHAPHTAEEKAKG 316

Query: 324 FAEASFGSIGLETMLSAALRLFHGQQI-SLKKLIRALSTRPAQIFNLPGGTLQTGTAADI 382
             +A FG  G ET        F    I +LK+L+  ++ +PA +F LP GTL+TG  ADI
Sbjct: 317 IEQAPFGITGFETAFPLLYTHFVETGIFTLKQLVDWMTIKPASVFGLPYGTLKTGAPADI 376

Query: 383 ALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVYTLE 430
             ++L  + T+  D   S  KNT F      G    T+ SGK V+  E
Sbjct: 377 TAVNLAEEKTIDPDRFLSKGKNTPFLGCVCKGFPQATWGSGKLVWEKE 424


>gi|229815182|ref|ZP_04445518.1| hypothetical protein COLINT_02228 [Collinsella intestinalis DSM
           13280]
 gi|229809192|gb|EEP44958.1| hypothetical protein COLINT_02228 [Collinsella intestinalis DSM
           13280]
          Length = 429

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 125/425 (29%), Positives = 208/425 (48%), Gaps = 7/425 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + +L N  ++DPS ++D    ++VE+  I A G +  +      A + D +G   VPG++
Sbjct: 2   ALLLKNAHVVDPSVELDGRVDVLVEDDKIAAVGENLSH----EGAEVVDLSGKYLVPGLV 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     E   +I + +  A  GG T +  MP   +   D    ++Y       K 
Sbjct: 58  DMHVHLREPGFEAKGDIESETAAAAKGGFTGVCSMP-NTNPVTDNGVVVEYIKSVAAAKG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              VYP+  +T  ++G+ ISEM  + E G V+F      I    +L  +M Y  M   + 
Sbjct: 117 HCRVYPSGAMTRGLKGEIISEMGNMVEHGCVAFTDDGHGIQGAGMLRRAMDYGQMFGKVF 176

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D+ L   G INEG ++  LGL+G P+  E + + RD++IA+ TG   H   IS  
Sbjct: 177 MSHCQDNDLVGDGQINEGAVSTRLGLLGWPAEGEELQIMRDIMIAELTGAKLHIQHISTA 236

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVE-MYNSLRKVLPPLRSETERMSMVEALE 301
           + + +++ AKA     TC  + +++ L E+ ++  YN+  KV PPLR+  +  +++  + 
Sbjct: 237 KGLEMVRAAKAKGLPVTCEATPHHMFLTEDAIDGTYNTCFKVNPPLRTAADAEALIAGVI 296

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALS 360
            G +D I +DH P     K   F  A FG  GLET L   +  L    +I+  +++  ++
Sbjct: 297 DGTVDTIATDHAPHSDWEKSREFELAPFGMTGLETALGLVITNLVKTGKITFGRMVELMA 356

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T P +I  L    +  G+ AD+ + D +  WTV  DD +S  KN+ F     TG+    +
Sbjct: 357 TEPRKILGLDQVKIAEGSVADLTVFDADQVWTVSEDDFASHAKNSGFKGVELTGRATDVF 416

Query: 421 ISGKQ 425
           + GK+
Sbjct: 417 VGGKR 421


>gi|304404038|ref|ZP_07385700.1| dihydroorotase, multifunctional complex type [Paenibacillus
           curdlanolyticus YK9]
 gi|304347016|gb|EFM12848.1| dihydroorotase, multifunctional complex type [Paenibacillus
           curdlanolyticus YK9]
          Length = 429

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 123/380 (32%), Positives = 198/380 (52%), Gaps = 3/380 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  G +   G ID  V L     EY ++I T ++ A AGG T+I  MP       D    
Sbjct: 49  DAAGKLVSAGFIDMHVHLRDPGFEYKEDIATGTRSAAAGGFTTIACMP-NTRPVTDTAET 107

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +KY L++   + ++ V P A +T N  G+E+++   L+E G + F    + + + Q++ N
Sbjct: 108 VKYILDKAANEGIVRVLPYAAITKNELGRELTDFAALKEAGAIGFTDDGVGVQNAQMMKN 167

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +M  A  L+  V     D  L      +EG  A   GL GIP+ SE + + RD L+A+ T
Sbjct: 168 AMALAKSLDMPVIAHCEDDSLVEGAWASEGNFAKKHGLKGIPNESEAIHVGRDALLAEAT 227

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVE-MYNSLRKVLPPLRS 289
           G HYH   +S  QS+ LI+ AK+     T  +  ++L+L++ D+  + ++  K+ PPLR+
Sbjct: 228 GVHYHVCHVSTEQSVRLIRLAKSIGVSITAEVCPHHLVLSDEDIPGLDDANWKMNPPLRT 287

Query: 290 ETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQ 348
             +  +++E LE G IDI+V+DH P   + K      A FG +G ET        F    
Sbjct: 288 PRDVQAVIEGLEDGTIDIVVTDHAPHSAEEKARGPQLAPFGIVGFETAFPLLYTKFVRTG 347

Query: 349 QISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFD 408
           Q +L  L++ +++ PA++FNLP G L+ G  AD+ ++DL  +  V+ +  +S   NT F 
Sbjct: 348 QWTLGFLLKRMTSDPARVFNLPTGRLEVGAPADLTIVDLENEREVRPETFASKSNNTPFG 407

Query: 409 KEFFTGKVVRTYISGKQVYT 428
                G    T ++GK V+T
Sbjct: 408 GWKLYGWPTATVVNGKLVWT 427


>gi|328951756|ref|YP_004369090.1| dihydroorotase, multifunctional complex type [Desulfobacca
           acetoxidans DSM 11109]
 gi|328452080|gb|AEB07909.1| dihydroorotase, multifunctional complex type [Desulfobacca
           acetoxidans DSM 11109]
          Length = 427

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 132/427 (30%), Positives = 220/427 (51%), Gaps = 3/427 (0%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            +L    +IDP++ ++    I++E+G ++A  A    A+      + +    V  PG+ID
Sbjct: 3   LLLRGGLVIDPAQALEAARDILIEDGRLMALVAPGSVAE--AGHRVIEAADFVVCPGLID 60

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L     EY + I T  + A AGG T++  MP       D  T  ++ LE+      
Sbjct: 61  MHTHLREPGQEYKETIATGGQAAAAGGFTAVACMP-NTIPVNDSATVTRFILEKAAQAKG 119

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             VYP A ++    G+ ++E   L+  G V+       + ++Q++  +++YAH  +  + 
Sbjct: 120 PRVYPVAAISQGSRGEVLAEYGELKAAGAVALSDDGRPVSNSQLMRRALEYAHTFDLPII 179

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
             + D  L   GV++EGI++  +GL GIP+ +E   + RD+ +A+ TG   H + +S   
Sbjct: 180 SHSEDLALTGNGVMHEGIVSLQMGLRGIPAAAEETAIFRDVALARLTGARLHIAHVSTAG 239

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
           S+ +I+ AKA  T+ T   + +   L +  V  +N+  K+ PPLR+  +  ++ + L  G
Sbjct: 240 SVEIIRQAKAAGTQVTAETAPHYFSLTDEAVRGFNTNAKMSPPLRTAADVAAIKKGLADG 299

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            +D I +DH P     K + F +A+ G IGLET L  +L L     ++L +++  LS  P
Sbjct: 300 TLDCIATDHAPHSSLEKEVEFDQAANGIIGLETALGLSLNLVWEGVLTLSQMVAKLSANP 359

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A+I  +PGGTLQ G  ADI +IDLN+ WTV      S  +N  F     TGK V T + G
Sbjct: 360 ARILRVPGGTLQVGKPADITVIDLNHAWTVDVQQFKSKSRNCPFHGWQLTGKPVLTMVGG 419

Query: 424 KQVYTLE 430
           + +Y L+
Sbjct: 420 EIIYKLK 426


>gi|1172784|sp|P46538|PYRC_BACCL RecName: Full=Dihydroorotase; Short=DHOase
 gi|312441|emb|CAA51737.1| dihydroorotase [Bacillus caldolyticus]
          Length = 427

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/378 (32%), Positives = 193/378 (51%), Gaps = 2/378 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  G + VPG+ID  V L     E  + I T +  A  GG T++  MP   +   D    
Sbjct: 46  DVGGRLIVPGLIDLHVHLREPGGEAKETIETGTLAAAKGGFTTVAAMP-NTNPAPDRKEQ 104

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +++    IR  + +NV P A +T   +G+E+++   L+E G  +F    + +    ++  
Sbjct: 105 MEWLQARIRETARVNVLPYAAITIGQKGEELTDFAALKEAGAFAFTDDGVGVQSAGMMFE 164

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +MK A  L+  +     D  L + G +++G  A   GL GIPS+ E V +ARD+L+A+  
Sbjct: 165 AMKQAAALDMAIVAHCEDDTLTNGGAVHDGEFARRYGLRGIPSVCEAVHIARDVLLAEAA 224

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G HYH   IS  +S+ +++ AK    + T  ++ ++L+L + D+   ++  K+ PPLRS 
Sbjct: 225 GCHYHVCHISTKESVRVVRDAKRAGIRVTAEVTPHHLLLCDEDIPGLDANYKMNPPLRSR 284

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQI 350
            +R +++E L  G ID I +DH P     K      A FG +GLET        F    +
Sbjct: 285 EDRDALIEGLLDGTIDFIATDHAPHTAAEKAKGIEAAPFGIVGLETAFPLLYTHFVKTGV 344

