BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780304|ref|YP_003064717.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] (34 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|320535372|ref|ZP_08035486.1| DNA protecting protein DprA [Treponema phagedenis F0421] gi|320147774|gb|EFW39276.1| DNA protecting protein DprA [Treponema phagedenis F0421] Length = 317 Score = 71.9 bits (177), Expect = 3e-11, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +YP N L +I + GG +SE P G Sbjct: 177 LACGVDRIYPRSNARLAAKIIETGGCILSEYPPG 210 >gi|238019258|ref|ZP_04599684.1| hypothetical protein VEIDISOL_01122 [Veillonella dispar ATCC 17748] gi|237863957|gb|EEP65247.1| hypothetical protein VEIDISOL_01122 [Veillonella dispar ATCC 17748] Length = 408 Score = 71.5 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD +YP EN L + I N G+ +SE P G Sbjct: 179 MGCGLDIVYPRENTKLFDRILQNNGLLVSEYPPG 212 >gi|313892683|ref|ZP_07826266.1| DNA protecting protein DprA [Veillonella sp. oral taxon 158 str. F0412] gi|313442774|gb|EFR61183.1| DNA protecting protein DprA [Veillonella sp. oral taxon 158 str. F0412] Length = 408 Score = 71.5 bits (176), Expect = 4e-11, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD +YP EN L + I N G+ +SE P G Sbjct: 179 MGCGLDIVYPRENTKLFDRILQNNGLLLSEYPPG 212 >gi|299138372|ref|ZP_07031551.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX8] gi|298599618|gb|EFI55777.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX8] Length = 403 Score = 71.1 bits (175), Expect = 4e-11, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP EN+ L E+I GG ISE P G Sbjct: 178 GTGIDVIYPKENKKLAEQIVQQGGALISEFPMG 210 >gi|260424749|ref|ZP_05733144.2| DNA processing protein DprA [Dialister invisus DSM 15470] gi|260403042|gb|EEW96589.1| DNA processing protein DprA [Dialister invisus DSM 15470] Length = 363 Score = 71.1 bits (175), Expect = 5e-11, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YPPEN+NL ++I DNGG ISE P G Sbjct: 170 LACGLDHVYPPENKNLFQKIIDNGGTIISEYPPG 203 >gi|77918023|ref|YP_355838.1| Rossmann-fold nucleotide-binding protein [Pelobacter carbinolicus DSM 2380] gi|77544106|gb|ABA87668.1| DNA protecting protein DprA [Pelobacter carbinolicus DSM 2380] Length = 366 Score = 70.8 bits (174), Expect = 6e-11, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN+ L +I D GG +SE P G Sbjct: 171 LGCGIDRIYPAENKQLFNDILDQGGAILSEYPPG 204 >gi|294791910|ref|ZP_06757058.1| DNA processing protein DprA [Veillonella sp. 6_1_27] gi|294457140|gb|EFG25502.1| DNA processing protein DprA [Veillonella sp. 6_1_27] Length = 408 Score = 69.6 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD YP EN L + I N G+ +SE P G Sbjct: 179 MGCGLDITYPRENAKLFDRILQNNGLLLSEYPPG 212 >gi|319404285|emb|CBI77878.1| DNA processing chain A [Bartonella rochalimae ATCC BAA-1498] Length = 383 Score = 69.6 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 167 MAGGIDHIYPPENQKLYDDILANGGAIISEMPIG 200 >gi|49475582|ref|YP_033623.1| DNA processing chain A [Bartonella henselae str. Houston-1] gi|49238389|emb|CAF27616.1| DNA processing chain A [Bartonella henselae str. Houston-1] Length = 410 Score = 69.2 bits (170), Expect = 2e-10, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YPPEN+ L E+I NGG ISE+P G Sbjct: 184 MAGGIDHIYPPENKKLHEDIIANGGAIISEMPIG 217 >gi|319898957|ref|YP_004159050.1| DNA processing chain A [Bartonella clarridgeiae 73] gi|319402921|emb|CBI76472.1| DNA processing chain A [Bartonella clarridgeiae 73] Length = 383 Score = 69.2 bits (170), Expect = 2e-10, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 157 MAGGIDHIYPPENKKLYDDILANGGAIISEMPIG 190 >gi|269798030|ref|YP_003311930.1| DNA protecting protein DprA [Veillonella parvula DSM 2008] gi|269094659|gb|ACZ24650.1| DNA protecting protein DprA [Veillonella parvula DSM 2008] Length = 408 Score = 68.8 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD YP EN L + + N G+ +SE P G Sbjct: 179 MGCGLDITYPRENAKLFDRMLQNNGLLLSEYPPG 212 >gi|294793770|ref|ZP_06758907.1| DNA processing protein DprA [Veillonella sp. 3_1_44] gi|294455340|gb|EFG23712.1| DNA processing protein DprA [Veillonella sp. 3_1_44] Length = 408 Score = 68.8 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD YP EN L + + N G+ +SE P G Sbjct: 179 MGCGLDITYPRENAKLFDRMLQNNGLLLSEYPPG 212 >gi|197303737|ref|ZP_03168774.1| hypothetical protein RUMLAC_02466 [Ruminococcus lactaris ATCC 29176] gi|197297257|gb|EDY31820.1| hypothetical protein RUMLAC_02466 [Ruminococcus lactaris ATCC 29176] Length = 366 Score = 68.8 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP