RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780303|ref|YP_003064716.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] (77 letters) >gnl|CDD|31101 COG0758, Smf, Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [DNA replication, recombination, and repair / Intracellular trafficking and secretion]. Length = 350 Score = 36.1 bits (83), Expect = 0.002 Identities = 10/46 (21%), Positives = 27/46 (58%) Query: 13 LTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQR 58 ++D ++++WL+L ++N+ P ++ +FG+ E L++ + Sbjct: 1 MSDRERLAWLKLSSTNNLGPLNLLLLLKHFGNKESILKIPLPQLEI 46 >gnl|CDD|173840 cd01151, GCD, Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehydrogenase (GCD). GCD is an acyl-CoA dehydrogenase, which catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and carbon dioxide in the catabolism of lysine, hydroxylysine, and tryptophan. It uses electron transfer flavoprotein (ETF) as an electron acceptor. GCD is a homotetramer. GCD deficiency leads to a severe neurological disorder in humans. Length = 386 Score = 25.8 bits (57), Expect = 3.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 39 INYFGSAEQALEMIPELAQ 57 I FGS EQ + +P+LA Sbjct: 105 IYDFGSEEQKQKYLPKLAS 123 >gnl|CDD|73065 cd02659, peptidase_C19C, A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.. Length = 334 Score = 25.2 bits (55), Expect = 3.6 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 7/31 (22%) Query: 33 ATCRDMINYFGSAEQALEMIPELAQRGAVYA 63 ATC Y S Q L M PE R AVY+ Sbjct: 10 ATC-----YMNSLLQQLYMTPEF--RNAVYS 33 >gnl|CDD|153223 cd03129, GAT1_Peptidase_E_like, Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins. Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins. This group contains proteins similar to the aspartyl dipeptidases Salmonella typhimurium peptidase E and Xenopus laevis peptidase E and, extracellular cyanophycinases from Pseudomonas anguilliseptica BI (CphE) and Synechocystis sp. PCC 6803 CphB. In bacteria peptidase E is believed to play a role in degrading peptides generated by intracellular protein breakdown or imported into the cell as nutrient sources. Peptidase E uniquely hydrolyses only Asp-X dipeptides (where X is any amino acid), and one tripeptide Asp-Gly-Gly. Cyanophycinases are intracellular exopeptidases which hydrolyze the polymer cyanophycin (multi L-arginyl-poly-L-aspartic acid) to the dipeptide beta-Asp-Arg. Peptidase E and cyanophycinases are thought to have a Ser-His-Glu catalytic triad which differs from the Cys-His-Glu catalytic triad typical of GATase1 domains by having a Ser in place of the reactive Cys at the nucleophile elbow. Xenopus peptidase E is developmentally regulated in response to thyroid hormone and, it is thought to play a role in apoptosis during tail reabsorption. Length = 210 Score = 24.6 bits (54), Expect = 5.7 Identities = 6/17 (35%), Positives = 8/17 (47%) Query: 48 ALEMIPELAQRGAVYAG 64 L+ I + RG V G Sbjct: 103 LLDAILKRVARGVVIGG 119 >gnl|CDD|30381 COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism]. Length = 300 Score = 24.3 bits (53), Expect = 6.7 Identities = 12/58 (20%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Query: 9 GGVSLTDDQKISWLRLIRSDNISPATCRDMIN--YFGSAEQALEMIPELAQRGAVYAG 64 G V L+ + + I + + D+I+ S E+A+ LA+ + G Sbjct: 206 GSVLLSGGEGPHKIEGIGAGFVPENLDLDLIDEVIRVSDEEAIATARRLAREEGLLVG 263 >gnl|CDD|48106 cd03179, GST_C_1, GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.. Length = 105 Score = 24.4 bits (53), Expect = 7.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Query: 33 ATCRDMINYFGSAEQALEMIPELAQRGAVYAG 64 AT R + Y G E E++ L +RG Sbjct: 22 ATLRFLRVYLGLGEADAEVLAFLRERGHAALA 53 >gnl|CDD|73063 cd02657, Peptidase_C19A, A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.. Length = 305 Score = 24.5 bits (53), Expect = 7.4 Identities = 11/42 (26%), Positives = 14/42 (33%), Gaps = 5/42 (11%) Query: 34 TCRDMINYFGSAEQALEMIPELAQRGAVYAGKRAFVQKNQQK 75 TC Y S Q L +PEL Y R ++ Sbjct: 8 TC-----YLNSTLQCLRSVPELRDALKNYNPARRGANQSSDN 44 >gnl|CDD|35260 KOG0037, KOG0037, KOG0037, Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]. Length = 221 Score = 24.1 bits (52), Expect = 7.5 Identities = 8/32 (25%), Positives = 11/32 (34%) Query: 13 LTDDQKISWLRLIRSDNISPATCRDMINYFGS 44 + + L S TCR MI+ F Sbjct: 74 ILAKELQQALSNGTWSPFSIETCRLMISMFDR 105 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.130 0.371 Gapped Lambda K H 0.267 0.0583 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 878,576 Number of extensions: 35207 Number of successful extensions: 100 Number of sequences better than 10.0: 1 Number of HSP's gapped: 100 Number of HSP's successfully gapped: 13 Length of query: 77 Length of database: 6,263,737 Length adjustment: 47 Effective length of query: 30 Effective length of database: 5,248,114 Effective search space: 157443420 Effective search space used: 157443420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.7 bits)