Query: 351 -SLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            +LK+L+  L+ +PAQ F L  G L  G  ADIA+IDL  +  +  +  +S  KNT F  
Sbjct: 345 FTLKQLVDWLTIKPAQCFGLKAGRLAVGAPADIAVIDLETEEAIDPETFASKGKNTPFAG 404

Query: 410 EFFTGKVVRTYISGKQVY 427
               G  V T++ G  V+
Sbjct: 405 WVCQGWPVMTFVGGTLVW 422


>gi|56419685|ref|YP_147003.1| dihydroorotase [Geobacillus kaustophilus HTA426]
 gi|81347664|sp|Q5L0U5|PYRC_GEOKA RecName: Full=Dihydroorotase; Short=DHOase
 gi|56379527|dbj|BAD75435.1| dihydroorotase [Geobacillus kaustophilus HTA426]
          Length = 428

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/378 (32%), Positives = 193/378 (51%), Gaps = 2/378 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  G + VPG+ID  V L     E  + I T +  A  GG T++  MP   +   D    
Sbjct: 47  DVGGRLIVPGLIDLHVHLREPGGEAKETIETGTLAAAKGGFTTVAAMP-NTNPAPDRKEQ 105

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +++    IR  + +NV P A +T   +G+E+++   L+E G  +F    + +    ++  
Sbjct: 106 MEWLQARIRETARVNVLPYAAITIGQKGEELTDFAALKEAGAFAFTDDGVGVQSAGMMFE 165

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +MK A  L+  +     D  L + G +++G  A   GL GIPS+ E V +ARD+L+A+  
Sbjct: 166 AMKQAAALDMAIVAHCEDDTLTNGGAVHDGEFARRYGLRGIPSVCEAVHIARDVLLAEAA 225

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G HYH   IS  +S+ +++ AK    + T  ++ ++L+L + D+   ++  K+ PPLRS 
Sbjct: 226 GCHYHVCHISTKESVRVVRDAKRAGIRVTAEVTPHHLLLCDEDIPGLDANYKMNPPLRSR 285

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQI 350
            +R +++E L  G ID I +DH P     K      A FG +GLET        F    +
Sbjct: 286 EDRDALIEGLLDGTIDFIATDHAPHTAAEKAKGIEAAPFGIVGLETAFPLLYTHFVKTGV 345

Query: 351 -SLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            +LK+L+  L+ +PAQ F L  G L  G  ADIA+IDL  +  +  +  +S  KNT F  
Sbjct: 346 FTLKQLVDWLTIKPAQCFGLKAGRLAVGAPADIAVIDLETEEAIDPETFASKGKNTPFAG 405

Query: 410 EFFTGKVVRTYISGKQVY 427
               G  V T++ G  V+
Sbjct: 406 WVCQGWPVMTFVGGTLVW 423


>gi|94971175|ref|YP_593223.1| dihydroorotase [Candidatus Koribacter versatilis Ellin345]
 gi|94553225|gb|ABF43149.1| dihydroorotase [Candidatus Koribacter versatilis Ellin345]
          Length = 429

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 128/429 (29%), Positives = 216/429 (50%), Gaps = 8/429 (1%)

Query: 2   TSFVLNNTRIIDPSRDIDEVGAIIVENGIILA-AGADALNAKFPTSALIHDCTGLVAVPG 60
           TS ++    +IDP+ +ID    +++  G + A      + +++       D   LV  PG
Sbjct: 4   TSVLIRRGHVIDPANNIDRPMDVLLREGRVAAITEPGGIKSEYEEE---FDANHLVVAPG 60

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
            ID  V L      + + I + ++ A AGG TS+  MP   S   D      + L+  R 
Sbjct: 61  FIDLHVHLREPGQAHKETIASGTRSAAAGGFTSVCAMP-NTSPVNDTPETTTWMLQPDR- 118

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++NV+P A  T    G++++  R LQ  G V+       I D  ++  +++ A  L  
Sbjct: 119 GAVVNVFPIAAATIGSNGEKLTNFRDLQRAGAVAISDDGKPILDDNLMREALRTAARLEM 178

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            V     D  +   G +N G+ +  LGL GIP+ SE   + RD+ + + +  H H + IS
Sbjct: 179 PVVQHAEDPRMHPGGCMNYGVTSLRLGLRGIPNASEASVVLRDIRLTRESRAHLHVAHIS 238

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++  ++ AK  N + T  ++ ++  L + ++  Y++  K+ PPLR+  +R +M+  L
Sbjct: 239 TAEALDAVRRAKKENLRVTAEVTPHHFTLLDENIGHYDTAYKMNPPLRANPDRDAMIAGL 298

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQ-QISLKKLIRAL 359
           + G +D I +DH P     K   F  A FG IGLET L  A+ + H   +I L ++++ +
Sbjct: 299 KDGTLDCIATDHAPHAYHEKEQEFDRAPFGIIGLETALPLAITVLHKHFEIPLTRIVQLM 358

Query: 360 STRPAQIFNL-PGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVR 418
           ST PA++F L   G+L  G+ AD+ + D   +W  +A    S  KNT FD   F GKV+ 
Sbjct: 359 STSPARLFQLMHRGSLAVGSHADVVVFDPKMKWKFEAAKGHSKSKNTPFDGWDFMGKVMA 418

Query: 419 TYISGKQVY 427
           T + G+ VY
Sbjct: 419 TIVGGRPVY 427


>gi|312793562|ref|YP_004026485.1| dihydroorotase, multifunctional complex type [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312875940|ref|ZP_07735930.1| dihydroorotase, multifunctional complex type [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311797421|gb|EFR13760.1| dihydroorotase, multifunctional complex type [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|312180702|gb|ADQ40872.1| dihydroorotase, multifunctional complex type [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 430

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 126/421 (29%), Positives = 213/421 (50%), Gaps = 4/421 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           ++ N +I++   D  E   I++ +  I   G +    + P   +I D +G   +P   D 
Sbjct: 3   LIKNAQIVNSIHDKAEKVDILIVDDKIEKIGKNM--EENPDKMIIIDASGKYVMPSFTDI 60

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
              L     EY ++I + S+ AVAGG T+I  MP   +  +D    + Y     R  S I
Sbjct: 61  HCHLREPGFEYKEDIKSGSRSAVAGGFTTICCMP-NTNPPIDNRAMVAYIKYRAREVSPI 119

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
            V P   +T  + G+E++E+  ++E+G ++       + +  ++ N++ Y+   +  V  
Sbjct: 120 EVLPVGAITKGLSGEELAEIGFMKEEGAIAISDDGKCVMNANIMRNALLYSKDFSIPVIS 179

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D  L   G IN G ++   GL GIP  +E+  +ARD+L+A+ T GH H + +S  +S
Sbjct: 180 HCEDTNLSEGGQINLGYVSTITGLRGIPREAESTIVARDILLAKETKGHLHITHVSTKES 239

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + LIK AK      T     + + L E +V  +N+  KV PPLR++ +  +++E L++G 
Sbjct: 240 VRLIKMAKEWGVNVTADTCPHYISLTEEEVLGFNTNAKVNPPLRTQEDVEALIEGLKEGV 299

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALSTRP 363
           ID I +DH P H D K + F  A+ G+IG ET  S     L       L K++  L+  P
Sbjct: 300 IDCISTDHAPHHKDEKNVEFNLAASGTIGFETAFSVLFTYLVEKNGFELGKVVELLNQNP 359

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
            ++  LP   ++ G  A++ ++DL  +W VK +++ S  KN+VF  +F T  V     +G
Sbjct: 360 RKVIGLPPNVIREGQKANLVIVDLKKKWEVKEENIVSKSKNSVFLGKFLTSYVETVIFNG 419

Query: 424 K 424
           K
Sbjct: 420 K 420


>gi|167749370|ref|ZP_02421497.1| hypothetical protein EUBSIR_00322 [Eubacterium siraeum DSM 15702]
 gi|167657651|gb|EDS01781.1| hypothetical protein EUBSIR_00322 [Eubacterium siraeum DSM 15702]
          Length = 445

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 134/426 (31%), Positives = 213/426 (50%), Gaps = 6/426 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + +L N  ++D     +    I++++G I A G D L      +A + DC GL  +PGI 
Sbjct: 22  TILLKNGHVVDYVNGFEGKKDILIKDGFIRALG-DNLECD-DKNARVVDCNGLTVIPGIC 79

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L      Y ++I T  + AVAGG+T++  MP      +D    +KY L+    K+
Sbjct: 80  DMHVHLRDPGQTYKEDIITGCEAAVAGGVTALACMP-NTKPPVDNKETVKYILD-KAKKA 137

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              VYP  C+T  M+GKE+ +   L+  G V+       +    ++  +M  AH     V
Sbjct: 138 KAKVYPVGCITKGMQGKELCDYDELKAAGCVAVSDDGRPVESANMMAQAMVKAHYAGLKV 197

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  +   G+IN+G I+  LG+ G+  +SE +  AR+L IAQ T    H + +S  
Sbjct: 198 ISHCEDLEIIDGGIINKGKISQQLGVKGMSRLSEDIITARELAIAQDTQMPIHIAHVSTK 257

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
            S+  I+         TC  + +  ++ +  +   ++  ++ PPLR E + M++  A+  
Sbjct: 258 GSVNTIRGNTHIGVMCTCETAPHYFMMTDEKLLSRDADYRMNPPLREEDDVMAITAAITD 317