E+ L +I + GG +SE P G Sbjct: 172 LGCGVDICYPREHIGLYMDILEQGGGILSEFPPG 205 >gi|225849802|ref|YP_002730036.1| protein smf (DNA-processing chain A) [Persephonella marina EX-H1] gi|225645083|gb|ACO03269.1| protein smf (DNA-processing chain A) [Persephonella marina EX-H1] Length = 352 Score = 68.4 bits (168), Expect = 3e-10, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YPPEN+ L E I +N G ISE P G Sbjct: 169 LGCGIDIAYPPENKKLYERIIEN-GAVISEFPMG 201 >gi|282850258|ref|ZP_06259637.1| DNA protecting protein DprA [Veillonella parvula ATCC 17745] gi|282579751|gb|EFB85155.1| DNA protecting protein DprA [Veillonella parvula ATCC 17745] Length = 408 Score = 68.4 bits (168), Expect = 3e-10, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD YP EN L + + N G+ +SE P G Sbjct: 179 MGCGLDITYPRENAKLFDRMLQNNGLLLSEYPPG 212 >gi|303228920|ref|ZP_07315730.1| DNA protecting protein DprA [Veillonella atypica ACS-134-V-Col7a] gi|302516334|gb|EFL58266.1| DNA protecting protein DprA [Veillonella atypica ACS-134-V-Col7a] Length = 378 Score = 68.1 bits (167), Expect = 4e-10, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD +YPPEN+ L + + N G+ +SE P G Sbjct: 180 MGCGLDIVYPPENKRLFDAVLKNNGLLVSEYPPG 213 >gi|303231443|ref|ZP_07318174.1| DNA protecting protein DprA [Veillonella atypica ACS-049-V-Sch6] gi|302513880|gb|EFL55891.1| DNA protecting protein DprA [Veillonella atypica ACS-049-V-Sch6] Length = 378 Score = 68.1 bits (167), Expect = 4e-10, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD +YPPEN+ L + + N G+ +SE P G Sbjct: 180 MGCGLDIVYPPENKRLFDAVLKNNGLLVSEYPPG 213 >gi|153815654|ref|ZP_01968322.1| hypothetical protein RUMTOR_01890 [Ruminococcus torques ATCC 27756] gi|317502440|ref|ZP_07960604.1| smf family protein [Lachnospiraceae bacterium 8_1_57FAA] gi|145847085|gb|EDK24003.1| hypothetical protein RUMTOR_01890 [Ruminococcus torques ATCC 27756] gi|316896178|gb|EFV18285.1| smf family protein [Lachnospiraceae bacterium 8_1_57FAA] Length = 357 Score = 68.1 bits (167), Expect = 4e-10, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP E+ L +I + GG ISE+P G Sbjct: 168 LGCGVDVCYPREHIGLYVDILEQGGGIISEMPPG 201 >gi|192360468|ref|YP_001984037.1| smf protein [Cellvibrio japonicus Ueda107] gi|190686633|gb|ACE84311.1| smf protein [Cellvibrio japonicus Ueda107] Length = 387 Score = 67.7 bits (166), Expect = 5e-10, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G+D +YP +R L ++I GG +SE P G Sbjct: 179 MGTGIDRIYPGRHRTLAQQIIAQGGALVSEFPLG 212 >gi|240850661|ref|YP_002972061.1| DNA processing chain A [Bartonella grahamii as4aup] gi|240267784|gb|ACS51372.1| DNA processing chain A [Bartonella grahamii as4aup] Length = 404 Score = 67.7 bits (166), Expect = 5e-10, Method: Composition-based stats. Identities = 20/33 (60%), Positives = 25/33 (75%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MAGG+D +YPPEN+ L E+I NGG ISE+P Sbjct: 178 MAGGIDHIYPPENKRLYEDIIANGGAIISEMPI 210 >gi|319407290|emb|CBI80931.1| DNA processing chain A [Bartonella sp. 1-1C] Length = 383 Score = 67.7 bits (166), Expect = 5e-10, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 167 MAGGIDYIYPPENQKLYDDILANGGAIISEMPIG 200 >gi|240145514|ref|ZP_04744115.1| DNA processing protein DprA [Roseburia intestinalis L1-82] gi|257202330|gb|EEV00615.1| DNA processing protein DprA [Roseburia intestinalis L1-82] Length = 361 Score = 67.7 bits (166), Expect = 5e-10, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP N + +EI + G ISE P G Sbjct: 170 LGCGVDICYPKSNSRIYQEILEKNGAIISEYPPG 203 >gi|325290385|ref|YP_004266566.1| DNA protecting protein DprA [Syntrophobotulus glycolicus DSM 8271] gi|324965786|gb|ADY56565.1| DNA protecting protein DprA [Syntrophobotulus glycolicus DSM 8271] Length = 383 Score = 67.7 bits (166), Expect = 5e-10, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD +YPPENR L EI +N G ISE P G Sbjct: 172 LAGGLDRIYPPENRKLAAEIIEN-GALISEYPPG 204 >gi|320108287|ref|YP_004183877.1| DNA protecting protein DprA [Terriglobus saanensis SP1PR4] gi|319926808|gb|ADV83883.1| DNA protecting protein DprA [Terriglobus saanensis SP1PR4] Length = 410 Score = 67.7 bits (166), Expect = 6e-10, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP EN+ L EEI GG +SE P G Sbjct: 199 GTGIDVIYPKENKRLAEEILQGGGAIVSEYPLG 231 >gi|319408534|emb|CBI82187.1| DNA processing chain A [Bartonella schoenbuchensis R1] Length = 404 Score = 67.3 bits (165), Expect = 7e-10, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 178 MAGGIDHIYPPENKKLYDDIITNGGAIISEMPVG 211 >gi|326204632|ref|ZP_08194488.1| DNA protecting protein DprA [Clostridium