PSIBLAST alignment of GI: 254780301 and protein with PDB id: 1e9y

>gi|16974909|pdb|1E9Y|B Chain B, Crystal Structure Of Helicobacter Pylori Urease In Complex With Acetohydroxamic Acid Length = 569
 Score = 89.3 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/403 (7%), Positives = 84/403 (20%), Gaps = 48/403 (11%)

Query: 3   SFVLNNTRIIDPSRDIDEVGAIIVEN----------------GIILAAGADALNAKFPTS 46
             ++ N  I+D +        I +++                G+         N     +
Sbjct: 67  DLIITNALIVDYTG--IYKADIGIKDGKIAGIGKGGNKDMQDGV-------KNNLSVGPA 117

Query: 47  ALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLD 106
                  GL+   G ID  +         +    +     + GG           ++ + 
Sbjct: 118 TEALAGEGLIVTAGGIDTHIHFISPQQIPTA-FASGVTTMIGGGTGPAD---GTNATTIT 173

Query: 107 EYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQ 166
                   +     +  +N+   A   ++ +     ++        +             
Sbjct: 174 PGRRNLKWMLRAAEEYSMNLGFLAKGNASNDASLADQIEAGAIGFXIHEDWGTTPSAINH 233

Query: 167 VLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLI 226
            L  + KY   +            +        G   +     G         +      
Sbjct: 234 ALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAGGGHAPDIIKVAGEH 293

Query: 227 AQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPP 286
                        ++      +      + K            +    +   +       
Sbjct: 294 NILPASTNPTIPFTVNTEAEHMDMLMVCHHKDKSIKEDVQFADSRIRPQTIAA------- 346

Query: 287 LRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFH 346
                      + L       I S  +        +            +           
Sbjct: 347 ----------EDTLHDMGAFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKEEKGD 396

Query: 347 GQQISLKKLIRALSTRPAQIFNLPG--GTLQTGTAADIALIDL 387
                +K+ +   +  PA    +    G+++ G  AD+ L   
Sbjct: 397 NDNFRIKRYLSKYTINPAIAHGISEYVGSVEVGKVADLVLWSP 439