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALR-LFHGQQISLKKLIRALST 361
           G ID IV+DH P   + K   F +A  G +G+ET L+A L  L+H   ISL  ++R +  
Sbjct: 318 GTIDCIVTDHAPHSAEEK-ADFEKAPNGVVGMETSLAATLTGLYHTGTISLMHIVRLMCV 376

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            P +I  + GG+L  G  ADIA+ D +  WTV  + + S  KNT F      G+V  T +
Sbjct: 377 NPRKILGIEGGSLGIGDIADIAIFDADESWTVDPEKLHSKSKNTCFKGMTLKGRVKYTLV 436

Query: 422 SGKQVY 427
           +GK VY
Sbjct: 437 NGKIVY 442


>gi|167036038|ref|YP_001671269.1| dihydroorotase [Pseudomonas putida GB-1]
 gi|166862526|gb|ABZ00934.1| dihydroorotase, multifunctional complex type [Pseudomonas putida
           GB-1]
          Length = 423

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 138/416 (33%), Positives = 207/416 (49%), Gaps = 5/416 (1%)

Query: 8   NTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVT 67
             R+IDP+  +D+V  + +E G I A    A  A F  S  I    GLVA PG++D  V+
Sbjct: 7   GARVIDPNSGLDQVTDLHLEGGRIAAI--GAAPAGFSASRTIQ-ADGLVAAPGLVDLGVS 63

Query: 68  LTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVY 127
           L         NI + ++ AVAGG+TS+   P      LD     +  L+  R  +   VY
Sbjct: 64  LREPGYSRKGNIASETRAAVAGGVTSLCCPPQ-TKPVLDTSAVAELILDRAREAANSKVY 122

Query: 128 PTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTH 187
           P   LT  +EG++++E+  L++ G V+F      I + + L  +++YA   +  V   + 
Sbjct: 123 PIGALTKGLEGEQLAELVALRDTGCVAFGNGLKEIPNNRTLARALEYAATFDLTVVFHSQ 182

Query: 188 DHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIAL 247
           D  L   G+ +EG +A++LGL GIP  +ETV LAR+LL+ + +G   H S I+  +   L
Sbjct: 183 DRDLAQGGLAHEGAMASFLGLPGIPESAETVALARNLLLVEQSGVRAHFSQITSARGARL 242

Query: 248 IKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDI 307
           I  A+A     T  +++  LIL +  +  ++SL  V PPLR+  +R  + EA++ G I  
Sbjct: 243 IAQAQALGLPVTADVALYQLILTDESLREFSSLYHVQPPLRTAADRDGLREAVKSGVIQA 302

Query: 308 IVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIF 367
           I S H P   D KL PF     G   +E +L  A+ L     + L  L+  LS+ PA   
Sbjct: 303 ISSHHQPHERDAKLAPFGATEPGISSVELLLPLAMTLVQDGLLDLPTLLARLSSGPAAAL 362

Query: 368 NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
            LP G L+ G AAD+ L D     TV  +   S  +N  F      G V  T + G
Sbjct: 363 RLPAGELKVGGAADLVLFDPQAS-TVAGEQWFSRGENCPFIGHCLPGAVRYTLVDG 417


>gi|288575028|ref|ZP_06393385.1| dihydroorotase, multifunctional complex type [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288570769|gb|EFC92326.1| dihydroorotase, multifunctional complex type [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 428

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 128/420 (30%), Positives = 211/420 (50%), Gaps = 4/420 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           + +  R+IDPS+ +D++  I+V +G I A G D L +         D  G V VPG+ID 
Sbjct: 4   LFSGARVIDPSQGLDDISDILVRDGKIAAIGKD-LASTLGGDVEKVDLRGYVVVPGLIDP 62

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
            V       E+ + + +    A AGG TS+I M    S  +D    + Y LE+ +    +
Sbjct: 63  HVHFRDPGQEHKETVISGCASAAAGGYTSVIAM-ANTSPAVDSVETLNYVLEKGK-GGPV 120

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
                  +T  ++G+E+S M  L E G V+F     SI D++V+  + + A  L   +++
Sbjct: 121 RFCSVGSVTLGLKGEELSPMGSLAEAGAVAFSDDGFSIVDSEVMYRAFEKAAELGLPISV 180

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
              D  L     +N G +++ L + G+P ++E   + RD+L+A       H   +S    
Sbjct: 181 HCEDPRLWGDRTMNRGALSDALKVKGVPKVAEEAMIQRDILLASKAKAKVHIQHVSTALG 240

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + +I+ AK    + T   + ++LIL E  + ++ S  K+ PPLR   +  ++ E L  G 
Sbjct: 241 VEMIRRAKEDGIEVTAEATPHHLILTEEVLSVHGSQAKMSPPLREARDVEALREGLRLGI 300

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRP 363
           ID+I +DH P   + K     E+  G +GLET +   L  L     +S+ +++ A+S   
Sbjct: 301 IDVIATDHAPHSEEEKGRGLLESPNGIVGLETAVPMILTELVAKGHLSINRMVEAMSCAS 360

Query: 364 AQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISG 423
           A IF LPGG+L+ G  AD+ ++DL  +WT+ AD   S  +NT FD     G V+ T + G
Sbjct: 361 AGIFGLPGGSLRPGCVADMTVLDLEARWTIDADRFESKGRNTPFDGAPVVGAVIGTALGG 420


>gi|239817574|ref|YP_002946484.1| dihydroorotase [Variovorax paradoxus S110]
 gi|239804151|gb|ACS21218.1| dihydroorotase [Variovorax paradoxus S110]
          Length = 427

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 136/433 (31%), Positives = 220/433 (50%), Gaps = 16/433 (3%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + +++N R++DP+   D+   I + +G I  AG     A F     + D TG V  PG++
Sbjct: 2   NILISNGRVVDPASGTDKKTDIAIADGKI--AGIGHTPAGFKAERTL-DATGCVVAPGLV 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFI---KYALEEIR 119
           D    L     E+   + +    A+AGG+TS++  P      LDE   +   K+  E+++
Sbjct: 59  DLAARLREPGYEHEGMLESEMAAAIAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRAEKLQ 117

Query: 120 VKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN 179
              L   +P   LT ++ G  ++EM  L E G + F Q+ + + DTQVL  ++ YA    
Sbjct: 118 GARL---FPLGALTRSLAGGVLTEMAELTEAGCIGFSQADVPLADTQVLQRALLYASTFG 174

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
             V L   D  LG +GV   G +A  LGL G+P  +ET+ +   + + + TG   H   I
Sbjct: 175 YTVWLRPQDRDLG-KGVAASGPLATRLGLSGVPVSAETIAIFTIVELMKSTGARVHLCRI 233

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEA 299
           S    +AL++ AKA     +C +SIN+L L + D+  ++S  ++ PPLR + +R ++  A
Sbjct: 234 SSAAGVALVRAAKAQGLPLSCDVSINSLHLADTDIGFFDSRARLNPPLRQQGDRDALSAA 293

Query: 300 LEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRAL 359
           L  G ID +VSDHTP   D K LPFAEA  G+ GLE +L  AL+        + + +  +
Sbjct: 294 LADGTIDALVSDHTPVEADAKTLPFAEAEPGATGLELLLPLALQWGERSGAGIVRALEVI 353

Query: 360 STRPAQIFNLPG-----GTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTG 414
           ++ PA++          G L  G  AD+ + D   +W V+ D + S  K+T F      G
Sbjct: 354 TSAPARLLAAADAGTGIGRLAEGGVADLCVFDPGLEWQVQPDALKSQGKHTPFSGYPLVG 413

Query: 415 KVVRTYISGKQVY 427
           +   T ++G+ V+
Sbjct: 414 RARHTLVAGRVVH 426


>gi|321315315|ref|YP_004207602.1| dihydroorotase [Bacillus subtilis BSn5]
 gi|320021589|gb|ADV96575.1| dihydroorotase [Bacillus subtilis BSn5]
          Length = 428

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 191/378 (50%), Gaps = 2/378 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  GL+  PG +D  V       E  + I T +K A  GG T++  MP       D    
Sbjct: 45  DAKGLLVSPGFVDLHVHFREPGGEKKETIETGAKAAARGGYTTVAAMP-NTRPVPDTKEQ 103

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +++    I+  S + V P A +T    G E++    L+E G  +F    + I    ++  
Sbjct: 104 MEWVQNRIKETSCVRVLPYASITIRQIGDEMTNFEALKEAGAFAFTDDGVGIQTAGMMYE 163

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +MK A  ++  +     D+ L   G ++EG  +   GL GIPS+ E+V +ARD+L+A+  
Sbjct: 164 AMKRAAAIDKAIVAHCEDNSLIYGGSVHEGTFSKANGLNGIPSVCESVHIARDVLLAEAA 223

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
             HYH   IS  +S+ +++ AK    + T  +S ++L+L + D+   ++  K+ PPLRS 
Sbjct: 224 NCHYHVCHISTKESVRVVRDAKKAGIRVTAEVSPHHLLLCDEDIPGLDTNYKMNPPLRSA 283

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQ 349
            +R +++E L  G ID I +DH P   + K      A FG +GLET        F    +
Sbjct: 284 EDRAALIEGLLDGTIDFIATDHAPHTEEEKNTEMKLAPFGIVGLETAFPLLYTHFVKNGK 343