papyrosolvens DSM 2782] gi|325985199|gb|EGD46039.1| DNA protecting protein DprA [Clostridium papyrosolvens DSM 2782] Length = 374 Score = 67.3 bits (165), Expect = 8e-10, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN L +EI D+ G+ +SE P G Sbjct: 171 LGSGLDNIYPQENAGLFKEIIDSKGLVLSEYPPG 204 >gi|118578968|ref|YP_900218.1| DNA protecting protein DprA [Pelobacter propionicus DSM 2379] gi|118501678|gb|ABK98160.1| DNA protecting protein DprA [Pelobacter propionicus DSM 2379] Length = 371 Score = 66.9 bits (164), Expect = 9e-10, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPENR+L +E+ + G +SE P G Sbjct: 177 LGCGIDRIYPPENRDLFDEMAER-GCLVSEFPLG 209 >gi|323140523|ref|ZP_08075450.1| DNA protecting protein DprA [Phascolarctobacterium sp. YIT 12067] gi|322414975|gb|EFY05767.1| DNA protecting protein DprA [Phascolarctobacterium sp. YIT 12067] Length = 385 Score = 66.9 bits (164), Expect = 9e-10, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YPPEN L I + G ++E P G Sbjct: 182 LGCGLDIVYPPENAKLFARIAEQ-GALVTEYPPG 214 >gi|225874954|ref|YP_002756413.1| DNA protecting protein DprA [Acidobacterium capsulatum ATCC 51196] gi|225792046|gb|ACO32136.1| DNA protecting protein DprA [Acidobacterium capsulatum ATCC 51196] Length = 401 Score = 66.9 bits (164), Expect = 9e-10, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP EN+ L E+I GG +SE+P G Sbjct: 190 GTGVDVIYPKENKALAEQIVATGGAIVSELPLG 222 >gi|220929474|ref|YP_002506383.1| DNA protecting protein DprA [Clostridium cellulolyticum H10] gi|219999802|gb|ACL76403.1| DNA protecting protein DprA [Clostridium cellulolyticum H10] Length = 374 Score = 66.9 bits (164), Expect = 1e-09, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 25/34 (73%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YPPEN L ++I D+GG+A+SE P G Sbjct: 171 LGSGLDNIYPPENAGLFKDIIDSGGLALSEYPPG 204 >gi|329121225|ref|ZP_08249852.1| DNA processing protein DprA [Dialister micraerophilus DSM 19965] gi|327470159|gb|EGF15622.1| DNA processing protein DprA [Dialister micraerophilus DSM 19965] Length = 363 Score = 66.9 bits (164), Expect = 1e-09, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP ENRNL E+I +GG ISE G Sbjct: 170 ACGLDKTYPAENRNLFEKIIAHGGCIISEYAPG 202 >gi|68536255|ref|YP_250960.1| putative DNA processing protein [Corynebacterium jeikeium K411] gi|260578955|ref|ZP_05846858.1| DNA processing protein [Corynebacterium jeikeium ATCC 43734] gi|68263854|emb|CAI37342.1| putative DNA processing protein [Corynebacterium jeikeium K411] gi|258602929|gb|EEW16203.1| DNA processing protein [Corynebacterium jeikeium ATCC 43734] Length = 396 Score = 66.9 bits (164), Expect = 1e-09, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MA GLD YP + NL E+I +GG+ ISE P G Sbjct: 198 MACGLDVSYPKAHANLFEQIVGSGGMLISEYPPG 231 >gi|325262840|ref|ZP_08129576.1| DNA processing protein DprA [Clostridium sp. D5] gi|324031934|gb|EGB93213.1| DNA processing protein DprA [Clostridium sp. D5] Length = 360 Score = 66.5 bits (163), Expect = 1e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G++ YP E+ L +I +NGG +SE P G Sbjct: 169 LGCGVNICYPREHIGLYADILENGGGILSEFPPG 202 >gi|261856670|ref|YP_003263953.1| DNA protecting protein DprA [Halothiobacillus neapolitanus c2] gi|261837139|gb|ACX96906.1| DNA protecting protein DprA [Halothiobacillus neapolitanus c2] Length = 384 Score = 66.5 bits (163), Expect = 1e-09, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G D +YP E++ L EI GG+ ISE P G Sbjct: 182 MGTGPDIIYPREHQALAAEIVAQGGLLISEWPPG 215 >gi|254447541|ref|ZP_05061007.1| DNA protecting protein DprA [gamma proteobacterium HTCC5015] gi|198262884|gb|EDY87163.1| DNA protecting protein DprA [gamma proteobacterium HTCC5015] Length = 373 Score = 66.5 bits (163), Expect = 1e-09, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MA G D +YP ++R+L I GG ++E P G Sbjct: 172 MATGADRVYPAKHRDLAHRIVAEGGALVTEFPLG 205 >gi|302338070|ref|YP_003803276.1| DNA protecting protein DprA [Spirochaeta smaragdinae DSM 11293] gi|301635255|gb|ADK80682.1| DNA protecting protein DprA [Spirochaeta smaragdinae DSM 11293] Length = 337 Score = 66.5 bits (163), Expect = 1e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP + L E I GG +SE P G Sbjct: 171 LGSGVDRIYPEAHHRLAERILAEGGGLVSEYPPG 204 >gi|313892558|ref|ZP_07826145.1| DNA protecting protein DprA [Dialister microaerophilus UPII 345-E] gi|313118955|gb|EFR42160.1| DNA protecting protein DprA [Dialister microaerophilus UPII 345-E] Length = 363 Score = 66.1 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP ENRNL E+I +GG ISE G Sbjct: 170 ACGLDKTYPAENRNLFEKIIAHGGCIISEYAPG 202 >gi|322436363|ref|YP_004218575.