RPSBLAST alignment for GI: 254780301 and conserved domain: cd01317

>gnl|CDD|30060 cd01317, DHOase_IIa, Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis. This subgroup also contains proteins that lack the active site, like unc-33, a C.elegans protein involved in axon growth.. Length = 374
 Score =  328 bits (842), Expect = 2e-90
 Identities = 141/374 (37%), Positives = 212/374 (56%), Gaps = 2/374 (0%)

Query: 47  ALIHDCTGLVAVPGIIDARVTLTGSPDEYSKNITTLSKEAVAGGITSIILMPLGMSSFLD 106
           A + D  G +  PG++D  V L     EY + + + +K A AGG T+++ MP   +  +D
Sbjct: 2   AEVIDAEGKILAPGLVDLHVHLREPGFEYKETLESGAKAAAAGGFTTVVCMP-NTNPVID 60

Query: 107 EYTFIKYALEEIRVKSLINVYPTACLTSNMEGKEISEMRLLQEQGIVSFIQSPMSIHDTQ 166
               ++      +   ++ V P   LT  ++G+E++E+  L E G V F      I D +
Sbjct: 61  NPAVVELLKNRAKDVGIVRVLPIGALTKGLKGEELTEIGELLEAGAVGFSDDGKPIQDAE 120

Query: 167 VLLNSMKYAHMLNAIVALDTHDHFLGSRGVINEGIIANYLGLVGIPSISETVPLARDLLI 226
           +L  +++YA ML+  + +   D  L   GV+NEG +A+ LGL GIP  +ET+ +ARDL +
Sbjct: 121 LLRRALEYAAMLDLPIIVHPEDPSLAGGGVMNEGKVASRLGLPGIPPEAETIMVARDLEL 180

Query: 227 AQHTGGHYHASVISIPQSIALIKHAKAHNTKATCGISINNLILNENDVEMYNSLRKVLPP 286
           A+ TG   H   +S  +S+ LI+ AKA     T  ++ ++L+L++  +E Y++  KV PP
Sbjct: 181 AEATGARVHFQHLSTARSLELIRKAKAKGLPVTAEVTPHHLLLDDEALESYDTNAKVNPP 240

Query: 287 LRSETERMSMVEALEKGDIDIIVSDHTPRHMDTKLLPFAEASFGSIGLETMLSAALRLFH 346
           LRSE +R +++EAL+ G ID I SDH P   + K LPFAEA  G IGLET L     L  
Sbjct: 241 LRSEEDREALIEALKDGTIDAIASDHAPHTDEEKDLPFAEAPPGIIGLETALPLLWTLLV 300

Query: 347 -GQQISLKKLIRALSTRPAQIFNLPGGTLQTGTAADIALIDLNYQWTVKADDMSSIHKNT 405
            G  ++L  LIRALST PA+I  LP G L+ G  AD+ L D + +W V  +   S  KNT
Sbjct: 301 KGGLLTLPDLIRALSTNPAKILGLPPGRLEVGAPADLVLFDPDAEWIVDEETFRSKSKNT 360

Query: 406 VFDKEFFTGKVVRT 419
            FD +   G+V+ T
Sbjct: 361 PFDGQKLKGRVLAT 374