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            SLK+LI  ++ +P + F LP GTLQTG AADI LIDL  +  +  +   S  KNT F+ 
Sbjct: 344 WSLKQLIDYMTIKPCEAFGLPYGTLQTGQAADITLIDLEKEAVIDKETFLSKGKNTPFNG 403

Query: 410 EFFTGKVVRTYISGKQVY 427
              TG  V T  +GK  Y
Sbjct: 404 ISCTGWPVATIAAGKLAY 421


>gi|300781104|ref|ZP_07090958.1| dihydroorotase [Corynebacterium genitalium ATCC 33030]
 gi|300532811|gb|EFK53872.1| dihydroorotase [Corynebacterium genitalium ATCC 33030]
          Length = 421

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 125/430 (29%), Positives = 219/430 (50%), Gaps = 14/430 (3%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           MT+  +NN R        ++   I++ +G+I   G    +++F  +  I D  G V +PG
Sbjct: 1   MTTLAINNVRPYG-----EDTTNILIRDGVIAEMG----DSRFDAADTI-DADGHVLLPG 50

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           ++D  V L     E ++ I T S  A  GG T++  M       +D+    +   E+ + 
Sbjct: 51  LVDMHVHLREPGREDTETIATGSDAAAKGGFTAVFTM-ANTQPVIDQPFLAEAVWEKGQA 109

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
               +VYP   +T  +EGK+++E+ LL    +  F      ++D Q++  +++YA   + 
Sbjct: 110 YGKCDVYPVGSITQGLEGKQLTEIGLLARNHVRMFSDDGRCVNDPQLMRRAIEYAKAHDV 169

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
           ++A    DH +      +EG  A  LGL G P ++E   +ARDL++ +  GG YH    S
Sbjct: 170 VLAQHAEDHRMTEGASAHEGANAARLGLRGWPRVAEESIVARDLIMTRDYGGRYHICHAS 229

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              ++AL++ AK    +AT  ++ ++L+L +  +E Y+ L +V PPLR + + +++ +AL
Sbjct: 230 TEGTVALLRWAKEQGIEATAEVTPHHLLLTDAKLETYDGLFRVNPPLREDRDTIALRDAL 289

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLI-RAL 359
             G ID+I +DH P   + K + F  A  G +GLET LS   ++F    ++  + + R +
Sbjct: 290 LDGTIDVIATDHAPHGSEDKCVEFEHAKPGMLGLETSLSIVAQVFVESGLADWRFVARVM 349

Query: 360 STRPAQIFNLP--GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
           S RPA+I  L   G  +  G  A++ L+D +  WT    DM+S   NT ++   F   V 
Sbjct: 350 SERPAEILGLSDQGRPIAVGEPANLTLVDPDAGWTAHGADMASKANNTPYENMNFNACVS 409

Query: 418 RTYISGKQVY 427
            T + G+  +
Sbjct: 410 ATILRGRPTF 419


>gi|241764788|ref|ZP_04762796.1| amidohydrolase [Acidovorax delafieldii 2AN]
 gi|241365718|gb|EER60414.1| amidohydrolase [Acidovorax delafieldii 2AN]
          Length = 431

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 138/433 (31%), Positives = 221/433 (51%), Gaps = 18/433 (4%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           ++ N R+IDP+   D+   I +  G I+  G + + A F  S ++ +  G + +PG++D 
Sbjct: 4   LIQNGRVIDPASGFDQTCDIALAAGRIV--GINRVPADFAPSRVV-EAAGCIVLPGLVDL 60

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFI---KYALEEIRVK 121
              L     E+   + +    AVAGG+TS++  P      LDE   +   K+  E++   
Sbjct: 61  AARLREPGYEHEGMLESEMAAAVAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRAEKLHQS 119

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
            L   +P   LT  + G+ ++EM  L E G V F Q+ + +  TQVL  +++YA      
Sbjct: 120 RL---FPLGALTHGLAGEVLTEMAELTESGCVGFGQAEVPLASTQVLQRALQYAATFGYT 176

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           V L   +  LG +GV   G +A  LGL G+P  +ET+ L     + + TG   H   +S 
Sbjct: 177 VWLRPQELHLG-KGVAASGPLATRLGLSGVPVAAETIALHTIFELLKTTGARVHLCRLSS 235

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
              + L++ AKA   K TC +SIN+L L + D+  ++S  ++ PPLR + +R ++  AL 
Sbjct: 236 AAGVDLVRRAKADGLKVTCDVSINSLHLTDVDIGFFDSRARLTPPLRQQRDRDALHAALA 295

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
            G ID +VSDHTP   D K LPFAEA  G+ GLE +LS AL+      + L++ +  +++
Sbjct: 296 DGTIDALVSDHTPVDEDAKTLPFAEAEPGATGLELLLSLALKWSRDSGVPLQRALATVTS 355

Query: 362 RPAQIFNLPGGTLQT-------GTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTG 414
            PA++     GTLQ        G   D+ ++D    WTV+   + S  K+T F      G
Sbjct: 356 EPARVLGNALGTLQASVGQLVEGGVGDLCILDPQAAWTVQDATLHSQGKHTPFSGYELPG 415

Query: 415 KVVRTYISGKQVY 427
           +V  T + G   +
Sbjct: 416 QVRMTLVGGHVAF 428


>gi|154500490|ref|ZP_02038528.1| hypothetical protein BACCAP_04162 [Bacteroides capillosus ATCC
           29799]
 gi|150270721|gb|EDM98017.1| hypothetical protein BACCAP_04162 [Bacteroides capillosus ATCC
           29799]
          Length = 427

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 130/428 (30%), Positives = 212/428 (49%), Gaps = 9/428 (2%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
             ++   +++DP   I  V  I++E+G I   G+D    + P + +I D  G+V   G+I
Sbjct: 2   KLLIRQGKLVDPVGGIGGVMDILIEDGKIAVIGSDI---REPDAQVI-DARGMVVCAGLI 57

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     EY + I T  + A AGG T I  M        D    + Y L++     
Sbjct: 58  DMHVHLREPGFEYKETIETGCRAAAAGGFTGIAPM-ANTRPVTDSPEQVAYILQKAEEAG 116

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L+ VYP   ++   +G+E+++   L+E G V+     + + +  +L +++  AH  N  V
Sbjct: 117 LVRVYPIGAVSKGQKGQELTDAGALREAGAVALSDDGVPVQNANLLRDALILAHRHNLTV 176

Query: 183 ALDTHD-HFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
                D   +G+R V NEG I+  L L G P+I+E + + RD ++A+ TG   H   IS 
Sbjct: 177 LSHCEDADMVGNRAV-NEGRISRQLRLDGRPAIAEELQVMRDAMLAEETGAAVHICHIST 235

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
            +S+A+++  K    + TC        L E+++    ++ +V PPLR+  +   ++E L+
Sbjct: 236 AKSVAIVRRYKRKGVQITCETCPQYFSLTEDEILTKGTMARVNPPLRTRADVEGIIEGLK 295

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALS 360
            G ID I +DH P   + K  P  EA  G +GLET L   L  L+H  ++ L  ++R ++
Sbjct: 296 DGTIDAIATDHAPHSAEEKGRPLTEAPSGMVGLETALGVTLTALYHTGEMGLSDILRKMT 355

Query: 361 TRPAQIFNLP-GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
             PA I  +P  G L  G   D+ + + + +WTV  +   S  +NT F      GKV  T
Sbjct: 356 MNPACILRIPHKGRLAIGGDGDLVIFNPDEKWTVDPEKFHSKGRNTPFAGMELKGKVKYT 415

Query: 420 YISGKQVY 427
            + GK VY
Sbjct: 416 VVGGKIVY 423


>gi|222151020|ref|YP_002560174.1| dihydroorotase [Macrococcus caseolyticus JCSC5402]
 gi|254788863|sp|B9EB67|PYRC_MACCJ RecName: Full=Dihydroorotase; Short=DHOase
 gi|222120143|dbj|BAH17478.1| dihydroorotase [Macrococcus caseolyticus JCSC5402]
          Length = 427

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 127/406 (31%), Positives = 210/406 (51%), Gaps = 7/406 (1%)

Query: 24  IIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLS 83
           I +E+G I+  G + LN     ++ I +  G     G +D  V L     E+ + I + +
Sbjct: 21  IRIEDGKIVEMG-EKLNV---YNSEIIELDGKFVSQGFVDVHVHLREPGGEHKETIESGT 76

Query: 84  KEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISE 143
           + A  GG T++  MP       D    I+   + I+  + + V P A +T    GK++ +
Sbjct: 77  RAAARGGFTTVCPMP-NTRPVPDSVEHIEALNQSIKQHAKVRVLPYASITERQLGKDLVD 135

Query: 144 MRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIA 203
            + L+E G  +F    + +    ++  +M+ A  LN  +     D+ L   G ++EG ++
Sbjct: 136 FKALKEHGAFAFTDDGVGVQTASIMYEAMQQAAQLNMAIVAHCEDNSLIYGGAMHEGKVS 195

Query: 204 NYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGIS 263
             L + GIPSI E V +ARD+L+A+    HYH   +S  +S+ +I+ AK    K T  ++
Sbjct: 196 KALNIPGIPSICEAVQIARDVLLAEAADCHYHVCHVSSKESVRVIRDAKRAGIKVTAEVT 255