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX9] gi|321164090|gb|ADW69795.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX9] Length = 404 Score = 66.1 bits (162), Expect = 2e-09, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 20/33 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN+ L EEI GG +SE P G Sbjct: 185 GTGLDVVYPKENKRLAEEIVTGGGAIVSEYPLG 217 >gi|315648145|ref|ZP_07901246.1| DNA protecting protein DprA [Paenibacillus vortex V453] gi|315276791|gb|EFU40134.1| DNA protecting protein DprA [Paenibacillus vortex V453] Length = 391 Score = 66.1 bits (162), Expect = 2e-09, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPENR+L EEI G+ ISE P G Sbjct: 190 LGAGIDVIYPPENRSLYEEIAA-KGLVISEYPPG 222 >gi|291549900|emb|CBL26162.1| DNA protecting protein DprA [Ruminococcus torques L2-14] Length = 370 Score = 66.1 bits (162), Expect = 2e-09, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP ++ L +I ++GG +SE P G Sbjct: 175 LGSGVDVCYPRDHIGLYMDIIEHGGGILSEFPPG 208 >gi|33152875|ref|NP_874228.1| DNA processing chain A [Haemophilus ducreyi 35000HP] gi|33149100|gb|AAP96617.1| smf protein [Haemophilus ducreyi 35000HP] Length = 380 Score = 65.7 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP ++ L E+I NGG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIIANGGALVSEFFP 200 >gi|78222110|ref|YP_383857.1| SMF protein [Geobacter metallireducens GS-15] gi|78193365|gb|ABB31132.1| DNA protecting protein DprA [Geobacter metallireducens GS-15] Length = 358 Score = 65.7 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP ENR L E+ + G +SE P G Sbjct: 170 LGCGVDVVYPAENRQLFREMAEQ-GAVVSEFPLG 202 >gi|88801029|ref|ZP_01116578.1| DNA processing chain A [Reinekea sp. MED297] gi|88776232|gb|EAR07458.1| DNA processing chain A [Reinekea sp. MED297] Length = 368 Score = 65.7 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP NR L E+I G +SE P G Sbjct: 176 LGCGIDVIYPKNNRQLFEDI-ARDGCLVSEYPLG 208 >gi|319405728|emb|CBI79351.1| DNA processing chain A [Bartonella sp. AR 15-3] Length = 383 Score = 65.7 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 167 MAGGIDYIYPPENKKLYDDILTNGGAIISEMPIG 200 >gi|290968766|ref|ZP_06560303.1| DNA protecting protein DprA [Megasphaera genomosp. type_1 str. 28L] gi|290781062|gb|EFD93653.1| DNA protecting protein DprA [Megasphaera genomosp. type_1 str. 28L] Length = 363 Score = 65.7 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 21/33 (63%), Positives = 22/33 (66%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP EN+ L EEI NGG ISE PFG Sbjct: 173 ASGLDITYPRENKKLFEEIAANGGGIISEYPFG 205 >gi|325294278|ref|YP_004280792.1| DNA protecting protein DprA [Desulfurobacterium thermolithotrophum DSM 11699] gi|325064726|gb|ADY72733.1| DNA protecting protein DprA [Desulfurobacterium thermolithotrophum DSM 11699] Length = 337 Score = 65.7 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N +L E I D GG ISE P G Sbjct: 154 LGSGVDSIYPRGNFSLAERIVDTGGAIISEFPLG 187 >gi|257066778|ref|YP_003153034.1| DNA protecting protein DprA [Anaerococcus prevotii DSM 20548] gi|256798658|gb|ACV29313.1| DNA protecting protein DprA [Anaerococcus prevotii DSM 20548] Length = 363 Score = 65.7 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +NR+L I + G+ +SE P G Sbjct: 172 IGCGIDKIYPKQNRDLYRRI-EENGLILSEFPLG 204 >gi|301155615|emb|CBW15083.1| conserved protein [Haemophilus parainfluenzae T3T1] Length = 371 Score = 65.7 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 20/31 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP ++R L E+I +N G +SE Sbjct: 170 LGSGLDHIYPAKHRRLAEQIIENNGALVSEF 200 >gi|190151041|ref|YP_001969566.1| protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|307264403|ref|ZP_07545989.1| hypothetical protein appser13_17940 [Actinobacillus pleuropneumoniae serovar 13 str. N273] gi|189916172|gb|ACE62424.1| Protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|306870219|gb|EFN01977.1| hypothetical protein appser13_17940 [Actinobacillus pleuropneumoniae serovar 13 str. N273] Length = 384 Score = 65.4 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSEFFP 200 >gi|328954307|ref|YP_004371641.1| DNA protecting protein DprA [Desulfobacca acetoxidans DSM 11109] gi|328454631|gb|AEB10460.1| DNA protecting protein DprA [Desulfobacca acetoxidans DSM 11109] Length = 366 Score = 65.4 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN+ L ++I +N G +SE P G Sbjct: 175 LGCGLDVIYPQENKALYQQISEN-GALVSEFPLG 207 >gi|303249954|ref|ZP_07336156.1| protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|303253126|ref|ZP_07339275.1| protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|307248764|ref|ZP_07530777.1| hypothetical protein appser2_17300 [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|307253383|ref|ZP_07535254.1| hypothetical protein appser6_18770 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|307262202|ref|ZP_07543852.1| hypothetical protein appser12_17470 [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|302647808|gb|EFL78015.1| protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|302651017|gb|EFL81171.1| protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306854691|gb|EFM86881.1| hypothetical protein appser2_17300 [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|306859062|gb|EFM91104.1| hypothetical protein appser6_18770 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306868076|gb|EFM99902.1| hypothetical protein appser12_17470 [Actinobacillus pleuropneumoniae serovar 12 str. 1096] Length = 384 Score = 65.4 bits (160), Expect = 3e-09, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSEFFP 200 >gi|32035463|ref|ZP_00135424.1| COG0758: Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|126209176|ref|YP_001054401.1| protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae L20] gi|126097968|gb|ABN74796.1| Protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 5b str. L20] Length = 384 Score = 65.4 bits (160), Expect = 3e-09, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSEFFP 200 >gi|307246636|ref|ZP_07528707.1| hypothetical protein appser1_18320 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|307251006|ref|ZP_07532931.1| hypothetical protein appser4_17690 [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|307255621|ref|ZP_07537426.1| hypothetical protein appser9_18460 [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|307260072|ref|ZP_07541784.1| hypothetical protein appser11_18580 [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|306852508|gb|EFM84742.1| hypothetical protein appser1_18320 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|306856946|gb|EFM89077.1| hypothetical protein appser4_17690 [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|306861470|gb|EFM93459.1| hypothetical protein appser9_18460 [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|306865908|gb|EFM97784.1| hypothetical protein appser11_18580 [Actinobacillus pleuropneumoniae serovar 11 str. 56153] Length = 384 Score = 65.4 bits (160), Expect = 3e-09, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSEFFP 200 >gi|307257797|ref|ZP_07539554.1| hypothetical protein appser10_17820 [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|306863703|gb|EFM95629.1| hypothetical protein appser10_17820 [Actinobacillus pleuropneumoniae serovar 10 str. D13039] Length = 384 Score = 65.4 bits (160), Expect = 3e-09, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSEFFP 200 >gi|292670827|ref|ZP_06604253.1| DNA protecting protein DprA [Selenomonas noxia ATCC 43541] gi|292647448|gb|EFF65420.1| DNA protecting protein DprA [Selenomonas noxia ATCC 43541] Length = 363 Score = 65.4 bits (160), Expect = 3e-09, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YPPENR LL +I ++GG +SE G Sbjct: 172 LGCGVDIAYPPENRRLLSQIVESGGAVLSEYAPG 205 >gi|165977147|ref|YP_001652740.1| Smf protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|165877248|gb|ABY70296.1| Smf protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] Length = 384 Score = 65.4 bits (160), Expect = 3e-09, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSEFFP 200 >gi|83589873|ref|YP_429882.1| DNA processing protein DprA, putative [Moorella thermoacetica ATCC 39073] gi|83572787|gb|ABC19339.1| DNA protecting protein DprA [Moorella thermoacetica ATCC 39073] Length = 361 Score = 65.4 bits (160), Expect = 3e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP E+R L ++ ++ G ISE P G Sbjct: 171 LGCGVDIVYPREHRELYRQVMEH-GAIISEFPPG 203 >gi|329929328|ref|ZP_08283081.1| DNA protecting protein DprA [Paenibacillus sp. HGF5] gi|328936697|gb|EGG33140.1| DNA protecting protein DprA [Paenibacillus sp. HGF5] Length = 391 Score = 65.4 bits (160), Expect = 3e-09, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPENR+L EEI G+ ISE P G Sbjct: 190 LGAGIDVIYPPENRSLYEEIAA-KGLIISEYPPG 222 >gi|254784307|ref|YP_003071735.1| SMF protein [Teredinibacter turnerae T7901] gi|237686231|gb|ACR13495.1| SMF protein [Teredinibacter turnerae T7901] Length = 389 Score = 65.4 bits (160), Expect = 