RPSBLAST alignment for GI: 254780301 and conserved domain: PRK09357

>gnl|CDD|181796 PRK09357, pyrC, dihydroorotase; Validated. Length = 423
 Score =  316 bits (813), Expect = 6e-87
 Identities = 150/427 (35%), Positives = 236/427 (55%), Gaps = 7/427 (1%)

Query: 2   TSFVLNNTRIIDPSRDIDEVGAIIVENGIILAAGADALNAKFPTSALIHDCTGLVAVPGI 61
              ++ N R+IDP   +DEV  +++++G I A G +         A + D TGLV  PG+
Sbjct: 1   MMILIKNGRVIDPK-GLDEVADVLIDDGKIAAIGENI----EAEGAEVIDATGLVVAPGL 55

Query: 62  IDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLDEYTFIKYALEEIRVK 121
           +D  V L     E  + I T S+ A AGG T+++ MP      +D    ++Y L+  +  
Sbjct: 56  VDLHVHLREPGQEDKETIETGSRAAAAGGFTTVVAMP-NTKPVIDTPEVVEYVLDRAKEA 114

Query: 122 SLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQVLLNSMKYAHMLNAI 181
            L++V P   +T  + G+E++E   L+E G+V+F    + + D +++  +++YA  L+ +
Sbjct: 115 GLVDVLPVGAITKGLAGEELTEFGALKEAGVVAFSDDGIPVQDARLMRRALEYAKALDLL 174

Query: 182 VALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLIAQHTGGHYHASVISI 241
           +A    D  L   GV+NEG ++  LGL GIP+++E V +ARD+L+A+ TG   H   +S 
Sbjct: 175 IAQHCEDPSLTEGGVMNEGEVSARLGLPGIPAVAEEVMIARDVLLAEATGARVHICHVST 234

Query: 242 PQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPPLRSETERMSMVEALE 301
             S+ LI+ AKA   K T  ++ ++L+L + D+  Y+   KV PPLR+E +R +++E L+
Sbjct: 235 AGSVELIRWAKALGIKVTAEVTPHHLLLTDEDLLTYDPNYKVNPPLRTEEDREALIEGLK 294

Query: 302 KGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAAL-RLFHGQQISLKKLIRALS 360
            G ID I +DH P   + K   F  A FG  GLET LS     L     + L++L+  ++
Sbjct: 295 DGTIDAIATDHAPHAREEKECEFEAAPFGITGLETALSLLYTTLVKTGLLDLEQLLEKMT 354

Query: 361 TRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNTVFDKEFFTGKVVRTY 420
             PA+I  LP G L  G  AD+ + D   +WTV  +D +S  KNT F      GKVV T 
Sbjct: 355 INPARILGLPAGPLAEGEPADLVIFDPEAEWTVDGEDFASKGKNTPFIGMKLKGKVVYTI 414

Query: 421 ISGKQVY 427
           + GK VY
Sbjct: 415 VDGKIVY 421