RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780303|ref|YP_003064716.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] (77 letters) >d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 105 Score = 26.0 bits (57), Expect = 0.89 Identities = 10/48 (20%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Query: 13 LTDDQKISWLRLIRSDN------ISPATCRDMINYFGSAEQALEMIPE 54 LT +Q I L+ +D + + I +G +AL+ + Sbjct: 1 LTREQLIDIAILVGTDYNEGVKGVGVKKALNYIKTYGDIFRALKALKV 48 >d1wvfa1 d.58.32.1 (A:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} Length = 279 Score = 24.3 bits (52), Expect = 2.8 Identities = 4/13 (30%), Positives = 8/13 (61%) Query: 4 MNPLKGGVSLTDD 16 + P + G+ L +D Sbjct: 266 LAPGRSGIDLNND 278 >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Length = 56 Score = 24.3 bits (53), Expect = 3.1 Identities = 7/35 (20%), Positives = 12/35 (34%), Gaps = 2/35 (5%) Query: 20 SWLRLIRSDNISPATCRDMINYFGSAEQALEMIPE 54 S L I + P + ++ Y G + E Sbjct: 2 SSLETIE--GVGPKRRQMLLKYMGGLQGLRNASVE 34 >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Score = 24.0 bits (51), Expect = 3.3 Identities = 10/38 (26%), Positives = 13/38 (34%) Query: 21 WLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQR 58 + +R N+ RD F Q L P LA Sbjct: 305 FFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATI 342 >d1ih7a2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]} Length = 528 Score = 23.4 bits (49), Expect = 4.9 Identities = 7/50 (14%), Positives = 14/50 (28%) Query: 24 LIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGAVYAGKRAFVQKNQ 73 +IR NISP T + + + + + + Sbjct: 44 IIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRD 93 >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Score = 23.3 bits (48), Expect = 5.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 36 RDMINYFGSAEQALEMIPELAQ 57 ++INY AE A IPEL + Sbjct: 3 VNLINYQDDAELATRAIPELTK 24 >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 272 Score = 23.6 bits (50), Expect = 5.2 Identities = 5/20 (25%), Positives = 7/20 (35%) Query: 18 KISWLRLIRSDNISPATCRD 37 + RL RS +S Sbjct: 18 ALRPGRLFRSSELSRLDDAG 37 >d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 295 Score = 23.1 bits (48), Expect = 6.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 39 INYFGSAEQALEMIPELAQRGA 60 IN+ G +QA +I A+ GA Sbjct: 24 INHDGKLDQAFALIDAAAEAGA 45 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.130 0.371 Gapped Lambda K H 0.267 0.0433 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 272,312 Number of extensions: 10324 Number of successful extensions: 45 Number of sequences better than 10.0: 1 Number of HSP's gapped: 45 Number of HSP's successfully gapped: 13 Length of query: 77 Length of database: 2,407,596 Length adjustment: 44 Effective length of query: 33 Effective length of database: 1,803,476 Effective search space: 59514708 Effective search space used: 59514708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.6 bits)