3e-09, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N+ + ++I GG +SE P G Sbjct: 178 LGTGIDQVYPQRNKQMADQIVQTGGALVSEFPLG 211 >gi|325579162|ref|ZP_08149118.1| DNA processing SMF protein [Haemophilus parainfluenzae ATCC 33392] gi|325159397|gb|EGC71531.1| DNA processing SMF protein [Haemophilus parainfluenzae ATCC 33392] Length = 367 Score = 65.4 bits (160), Expect = 3e-09, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 20/31 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP ++R L E+I +N G +SE Sbjct: 170 LGSGLDHIYPAKHRRLAEQIIENNGALVSEF 200 >gi|163868294|ref|YP_001609503.1| DNA processing chain A [Bartonella tribocorum CIP 105476] gi|161017950|emb|CAK01508.1| DNA processing chain A [Bartonella tribocorum CIP 105476] Length = 404 Score = 65.0 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 25/33 (75%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MAGG++ +YPPEN+ L E+I NGG ISE+P Sbjct: 178 MAGGINHIYPPENKKLYEDIIANGGAIISEMPI 210 >gi|148265710|ref|YP_001232416.1| DNA protecting protein DprA [Geobacter uraniireducens Rf4] gi|146399210|gb|ABQ27843.1| DNA protecting protein DprA [Geobacter uraniireducens Rf4] Length = 359 Score = 65.0 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPEN+ L +E+ + G +SE P G Sbjct: 170 LGCGIDVVYPPENQRLFKEMAE-KGALVSEFPMG 202 >gi|322513217|ref|ZP_08066343.1| DNA-processing protein Smf [Actinobacillus ureae ATCC 25976] gi|322120993|gb|EFX92834.1| DNA-processing protein Smf [Actinobacillus ureae ATCC 25976] Length = 384 Score = 65.0 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSEFFP 200 >gi|169830783|ref|YP_001716765.1| DNA protecting protein DprA [Candidatus Desulforudis audaxviator MP104C] gi|169637627|gb|ACA59133.1| DNA protecting protein DprA [Candidatus Desulforudis audaxviator MP104C] Length = 394 Score = 65.0 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN L+E+I +GG+ ++E P G Sbjct: 195 LGSGLDVVYPRENAGLMEKIAASGGLVLTEFPLG 228 >gi|261407992|ref|YP_003244233.1| DNA protecting protein DprA [Paenibacillus sp. Y412MC10] gi|261284455|gb|ACX66426.1| DNA protecting protein DprA [Paenibacillus sp. Y412MC10] Length = 391 Score = 65.0 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPENR+L EEI G+ ISE P G Sbjct: 190 LGAGIDVIYPPENRSLYEEIAA-KGLIISEYPPG 222 >gi|121602381|ref|YP_989130.1| DNA protecting protein DprA [Bartonella bacilliformis KC583] gi|120614558|gb|ABM45159.1| DNA protecting protein DprA [Bartonella bacilliformis KC583] Length = 396 Score = 65.0 bits (159), Expect = 4e-09, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 24/33 (72%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MAGG+D +YP EN+ L +I DNGG ISE+P Sbjct: 172 MAGGIDHIYPSENKKLYNDIIDNGGAIISEMPI 204 >gi|157372743|ref|YP_001480732.1| DNA protecting protein DprA [Serratia proteamaculans 568] gi|157324507|gb|ABV43604.1| DNA protecting protein DprA [Serratia proteamaculans 568] Length = 373 Score = 65.0 bits (159), Expect = 4e-09, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP +R L E I +NGG ISE Sbjct: 167 LGSGLDNIYPRRHRRLAERIVENGGALISEY 197 >gi|313888012|ref|ZP_07821690.1| DNA protecting protein DprA [Peptoniphilus harei ACS-146-V-Sch2b] gi|312845967|gb|EFR33350.1| DNA protecting protein DprA [Peptoniphilus harei ACS-146-V-Sch2b] Length = 359 Score = 65.0 bits (159), Expect = 4e-09, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N+ L EEI + G ISE P G Sbjct: 172 LGTGIDVIYPKSNKALYEEISE-KGAVISEFPLG 204 >gi|269836418|ref|YP_003318646.1| DNA protecting protein DprA [Sphaerobacter thermophilus DSM 20745] gi|269785681|gb|ACZ37824.1| DNA protecting protein DprA [Sphaerobacter thermophilus DSM 20745] Length = 359 Score = 64.6 bits (158), Expect = 4e-09, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPE+R L E+ G +SE P G Sbjct: 171 LGSGVDVIYPPEHRQLAEQ-VAQQGALVSEFPLG 203 >gi|281412306|ref|YP_003346385.1| DNA protecting protein DprA [Thermotoga naphthophila RKU-10] gi|281373409|gb|ADA66971.1| DNA protecting protein DprA [Thermotoga naphthophila RKU-10] Length = 337 Score = 64.6 bits (158), Expect = 4e-09, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N L EI N G +SE P G Sbjct: 156 LGTGVDVVYPRSNERLFHEIVKN-GCVVSEYPMG 188 >gi|148269810|ref|YP_001244270.1| DNA protecting protein DprA [Thermotoga petrophila RKU-1] gi|147735354|gb|ABQ46694.1| DNA protecting protein DprA [Thermotoga petrophila RKU-1] Length = 337 Score = 64.6 bits (158), Expect = 4e-09, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N L EI N G +SE P G Sbjct: 156 LGTGVDVVYPRSNERLFHEIVKN-GCVVSEYPMG 188 >gi|15643022|ref|NP_228064.1| DNA processing