Query: 264 INNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLP 323
            ++L+LNE  +   +++ K+ PPLRSE +  +++EAL  G ID I +DH P   D K  P
Sbjct: 256 PHHLLLNETAITEDDAILKMNPPLRSEEDHQALIEALLDGTIDFIATDHAPHAADEKNQP 315

Query: 324 FAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRPAQIFNLP-GGTLQTGTAAD 381
             +A FG +G ET       R       +L +LI  L+ +P Q+F LP G +L+ G+ AD
Sbjct: 316 MTKAPFGIVGSETAFPLLYTRFVKNGDWTLGQLIDYLALKPGQVFGLPYGKSLEVGSIAD 375

Query: 382 IALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           I +IDL+ ++ +K++D  S   NT F  E   G V  T + G+  Y
Sbjct: 376 ITVIDLDEKYEIKSEDFLSKSSNTPFIGEHVYGNVKLTLVEGQIAY 421


>gi|118474957|ref|YP_892610.1| dihydroorotase [Campylobacter fetus subsp. fetus 82-40]
 gi|118414183|gb|ABK82603.1| dihydroorotase [Campylobacter fetus subsp. fetus 82-40]
          Length = 426

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 129/413 (31%), Positives = 217/413 (52%), Gaps = 8/413 (1%)

Query: 22  GAIIVENGI----ILAAGA--DALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEY 75
           G II +NG     +L  G    ++ A+ P + L+ D T  + +PG+ID  V       EY
Sbjct: 8   GIIINQNGTLKANVLIDGEMIKSITAEEPKADLVIDATNKLVMPGLIDMHVHFRDPGLEY 67

Query: 76  SKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSN 135
             +I T S  AVAGG+T+   M    +   D     +  + + + + LI++ P   +T  
Sbjct: 68  KDDIITGSMSAVAGGVTTACPMA-NTNPVNDNAVVTRDMIAKAKKRGLIDLLPIGAITKG 126

Query: 136 MEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRG 195
           MEGK I+EM  + E G V+F    + +  + V+  ++ Y+    + +   + D  L   G
Sbjct: 127 MEGKGITEMGDMSEAGCVAFSDDGLPVSSSDVMRAALLYSAFHKSFIINHSQDCSLCRGG 186

Query: 196 VINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHN 255
            +NEG ++  LG+ G+P   E + ++RD+L+A+ TGGH H + +S   S+ LI+ AK   
Sbjct: 187 HMNEGKMSMLLGIKGMPREQEEIMISRDMLLAKLTGGHIHVAHVSSAYSLKLIEQAKNEG 246

Query: 256 TKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPR 315
              TC ++ ++   +E+++  Y++  K+ PPLR+  +  +M   L+ G ID+I +DH P 
Sbjct: 247 VNITCEVTPHHFTFSEDELINYDTNFKMSPPLRTNNDVEAMRNGLKNGLIDVICTDHAPH 306

Query: 316 HMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPAQIFNLPG-GTL 374
           H D K L F +A FG +GL+T++   L L     I  +++++  S  PA+I NL   G +
Sbjct: 307 HTDEKFLEFDKAPFGILGLQTLVPLTLNLVREGVIDYEQMVKLTSFNPAKILNLKNKGAI 366

Query: 375 QTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           + G  ADIA+ID + ++    +   S  KN+    +   G  V T  SGK V+
Sbjct: 367 KEGFLADIAIIDPDLEYIYDENLNKSKSKNSPLLGKKLKGASVVTIKSGKVVF 419


>gi|304313321|ref|YP_003812919.1| Dihydroorotase-like protein [gamma proteobacterium HdN1]
 gi|301799054|emb|CBL47297.1| Dihydroorotase-like protein [gamma proteobacterium HdN1]
          Length = 433

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 128/425 (30%), Positives = 212/425 (49%), Gaps = 4/425 (0%)

Query: 5   VLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDA 64
           V+   R++DP++ +D V  I + +GI+L+ G   +   F    +IH   G + +PG +D 
Sbjct: 13  VIRGGRLVDPAQKLDLVTDIYIADGIVLSIGQRPVG--FSDDEIIH-AEGALVIPGAVDL 69

Query: 65  RVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLI 124
              L     E    I + ++ A A GIT I+  P   +  +D         E        
Sbjct: 70  CAHLREPGSETRGTIYSETRAAAAAGITHIVCTP-DTTPVVDSAAIANLIQERAWQTGYC 128

Query: 125 NVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVAL 184
           +VYP   LT  +EG+++SEM  L+E G + F Q  M + + +VLL  ++YA   +  V  
Sbjct: 129 HVYPIGALTRGLEGQQLSEMYALRESGCIGFSQMRMPVRNHRVLLRCLEYAATFDLTVFF 188

Query: 185 DTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQS 244
            + D  L   G  + G  A  LGL GIPS +ET+ L+RDLL+ +HTG   H   +S  +S
Sbjct: 189 QSVDTGLAGNGCAHAGPTATRLGLTGIPSAAETIALSRDLLLVEHTGVRAHFGQLSCARS 248

Query: 245 IALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGD 304
           + LI  A+A   + T  ++ + L L +  ++ +NS+  V PPLR+E +R+ ++E +  G 
Sbjct: 249 VELIADAQARGLRVTADVAAHQLFLTDTMMDGFNSVYHVNPPLRTEADRLGLIEGVRSGI 308

Query: 305 IDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRPA 364
           I  I SDH P     K  PFA ++ G     T L  +  L     +S+   +R +S  PA
Sbjct: 309 ITAICSDHQPHEAAAKAAPFAASAPGISAFSTYLPLSYDLVRNGTLSVADWVRRISLHPA 368

Query: 365 QIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGK 424
           QI  L  G+++ G  A++ +   + +W +  + + S+  N+ +      G+V  T   G+
Sbjct: 369 QIIGLEAGSVRIGDEANLTVFAPDERWILTDETLFSLGANSPWFGTEIEGRVRATLHDGR 428

Query: 425 QVYTL 429
             + L
Sbjct: 429 ISFRL 433


>gi|291484102|dbj|BAI85177.1| dihydroorotase [Bacillus subtilis subsp. natto BEST195]
          Length = 428

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 190/378 (50%), Gaps = 2/378 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  GL+  PG +D  V       E  + I T +K A  GG T++  MP       D    
Sbjct: 45  DAKGLLVSPGFVDLHVHFREPGGEKKETIETGAKAAARGGYTTVAAMP-NTRPVPDTKEQ 103

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +++    I+  S + V P A +T    G E++    L+E G  +F    + I    ++  
Sbjct: 104 MEWVQNRIKETSCVRVLPYASITIRQIGDEMTNFEALKEAGAFAFTDDGVGIQTAGMMYE 163

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +MK A  ++  +     D+ L   G ++EG  +   GL GIPS+ E+V +ARD+L+A+  
Sbjct: 164 AMKRAAAIDKAIVAHCEDNSLIYGGSVHEGTFSKANGLNGIPSVCESVHIARDVLLAEAA 223

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
             HYH   IS  +S+ +++ AK    + T  +S ++L+L + D+   ++  K+ PPLRS 
Sbjct: 224 NCHYHVCHISTKESVRVVRDAKKAGIRVTAEVSPHHLLLCDEDIPGLDTNYKMNPPLRSA 283

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQ 349
            +R +++E L  G ID I +DH P   + K      A FG +GLET        F     
Sbjct: 284 EDRAALIEGLLDGTIDFIATDHAPHTEEEKNTEMKLAPFGIVGLETAFPLLYTHFVKNGS 343

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            SLK+LI  ++ +P + F LP GTLQTG AADI LIDL  +  +  +   S  KNT F+ 
Sbjct: 344 WSLKQLIDYMTIKPCEAFGLPYGTLQTGQAADITLIDLEKEAVIDKETFLSKGKNTPFNG 403

Query: 410 EFFTGKVVRTYISGKQVY 427
              TG  V T  +GK  Y
Sbjct: 404 ISCTGWPVATIAAGKLAY 421


>gi|255767363|ref|NP_389433.2| dihydroorotase [Bacillus subtilis subsp. subtilis str. 168]
 gi|239938687|sp|P25995|PYRC_BACSU RecName: Full=Dihydroorotase; Short=DHOase
 gi|225184990|emb|CAB13424.2| dihydroorotase [Bacillus subtilis subsp. subtilis str. 168]
          Length = 428

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 190/378 (50%), Gaps = 2/378 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D  GL+  PG +D  V       E  + I T +K A  GG T++  MP       D    
Sbjct: 45  DAKGLLVSPGFVDLHVHFREPGGEKKETIETGAKAAARGGYTTVAAMP-NTRPVPDTKEQ 103

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +++    I+  S + V P A +T    G E++    L+E G  +F    + I    ++  
Sbjct: 104 MEWVQNRIKETSCVRVLPYASITIRQIGDEMTNFEALKEAGAFAFTDDGVGIQTAGMMYE 163

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +MK A  ++  +     D+ L   G ++EG  +   GL GIPS+ E+V +ARD+L+A+  
Sbjct: 164 AMKRAAAIDKAIVAHCEDNSLIYGGSVHEGTFSKANGLNGIPSVCESVHIARDVLLAEAA 223

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
             HYH   IS  +S+ +++ AK    + T  +S ++L+L + D+   ++  K+ PPLRS 
Sbjct: 224 NCHYHVCHISTKESVRVVRDAKKAGIRVTAEVSPHHLLLCDEDIPGLDTNYKMNPPLRSP 283

