RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780303|ref|YP_003064716.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] (77 letters) >gnl|CDD|181323 PRK08250, PRK08250, glutamine amidotransferase; Provisional. Length = 235 Score = 27.2 bits (61), Expect = 0.88 Identities = 11/20 (55%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Query: 31 SPATCRDMINYFGS-AEQAL 49 SP T R+ YF S AEQ L Sbjct: 57 SPRTTREECPYFDSKAEQRL 76 >gnl|CDD|184100 PRK13509, PRK13509, transcriptional repressor UlaR; Provisional. Length = 251 Score = 27.3 bits (61), Expect = 1.0 Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 13 LTDDQKISWLRLIRSDNISPATCRDMIN 40 L ++ ++I ISPAT R IN Sbjct: 14 LAQLGFVTVEKVIERLGISPATARRDIN 41 >gnl|CDD|130852 TIGR01792, urease_alph, urease, alpha subunit. This model describes the urease alpha subunit UreC (designated beta or B chain, UreB in Helicobacter species). Accessory proteins for incorporation of the nickel cofactor are usually found in addition to the urease alpha, beta, and gamma subunits. The trusted cutoff is set above the scores of many reported fragments and of a putative second urease alpha chain in Streptomyces coelicolor. Length = 567 Score = 27.0 bits (60), Expect = 1.2 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Query: 1 MKKM-NPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAE 46 MKK PL G D+ ++ R + I+PA + +Y GS E Sbjct: 381 MKKQRGPLPGDSPGNDNNRV--KRYVAKYTINPAITHGISDYIGSIE 425 >gnl|CDD|178682 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional. Length = 1195 Score = 26.8 bits (59), Expect = 1.3 Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 5/35 (14%) Query: 46 EQALEMIPELAQRGAVY-----AGKRAFVQKNQQK 75 E+ E + E + A Y +RAFVQK K Sbjct: 694 EKVAERLQEFGHKAAFYHGSMDPAQRAFVQKQWSK 728 >gnl|CDD|163340 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase. Members of this protein family are polyribonucleotide nucleotidyltransferase, also called polynucleotide phosphorylase. Some members have been shown also to have additional functions as guanosine pentaphosphate synthetase and as poly(A) polymerase (see model TIGR02696 for an exception clade, within this family). Length = 684 Score = 25.5 bits (57), Expect = 3.0 Identities = 9/25 (36%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Query: 44 SAEQALEMIPELAQR---GAVYAGK 65 +AE A++MI + G +Y GK Sbjct: 601 AAEAAIKMIEGITAEPEVGKIYEGK 625 >gnl|CDD|129757 TIGR00674, dapA, dihydrodipicolinate synthase. Dihydrodipicolinate synthase is a homotetrameric enzyme of lysine biosynthesis. E. coli has several paralogs closely related to dihydrodipicoline synthase (DapA), as well as the more distant N-acetylneuraminate lyase. In Pyrococcus horikoshii, the bidirectional best hit with E. coli is to an uncharacterized paralog of DapA, not DapA itself, and it is omitted from the seed. The putative members from the Chlamydias (pathogens with a parasitic metabolism) are easily the most divergent members of the multiple alignment. Length = 285 Score = 25.4 bits (56), Expect = 3.0 Identities = 7/25 (28%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Query: 29 NISPATCRDMINYF--GSAEQALEM 51 N++P ++M+N G +A E+ Sbjct: 205 NVAPKLMKEMVNNALEGDFAEAREI 229 >gnl|CDD|162696 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase. This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase. The plant form is an alpha2,beta2 heterodimer, allosterically regulated in plants. Both subunits are homologous and included in this model. In bacteria, both homomeric forms of GlgC and more active heterodimers of GlgC and GlgD have been described. This model describes the GlgC subunit only. This enzyme appears in variants of glycogen synthesis pathways that use ADP-glucose, rather than UDP-glucose as in animals. Length = 361 Score = 25.3 bits (56), Expect = 3.8 Identities = 11/40 (27%), Positives = 17/40 (42%), Gaps = 9/40 (22%) Query: 24 LIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGAVYA 63 L+ D P + D FG ++IP + G+V A Sbjct: 204 LLEEDADDPESSHD----FGK-----DIIPRALEEGSVQA 234 >gnl|CDD|162847 TIGR02412, pepN_strep_liv, aminopeptidase N, Streptomyces lividans type. This family is a subset of the members of the zinc metallopeptidase family M1 (pfam01433), with a single member characterized in Streptomyces lividans 66 and designated aminopeptidase N. The spectrum of activity may differ somewhat from the aminopeptidase N clade of E. coli and most other Proteobacteria, well separated phylogenetically within the M1 family. The M1 family also includes leukotriene A-4 hydrolase/aminopeptidase (with a bifunctional active site). Length = 831 Score = 25.1 bits (55), Expect = 4.6 Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 21 WLRLIRSDNISPATCRDMINYFGSAEQALEMIP 53 W +L+ +D + + R +I F EQAL + Sbjct: 723 WQKLVTTDALPNSKQRAIIEGFWQPEQALLLAA 755 >gnl|CDD|180494 PRK06260, PRK06260, threonine synthase; Validated. Length = 397 Score = 24.9 bits (55), Expect = 5.4 Identities = 9/25 (36%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Query: 38 MINYFGSAEQALEMIPELAQRGAVY 62 ++ G+ + AL+M+ ELA+ G +Y Sbjct: 167 EVD--GNFDDALDMVVELAKEGKIY 189 >gnl|CDD|163337 TIGR03586, PseI, pseudaminic acid synthase. Length = 327 Score = 24.6 bits (54), Expect = 6.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Query: 40 NYFGSAEQALEMIPELAQRGA 60 N+ GS E+AL MI GA Sbjct: 11 NHNGSLERALAMIEAAKAAGA 31 >gnl|CDD|182843 PRK10925, PRK10925, superoxide dismutase; Provisional. Length = 206 Score = 24.1 bits (52), Expect = 7.6 Identities = 11/41 (26%), Positives = 18/41 (43%), Gaps = 9/41 (21%) Query: 41 YFGSAEQALEMIPELA---------QRGAVYAGKRAFVQKN 72 Y +A ALE +PE A + + A K+ ++ N Sbjct: 35 YVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNN 75 >gnl|CDD|117577 pfam09011, DUF1898, Domain of unknown function (DUF1898). This domain is predominantly found in Maelstrom homolog proteins. It has no known function. Length = 164 Score = 24.3 bits (52), Expect = 7.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Query: 48 ALEMIPELAQRGAVYAGKR 66 AL+ IPEL +RG AG Sbjct: 15 ALDKIPELRRRGLPVAGVA 33 >gnl|CDD|164866 PHA01751, PHA01751, hypothetical protein. Length = 110 Score = 23.8 bits (51), Expect = 9.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Query: 40 NYFGSAEQALEMIPELAQRGAVYAGKR 66 N FG A++ I EL QRG +Y R Sbjct: 9 NIFGVVRIAIDKIRELEQRGQIYGLSR 35 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.130 0.371 Gapped Lambda K H 0.267 0.0801 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,237,587 Number of extensions: 61791 Number of successful extensions: 172 Number of sequences better than 10.0: 1 Number of HSP's gapped: 172 Number of HSP's successfully gapped: 22 Length of query: 77 Length of database: 5,994,473 Length adjustment: 47 Effective length of query: 30 Effective length of database: 4,978,897 Effective search space: 149366910 Effective search space used: 149366910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (22.9 bits)