chain A [Thermotoga maritima MSB8] gi|170288496|ref|YP_001738734.1| DNA protecting protein DprA [Thermotoga sp. RQ2] gi|4980749|gb|AAD35341.1|AE001708_9 DNA processing chain A [Thermotoga maritima MSB8] gi|170175999|gb|ACB09051.1| DNA protecting protein DprA [Thermotoga sp. RQ2] Length = 337 Score = 64.6 bits (158), Expect = 4e-09, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N L EI N G +SE P G Sbjct: 156 LGTGVDVVYPRSNERLFHEIVKN-GCVVSEYPMG 188 >gi|222054654|ref|YP_002537016.1| DNA protecting protein DprA [Geobacter sp. FRC-32] gi|221563943|gb|ACM19915.1| DNA protecting protein DprA [Geobacter sp. FRC-32] Length = 359 Score = 64.6 bits (158), Expect = 4e-09, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPENR L +E+ + G +SE P G Sbjct: 170 LGCGIDIVYPPENRPLFKEM-EEKGALVSEFPMG 202 >gi|167630278|ref|YP_001680777.1| DNA processing protein dpra, putative [Heliobacterium modesticaldum Ice1] gi|167593018|gb|ABZ84766.1| DNA processing protein dpra, putative [Heliobacterium modesticaldum Ice1] Length = 378 Score = 64.6 bits (158), Expect = 4e-09, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPPE+ L I + G +SE P G Sbjct: 179 LAGGVDVIYPPEHGKLASRIVEQ-GALVSEYPPG 211 >gi|262089745|gb|ACY24839.1| Smf protein [uncultured organism] Length = 382 Score = 64.6 bits (158), Expect = 4e-09, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD +YP +R L ++I D GG +SE+P G Sbjct: 179 MGTGLDMIYPSRHRALAQQIVDIGGALVSELPLG 212 >gi|325479008|gb|EGC82109.1| DNA protecting protein DprA [Anaerococcus prevotii ACS-065-V-Col13] Length = 365 Score = 64.6 bits (158), Expect = 5e-09, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +N++L I + G+ +SE P G Sbjct: 174 IGCGIDKIYPKQNKDLYRRI-EENGLILSEFPLG 206 >gi|153010990|ref|YP_001372204.1| DNA protecting protein DprA [Ochrobactrum anthropi ATCC 49188] gi|151562878|gb|ABS16375.1| DNA protecting protein DprA [Ochrobactrum anthropi ATCC 49188] Length = 388 Score = 64.6 bits (158), Expect = 5e-09, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLDC YPPEN L I + GG ISE+P G Sbjct: 178 LAGGLDCPYPPENLPLYHAIPEQGGALISEMPMG 211 >gi|258511359|ref|YP_003184793.1| DNA protecting protein DprA [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] gi|257478085|gb|ACV58404.1| DNA protecting protein DprA [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] Length = 366 Score = 64.2 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YPP NR L ++I + G +SE P G Sbjct: 175 LGCGIDRCYPPSNRRLYDQI-ASTGTLVSEYPPG 207 >gi|255659254|ref|ZP_05404663.1| DNA processing protein DprA [Mitsuokella multacida DSM 20544] gi|260848709|gb|EEX68716.1| DNA processing protein DprA [Mitsuokella multacida DSM 20544] Length = 365 Score = 64.2 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP ENR LL EI ++GG ISE G Sbjct: 174 LGCGIDVAYPAENRRLLMEIAESGGAVISEYGPG 207 >gi|255526680|ref|ZP_05393584.1| DNA protecting protein DprA [Clostridium carboxidivorans P7] gi|296185600|ref|ZP_06854009.1| DNA protecting protein DprA [Clostridium carboxidivorans P7] gi|255509612|gb|EET85948.1| DNA protecting protein DprA [Clostridium carboxidivorans P7] gi|296049728|gb|EFG89153.1| DNA protecting protein DprA [Clostridium carboxidivorans P7] Length = 364 Score = 64.2 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG+D +YP E+ L+EEI G ISE P G Sbjct: 171 LGGGVDKVYPKEHIKLMEEIIA-KGAVISEYPPG 203 >gi|257469331|ref|ZP_05633425.1| Smf protein [Fusobacterium ulcerans ATCC 49185] Length = 352 Score = 64.2 bits (157), Expect = 6e-09, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ENR L E+I + G+ ISE P G Sbjct: 167 GSGLDIIYPKENRILWEQI-ERSGLIISEYPLG 198 >gi|332981422|ref|YP_004462863.1| DNA protecting protein DprA [Mahella australiensis 50-1 BON] gi|332699100|gb|AEE96041.1| DNA protecting protein DprA [Mahella australiensis 50-1 BON] Length = 366 Score = 64.2 bits (157), Expect = 6e-09, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPE++ L +I + G ISE P G Sbjct: 175 LGCGVDMIYPPEHKPLYYDIISH-GAVISEFPPG 207 >gi|317063578|ref|ZP_07928063.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185] gi|313689254|gb|EFS26089.