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQ 349
            +R +++E L  G ID I +DH P   + K      A FG +GLET        F     
Sbjct: 284 EDRAALIEGLLDGTIDFIATDHAPHTEEEKNTEMKLAPFGIVGLETAFPLLYTHFVKNGS 343

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            SLK+LI  ++ +P + F LP GTLQTG AADI LIDL  +  +  +   S  KNT F+ 
Sbjct: 344 WSLKQLIDYMTIKPCEAFGLPYGTLQTGQAADITLIDLEKEAVIDKETFLSKGKNTPFNG 403

Query: 410 EFFTGKVVRTYISGKQVY 427
              TG  V T  +GK  Y
Sbjct: 404 ISCTGWPVATIAAGKLAY 421


>gi|225850193|ref|YP_002730427.1| dihydroorotase [Persephonella marina EX-H1]
 gi|225646369|gb|ACO04555.1| dihydroorotase (DHOase) [Persephonella marina EX-H1]
          Length = 425

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 131/427 (30%), Positives = 210/427 (49%), Gaps = 4/427 (0%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M S ++ N  I+DP ++I +   I++ENG+I     D     FP   +I D T  +  P 
Sbjct: 1   MGSILIKNGFIVDPKQNIKKELDILIENGVIKKIDKDI--QPFPGCEII-DATNCIVSPS 57

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
            +D  V        Y +++ T S  AVAGG T+++ MP  + + LDE + ++Y +E+   
Sbjct: 58  FVDIHVHFRDPGQTYKEDLYTGSLSAVAGGYTTVVCMPNTIPA-LDEPSLVRYIVEKGEE 116

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
             L  V P A +T   EGK+++EM LL+E G V F      + D  V+  +M++A  + +
Sbjct: 117 IGLCRVLPAAAITKGREGKKLTEMSLLKEAGAVYFTDDGAPVMDAHVMRKAMEFAGSIGS 176

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            VA    D  L   GV +EG I+  LGL  +P  +E   +ARD +++ HTG   H   +S
Sbjct: 177 FVADHCEDLNLSQDGVAHEGEISAALGLPPLPPEAEDTMVARDCVLSLHTGMPVHICHVS 236

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
              ++ +I  AKA     T  ++ ++L L + +   ++   KV PPLR   +  ++  AL
Sbjct: 237 TKVAVEVITWAKAMGAPVTAEVTPHHLYLTDEEWLDFDCKAKVSPPLREHEDIEALRWAL 296

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALS 360
             G ID + +DH P     K+L       G IGL+  L   L L       + + I  LS
Sbjct: 297 ASGIIDFVATDHAPHAHQEKMLEHQHCPPGMIGLQFSLPIILELVRKDYFDIFRAIEVLS 356

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
           T+PA+   +    ++ G  A++ + D    W V  + + S  KNT        GKV  T+
Sbjct: 357 TKPAERIGIDPPQIKEGVKAELTVFDPTESWEVTEEVIKSKSKNTPLIGRKLIGKVKYTF 416

Query: 421 ISGKQVY 427
            +GK V+
Sbjct: 417 YNGKIVF 423


>gi|295399738|ref|ZP_06809719.1| dihydroorotase, multifunctional complex type [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978141|gb|EFG53738.1| dihydroorotase, multifunctional complex type [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 427

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 129/403 (32%), Positives = 206/403 (51%), Gaps = 5/403 (1%)

Query: 26  VENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKE 85
           +ENGII   G +  + +   +  I D  G     G+ID  V L     E  + I T +  
Sbjct: 24  IENGIITETGPELHSGE---ADEIIDVQGKFISAGLIDLHVHLREPGGEQKETIATGTLA 80

Query: 86  AVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMR 145
           A  GG T++  MP   +   D    +++  E I   + + V P A +T   +G E+++  
Sbjct: 81  AAKGGFTTVAAMP-NTNPVPDTKEQMEWLHERICETAYVRVLPYAAITMRQQGTELTDFA 139

Query: 146 LLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANY 205
            L++ G  +F    + +    ++  +MK A  LN  +     D+ L + G +++G  A  
Sbjct: 140 ALKQAGAFAFTDDGVGVQSAGMMYEAMKRAAALNMAIVAHCEDNTLTNGGAVHDGEFACR 199

Query: 206 LGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISIN 265
            GL GIPS+SE+V +ARD+L+A+ TG HYH   IS  +S+ +++ AK    + T  ++ +
Sbjct: 200 HGLNGIPSVSESVHIARDVLLAEATGCHYHVCHISTKESVRVVRDAKRAGIRVTAEVTPH 259

Query: 266 NLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFA 325
           +L+L + D+   ++  K+ PPLRS+ +R +++E L  G ID I +DH P     K     
Sbjct: 260 HLLLCDEDIPGPDANYKMNPPLRSKEDRAALIEGLLDGTIDFIATDHAPHTEAEKQKGMR 319

Query: 326 EASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIAL 384
            A FG +GLET        L     ++LK+LI  L+ +PA+ F LP G L  G  ADI +
Sbjct: 320 AAPFGIVGLETAFPLLYTHLVETNILTLKQLIDLLTVKPAECFGLPLGKLAVGAKADITV 379

Query: 385 IDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYISGKQVY 427
           IDL+ + T+      S  KNT F      G  V T++ GK V+
Sbjct: 380 IDLDAEETIDPQTFVSKGKNTPFAGWTCKGWPVMTFVGGKLVW 422


>gi|299534057|ref|ZP_07047409.1| amidohydrolase [Comamonas testosteroni S44]
 gi|298717966|gb|EFI58971.1| amidohydrolase [Comamonas testosteroni S44]
          Length = 430

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 128/431 (29%), Positives = 213/431 (49%), Gaps = 12/431 (2%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R++DP+R  D+   I ++  +I A G   +   F     I D +G   +PG++D
Sbjct: 3   ILIRNGRVMDPARGFDQQADIAIDGSVIAAIGT--VPEGFVAEREI-DASGQWLLPGLVD 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
             V L     E+   + +    AVAGG+TS++  P      LDE   ++        +  
Sbjct: 60  LAVRLREPGHEHEGMLQSEMAAAVAGGVTSLVCPP-DTEPVLDEQGLVEMLKFRAEKQHK 118

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             ++P   LT  ++G+ ++EM  L E G V+F Q+ + +     L  ++ YA+     V 
Sbjct: 119 SRLFPMGALTVGLKGETLTEMAELTESGCVAFGQADVPLSSITTLSRALSYANTFGYAVW 178

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   D  LG RGV   G +A  +GL G+   +ET+ L     + + +    H   IS   
Sbjct: 179 LRPQDKDLG-RGVAASGALATRMGLAGVSVAAETIALHTIFELIRGSQTRVHLCRISSAA 237

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
            + L++ AKA     T  +SIN+L+L END+  ++S  +V+P LR + +R ++  AL  G
Sbjct: 238 GVELVRRAKAEGLNVTADVSINSLLLTENDIGYFDSCARVVPVLRQQRDRDALSAALADG 297

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID +VSDH P   D K+LPFAEA  G+ G+E +LS A++     ++ L + +  +++ P
Sbjct: 298 TIDALVSDHCPVDEDAKVLPFAEAEPGATGVELLLSIAVKWSRDYKVPLNRALAVVTSAP 357

Query: 364 AQIFNLP-------GGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKV 416
             +            G L+ G  AD+ ++D   +WTV    + S  K+T F+      +V
Sbjct: 358 VAVLGSALGEQQSLLGQLKVGGVADLCIVDPEAEWTVDPKALQSQGKSTPFNGYELPARV 417

Query: 417 VRTYISGKQVY 427
           V T + G   Y
Sbjct: 418 VTTIVDGAVAY 428


>gi|319942921|ref|ZP_08017204.1| dihydroorotase [Lautropia mirabilis ATCC 51599]
 gi|319743463|gb|EFV95867.1| dihydroorotase [Lautropia mirabilis ATCC 51599]
          Length = 449

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 140/433 (32%), Positives = 213/433 (49%), Gaps = 12/433 (2%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           SF +   R++DP   +D    + V +G I+A GA A +   P   +  D TGLV  PG++
Sbjct: 21  SFSITGARLVDPWVKLDMQADLHVADGRIIAVGA-APHGFRPARTI--DGTGLVVSPGLV 77

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D    L     EY  ++ +  + AVAGG+T++   P      LDE   ++          
Sbjct: 78  DLSARLREPGFEYKASLESEMQAAVAGGVTALACPP-DTDPPLDEPGLVEMLKYRAHNLG 136

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L ++YP   LT  ++G+ ++EM  L   G V F Q+   I DTQVLL +M+YAH     V
Sbjct: 137 LAHLYPLGALTVGLKGQALTEMAELTAAGCVGFAQASQPIQDTQVLLRAMQYAHSFGYTV 196

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
            L+  D FL   GV++ G  A+ LGL G P  SETV L     +    G   H   +S  
Sbjct: 197 WLNPVDPFLSRGGVMHAGPFASRLGLPGNPVTSETVALHTICELVASVGCPVHLCRLSSA 256

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
             + L++ A+      T  ++IN+L L + DV  ++S  ++ PPLR++ +R ++   L  
Sbjct: 257 AGVELVRQARKAGLPITADVAINHLHLTDVDVGFFDSAYRLEPPLRAQRDRDALRAGLAD 316

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G +D I SDHTP   D K LPF EA  G++GL  +L  +L+    Q ++L  ++  L+  
Sbjct: 317 GTLDAICSDHTPVVEDAKRLPFGEAEPGAVGLSLLLPLSLKWGKEQGLNLVSVLDRLTRI 376

Query: 363 PAQIF-------NLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGK 415
           PA I        N P G L  G  AD+ + D    W V    +     +T +      G+
Sbjct: 377 PAGIAGIDPARKNEPAG-LSVGARADLCVFDPEESWVVNEKTLWGQCTDTPWLGREVQGR 435

Query: 416 VVRTYISGKQVYT 428
           V  T + G+ V+T
Sbjct: 436 VRLTAVGGRLVFT 448


>gi|171060628|ref|YP_001792977.1| putative dihydroorotase-like protein [Leptothrix cholodnii SP-6]
 gi|170778073|gb|ACB36212.1| putative dihydroorotase-like protein [Leptothrix cholodnii SP-6]
          Length = 441

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 139/439 (31%), Positives = 221/439 (50%), Gaps = 16/439 (3%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGIID 63
            ++ N R+IDP+   DE+  I +  G I+  G   ++ +F  + +I D  G V  PG++D
Sbjct: 3   ILIKNGRVIDPASGRDELADIAIAAGRIVTIGR--ISPEFQANRVI-DAAGCVVAPGLVD 59

Query: 64  ARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKSL 123
               L    +E    + +    A AGG+TS++  P      LDE   ++      R  SL
Sbjct: 60  LAARLREPGEEQKGMLESELNAAAAGGVTSLVCPP-DTDPVLDEPGLVEMLKFRARKLSL 118

Query: 124 INVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIVA 183
             ++P   LT  ++G+ ++EM  L E G V F Q+ + + DT  L  +M YA   +  V 
Sbjct: 119 CRLFPLGALTRGLQGQVLTEMVELTEAGCVGFSQAEVPVQDTLALQRAMLYAATHDFTVW 178

Query: 184 LDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIPQ 243
           L   D++LG +GV   G +A  LGL G+P ++ET+ L     + + TG   H   +S   
Sbjct: 179 LRPQDYWLG-KGVAASGGVATRLGLSGVPVMAETIALHTLFELVRVTGARLHLCRLSSAA 237

Query: 244 SIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEKG 303
            +AL++ AKA   + T  +SIN+L L + D+  +NS  +++PPLR   +R ++  AL  G
Sbjct: 238 GVALLRAAKAEGLRVTADVSINSLHLTDIDIGYFNSSMRLMPPLRQGRDRDALRAALADG 297

Query: 304 DIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTRP 363
            ID +VSDHTP   D K LPFAEA  G+ GLE +LS AL+      + L   +  +++ P
Sbjct: 298 TIDALVSDHTPVEGDAKTLPFAEAEPGATGLELLLSLALKWGTDAGLGLPATLARVTSEP 357

Query: 364 AQIFNLPGGTLQT-------GTAADIALIDLNYQWTVKADDMSSIHKNTVF----DKEFF 412
            ++     G+L +       G  AD+ + D    W V  D + S  K+T F         
Sbjct: 358 VRVLGDALGSLSSSAGRLVEGGVADVCVFDPAATWAVTPDVLCSQGKHTPFAFADTGMAL 417

Query: 413 TGKVVRTYISGKQVYTLES 431
            G+V  T ++G   + L +
Sbjct: 418 PGRVRATLVAGTVAHELRA 436


>gi|199598368|ref|ZP_03211787.1| Dihydroorotase [Lactobacillus rhamnosus HN001]
 gi|199590687|gb|EDY98774.1| Dihydroorotase [Lactobacillus rhamnosus HN001]
          Length = 424

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 127/378 (33%), Positives = 194/378 (51%), Gaps = 2/378 (0%)

Query: 51  DCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTF 110
           D TG   VPG+ID  V          + I T ++ A  GG T+++ M   ++   D  T 
Sbjct: 42  DATGATVVPGLIDVHVHFREPGFTAKETIKTGAQAAAHGGFTTVVAMS-NLNPVPDTVTT 100

Query: 111 IKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLN 170
           +K  L + R  + I V   A +T ++   ++ +M  LQ  G + F    + + D   +  
Sbjct: 101 LKPLLAKNRSDAKITVRQFAPITRDLHSDQVVDMPALQAAGALGFSNDGVGVQDADTMYQ 160

Query: 171 SMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHT 230
           +M  A  LNA +     D  L   GVIN G +A  L L GI + +E+  LARDL +A  T
Sbjct: 161 AMLQAAKLNAPIVAHIEDASLMHGGVINAGPVAKQLNLPGIINQTESSQLARDLDLAAAT 220

Query: 231 GGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSE 290
           G HYHA  IS  QS+ALI+ AK      T  +S ++L+L+EN++   N + K+ PPLRS 
Sbjct: 221 GVHYHACHISTRQSVALIREAKKRGVNVTAEVSPHHLLLDENNIPGDNPMFKMNPPLRSR 280

Query: 291 TERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLF-HGQQ 349
            + ++++E L+ G +D+I +DH P   + K   F  A+FG +G ET        F   + 
Sbjct: 281 ADHLALLEGLQDGTLDMIATDHAPHTAEEKTGSFKTAAFGIVGSETAFPLLYTKFVKSKM 340

Query: 350 ISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDK 409
            +L++LI  +ST PA  F LPGG +  G  AD+ ++DL   + +   D  S  KN+ F  
Sbjct: 341 FTLQQLIAKMSTIPAAKFGLPGGHITVGGPADLTILDLETSYKIDPADWFSKGKNSPFIG 400

Query: 410 EFFTGKVVRTYISGKQVY 427
           E   G+ + T   G+  Y
Sbjct: 401 EEVQGQALYTISHGQIAY 418


>gi|254468736|ref|ZP_05082142.1| dihydroorotase, multifunctional complex type [beta proteobacterium
           KB13]
 gi|207087546|gb|EDZ64829.1| dihydroorotase, multifunctional complex type [beta proteobacterium
           KB13]
          Length = 424

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 129/428 (30%), Positives = 213/428 (49%), Gaps = 8/428 (1%)

Query: 4   FVLNNTRIIDPSRDIDEVGAIIVENGII--LAAGADALNAKFPTSALIHDCTGLVAVPGI 61
           +++ N  + D + +I     I +  G I       + ++ K      I D T  + VP I
Sbjct: 3   YLIKNINVFDSNSEIQTNQNIYISKGKIENFLHNENNIDKK----CQIIDGTNKLLVPVI 58

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
            D    L    +E+   +      A+AGG+T++   P      LDE + IK  + +    
Sbjct: 59  TDLYSNLKTPGEEHRSILDQEISAAIAGGVTNVCCHP-ATDPVLDEPSLIKNLISKANKI 117

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
             IN+ P A +T N+ G+++SEM+ L + G + F Q+   I DT+VLL + +YA      
Sbjct: 118 FPINIKPFAAITKNLAGEQLSEMKELFDAGAIGFSQAEQPIIDTKVLLRAFEYAKTFGFT 177

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           + L   +++L      NE  IA  LGL G    SE + + + L +++  G   H S IS 
Sbjct: 178 LFLRPAENYLSKNTYANESSIATRLGLKGSNRNSEIIEILKYLALSKDIGTKIHLSKISC 237

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
            +S+ +I+ AK  N   TC +SIN L+ NE D++ YNS   ++PPLRS+ ++  +  +++
Sbjct: 238 RESLEIIEKAKNANINVTCDVSINQLLFNEQDIDGYNSNYHLVPPLRSKIDQKEIFNSIQ 297

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALST 361
              ID I SDH P  +D K+LPF E+  G+   ET L    ++    QI++ KL+  +S 
Sbjct: 298 NDVIDAISSDHCPVDLDKKMLPFEESEPGASSFETFLPLIFKIAQDHQINITKLLSKISL 357

Query: 362 RPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYI 421
            P +I N     L+  +  D  L D +  W      + +  KN  F+ E   G+V  T++
Sbjct: 358 EPYKILNNKKYDLKKCSNIDFCLYDESLSWIPSQSLIKTSGKNIPFEYE-LQGRVSHTFV 416

Query: 422 SGKQVYTL 429
            G+++Y L
Sbjct: 417 DGEKIYEL 424


>gi|226313360|ref|YP_002773254.1| dihydroorotase [Brevibacillus brevis NBRC 100599]
 gi|254788853|sp|C0ZG41|PYRC_BREBN RecName: Full=Dihydroorotase; Short=DHOase
 gi|226096308|dbj|BAH44750.1| dihydroorotase [Brevibacillus brevis NBRC 100599]
          Length = 426

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 135/430 (31%), Positives = 219/430 (50%), Gaps = 13/430 (3%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGA--DALNAKFPTSALIHDCTGLVAVPG 60
             +L N  +++ + ++  +  I+VE G I A G   D     +       DC G +   G
Sbjct: 2   GIILGNGNVLNQAGELTPM-EILVEKGRITAMGETLDRCGHDWI------DCHGGMISAG 54

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +IDA V L     E+ + I T +K AV GG T++  MP    S +D    + Y L++   
Sbjct: 55  LIDAHVHLREPGFEHKETIETGAKAAVQGGFTTVACMPNTRPS-IDSVETVTYILDKASE 113

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLN- 179
             +  V P   +T    GKE+++   L+E GI +     + +  T ++  +M+ A  L  
Sbjct: 114 AGMARVIPYGAITVRQLGKELTDFAGLKEAGIFALTDDGVGVQSTAMMKKAMQKAAELGI 173

Query: 180 AIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVI 239
           AIVA    +  L     +++G++A   GL GIPS SE++ + RD+L+A+ TG HYH   I
Sbjct: 174 AIVAHCEDEDLLIPGAALHDGVVAARHGLPGIPSESESIHVGRDILLAEQTGVHYHVCHI 233

Query: 240 SIPQSIALIKHAKAHNTKATCGISINNLILNENDV-EMYNSLRKVLPPLRSETERMSMVE 298
           S  +S+ L++  K      TC +S ++L+L + D+ +  ++  K+ PPLRS  +R +++ 
Sbjct: 234 SAKESVRLVRDGKRAGVNVTCEVSPHHLLLCDEDIPDNLDTNWKMNPPLRSREDRAALIA 293

Query: 299 ALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIR 357
            L+ G ID+I +DH P   + K      A FG +GLET        L    +++LKKL+ 
Sbjct: 294 GLKDGTIDMIATDHAPHTQEEKANGINRAPFGIVGLETAFPLLYTNLVQTGELTLKKLVE 353

Query: 358 ALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVV 417
            L+ +PA+ F LP G L+ G  AD+ ++DL  + T+     +S   NT F      G   
Sbjct: 354 LLTVKPAEAFKLPYGRLEVGAPADLTVMDLETEKTIDPSTFASKGINTPFAGWVCKGWPT 413

Query: 418 RTYISGKQVY 427
            T + GK VY
Sbjct: 414 LTLVDGKIVY 423


>gi|328955620|ref|YP_004372953.1| dihydroorotase [Coriobacterium glomerans PW2]
 gi|328455944|gb|AEB07138.1| dihydroorotase [Coriobacterium glomerans PW2]
          Length = 430

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 124/424 (29%), Positives = 205/424 (48%), Gaps = 6/424 (1%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGII 62
           + +L N  +IDP+  +D V  + +    I   G + L        L  D TG   VPG++
Sbjct: 2   ALILRNAHVIDPACGLDGVLDVRIAGERIERVG-ERLEGGDSDDQL--DLTGCCLVPGLV 58

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     E+ ++I + ++ A  GG T++  MP       D  + I++ L   R   
Sbjct: 59  DMHVHLREPGYEHKEDIESGTRAAAVGGFTAVCSMP-NTDPVSDSASVIEFVLSRARAAG 117

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
              V+P   +T    G+ +SEM  +   G V+F      +    ++   M Y  M   + 
Sbjct: 118 HCRVHPCGAMTKGERGEILSEMGDMVAHGAVAFTDDGRGVQSAGMMRRVMDYGKMFGKVF 177

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
                D  L   G +NEG+ +  LGL+G P+  E + +ARD+ +A+ TG   H   +S  
Sbjct: 178 MSHCQDEDLVGDGQVNEGVASTKLGLLGWPAAGEELQIARDIRLAELTGARLHIQHVSTA 237

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVE-MYNSLRKVLPPLRSETERMSMVEALE 301
           + + L++ AKA     TC  ++++L L E+D++  Y++  KV PPLR+  +  ++VE L 
Sbjct: 238 RGVELVRAAKARGIPVTCEATVHHLFLTEDDLDGTYDTNLKVNPPLRTAADAAALVEGLV 297

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALS 360
              ID IV+DH P     K   F  A FG  GLE+ L+  + +L     IS  +++  +S
Sbjct: 298 DKTIDAIVTDHAPHAAWEKAREFELAPFGMTGLESSLALVISKLVRPGTISYARMVELMS 357

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
            RP +I  +   ++  G+ AD+ + D N  WT+  D   S  +N  F     TG+ V  +
Sbjct: 358 IRPREILGVDSISITAGSPADVTVFDPNLTWTLGRDGYQSKAENCGFAGTELTGRAVDVF 417

Query: 421 ISGK 424
           +SG+
Sbjct: 418 VSGR 421


>gi|304436902|ref|ZP_07396866.1| dihydroorotase [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304370101|gb|EFM23762.1| dihydroorotase [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 430

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 135/427 (31%), Positives = 223/427 (52%), Gaps = 6/427 (1%)

Query: 1   MTSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPG 60
           M + +L   R+IDP+   +EV  ++VE+G+I A GA+ L+A     A I+D  G V VPG
Sbjct: 1   MRALLLKGGRVIDPASKRNEVADVLVEDGVIRAVGAN-LSAD---GAEIYDAVGKVVVPG 56

Query: 61  IIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRV 120
           +ID          E  ++  + S+ A AGG T+I  MP      +D    +    +    
Sbjct: 57  LIDMHTHFREPGQEAKEDFASGSRAAAAGGYTTIATMP-NTRPVVDTAALVTSLQKRAEE 115

Query: 121 KSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNA 180
            +++++     +T N EGKE++E+  + E G V+F          +VLL++  Y    + 
Sbjct: 116 TAVMHIRIIGAVTKNQEGKELAELGDMVEAGAVAFSDDGHFDPSAKVLLSAYDYLAPFDK 175

Query: 181 IVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVIS 240
            +     D  L   G +NEG  +  LG+ G P ++E + +ARD+++A++ G H H + IS
Sbjct: 176 AIINHEEDTSLVEEGAMNEGHRSAMLGIKGRPIVAEDIAVARDIMLAEYAGAHVHVAHIS 235

Query: 241 IPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEAL 300
             +++ L++ AKA     T  ++ ++L + E+ V+  +S  KV PPLR+E +  +M+  L
Sbjct: 236 SARAVQLVREAKARGVHVTTEVTPHHLTMTEDCVDPTDSSTKVNPPLRTEKDTAAMLAGL 295

Query: 301 EKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRAL 359
             G ID++V+DH+P   + K   +  A  G  GLET L   +  L H  ++ L+ LI  +
Sbjct: 296 LDGTIDMVVTDHSPHAREEKDREYIYAPSGFPGLETALGVLMTELVHTGRLPLETLIERM 355

Query: 360 STRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRT 419
           +  PA+IF+L  GTL+ G  AD+ +ID N  WTV      +   ++ F      GK V T
Sbjct: 356 TYAPARIFHLDAGTLREGAPADVTVIDPNCVWTVDEKKFYTRGSHSPFVGRELRGKAVLT 415

Query: 420 YISGKQV 426
            + G  V
Sbjct: 416 VVDGNIV 422


>gi|224369867|ref|YP_002604031.1| PyrC [Desulfobacterium autotrophicum HRM2]
 gi|259547430|sp|C0QJ54|PYRC_DESAH RecName: Full=Dihydroorotase; Short=DHOase
 gi|223692584|gb|ACN15867.1| PyrC [Desulfobacterium autotrophicum HRM2]
          Length = 426

 Score =  203 bits (516), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 128/428 (29%), Positives = 218/428 (50%), Gaps = 10/428 (2%)

Query: 6   LNNTRIIDPSRDIDEVGAIIVENGII---LAAGADALNAKFPTSALIHDCTGLVAVPGII 62
                I+DP  +I+E   ++V++G++   L  GA        T     D TG++ VPG+I
Sbjct: 5   FKGAHIVDPG-NINEQKDLLVKDGLVHALLDPGAADPEPGIDTV----DVTGMLLVPGLI 59

Query: 63  DARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVKS 122
           D  V L     EY + I T    A  GG T++  MP   S   D     ++ L+  +   
Sbjct: 60  DLHVHLREPGHEYKETIQTGLMAAAKGGFTAVCPMP-NTSPVNDNAQVTRFILDRAKAAG 118

Query: 123 LINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAIV 182
           L  VYP   +T  ++G+ ++E   +++ G+V+       + + +V+  +M+YA  L   V
Sbjct: 119 LSRVYPVGAITLGLKGETLAEYGEMKQAGMVAITDDGRPVENARVMRRAMEYATGLGLPV 178

Query: 183 ALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISIP 242
              + D  L   G +NEG  A  +G+ GIP+ +E++ + R++ IA+ T    H + +S  
Sbjct: 179 MSHSEDLSLARDGAMNEGSFATRIGIKGIPNAAESIMVMREIAIAELTHARVHIAHVSCE 238

Query: 243 QSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALEK 302
           +S+  I+H K    + TC  + +   L +  V  Y++  K+ PPLRSE +R+++++ L+ 
Sbjct: 239 ESVDAIRHGKQRGVQVTCETAPHYFTLTDKAVGDYDTHAKMNPPLRSEADRLAVIKGLQD 298

Query: 303 GDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFHGQQISLKKLIRALSTR 362
           G ID I +DH P     K + F +A+FG IGLET L  +L+L   + +S++ L+  +S  
Sbjct: 299 GTIDCIATDHAPHSPLEKAVEFDQAAFGIIGLETSLVLSLKLVQDELLSMETLVEKMSRN 358

Query: 363 PAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTYIS 422
           PA+   L    L  G  ADI +ID +    +  +   S  +NT F      G+V+ T + 
Sbjct: 359 PARFLGL-DNRLIPGNPADITVIDPDRVHVIDPETFVSKSRNTPFAGIEVKGEVLLTMVE 417

Query: 423 GKQVYTLE 430
           G+ +Y  E
Sbjct: 418 GRIIYQRE 425


>gi|295090690|emb|CBK76797.1| dihydroorotase [Clo