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185] Length = 355 Score = 64.2 bits (157), Expect = 6e-09, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ENR L E+I + G+ ISE P G Sbjct: 170 GSGLDIIYPKENRILWEQI-ERSGLIISEYPLG 201 >gi|293602355|ref|ZP_06684801.1| DNA protecting protein DprA [Achromobacter piechaudii ATCC 43553] gi|292819117|gb|EFF78152.1| DNA protecting protein DprA [Achromobacter piechaudii ATCC 43553] Length = 370 Score = 64.2 bits (157), Expect = 6e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G+D +YP +R L I + G +SE P G Sbjct: 182 MGTGIDRIYPARHRELAHRIAAH-GALVSEFPLG 214 >gi|291533226|emb|CBL06339.1| DNA protecting protein DprA [Megamonas hypermegale ART12/1] Length = 368 Score = 64.2 bits (157), Expect = 6e-09, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP EN+ LLE I G ISE P Sbjct: 169 LGCGLDIIYPKENKQLLEAI-AQNGAVISEYPL 200 >gi|90019672|ref|YP_525499.1| filamentous hemagglutinin-like protein [Saccharophagus degradans 2-40] gi|89949272|gb|ABD79287.1| DNA processing protein DprA, putative [Saccharophagus degradans 2-40] Length = 399 Score = 64.2 bits (157), Expect = 6e-09, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N L EI NGG +SE P G Sbjct: 197 IGTGIDSVYPQRNSALASEIIANGGAIVSEFPLG 230 >gi|89895301|ref|YP_518788.1| hypothetical protein DSY2555 [Desulfitobacterium hafniense Y51] gi|219669735|ref|YP_002460170.1| DNA protecting protein DprA [Desulfitobacterium hafniense DCB-2] gi|89334749|dbj|BAE84344.1| hypothetical protein [Desulfitobacterium hafniense Y51] gi|219539995|gb|ACL21734.1| DNA protecting protein DprA [Desulfitobacterium hafniense DCB-2] Length = 389 Score = 64.2 bits (157), Expect = 7e-09, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GL+ +YPPEN+ L EEI GG SE P G Sbjct: 182 MGCGLNHMYPPENQKLAEEILAKGGALWSEFPPG 215 >gi|332285820|ref|YP_004417731.1| hypothetical protein PT7_2567 [Pusillimonas sp. T7-7] gi|330429773|gb|AEC21107.1| hypothetical protein PT7_2567 [Pusillimonas sp. T7-7] Length = 389 Score = 63.8 bits (156), Expect = 7e-09, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G+D +YP NR+L I G+ ISE P G Sbjct: 182 MGTGIDIVYPARNRDLAHRI-AQDGLLISEFPLG 214 >gi|253579631|ref|ZP_04856900.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA] gi|251849132|gb|EES77093.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA] Length = 305 Score = 63.8 bits (156), Expect = 7e-09, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 17/34 (50%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP NR L E I G ISE P G Sbjct: 114 LGSGVDVCYPKSNRKLYERILWENGGIISECPLG 147 >gi|218288280|ref|ZP_03492579.1| DNA protecting protein DprA [Alicyclobacillus acidocaldarius LAA1] gi|218241639|gb|EED08812.1| DNA protecting protein DprA [Alicyclobacillus acidocaldarius LAA1] Length = 366 Score = 63.8 bits (156), Expect = 7e-09, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YPP NR L ++I + G +SE P G Sbjct: 175 LGCGIDRCYPPSNRRLYDQI-ASTGTLVSEYPPG 207 >gi|323701838|ref|ZP_08113508.1| DNA protecting protein DprA [Desulfotomaculum nigrificans DSM 574] gi|323533142|gb|EGB23011.1| DNA protecting protein DprA [Desulfotomaculum nigrificans DSM 574] Length = 363 Score = 63.8 bits (156), Expect = 7e-09, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP EN L+++I + G ISE P G Sbjct: 172 LGCGPDVVYPKENARLMDKIIEQ-GAVISEFPPG 204 >gi|237755691|ref|ZP_04584300.1| DNA protecting protein DprA [Sulfurihydrogenibium yellowstonense SS-5] gi|237692141|gb|EEP61140.1| DNA protecting protein DprA [Sulfurihydrogenibium yellowstonense SS-5] Length = 356 Score = 63.8 bits (156), Expect = 7e-09, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN+ L EEI + G ISE PFG Sbjct: 171 LGNGIDIVYPYENKKLYEEISE-KGCIISEFPFG 203 >gi|188996508|ref|YP_001930759.1| DNA protecting protein DprA [Sulfurihydrogenibium sp. YO3AOP1] gi|188931575|gb|ACD66205.1| DNA protecting protein DprA [Sulfurihydrogenibium sp. YO3AOP1] Length = 356 Score = 63.8 bits (156), Expect = 7e-09, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN+ L EEI + G ISE PFG Sbjct: 171 LGNGIDIVYPYENKKLYEEISE-KGCIISEFPFG 203 >gi|261491953|ref|ZP_05988530.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia haemolytica serotype A2 str. BOVINE] gi|261496244|ref|ZP_05992649.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia haemolytica serotype A2 str. OVINE] gi|261308075|gb|EEY09373.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia haemolytica serotype A2 str. OVINE] gi|261312420|gb|EEY13546.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 381 Score = 63.8 bits (156), Expect = 8e-09, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLNRIYPARHQKLAEQIVESGGALVSEFSP 200 >gi|147677580|ref|YP_001211795.1| Rossmann fold nucleotide-binding protein [Pelotomaculum thermopropionicum SI] gi|146273677|dbj|BAF59426.1| predicted Rossmann fold nucleotide-binding protein [Pelotomaculum thermopropionicum SI] Length = 367 Score = 63.8 bits (156), Expect = 8e-09, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP ENR L+E+I N G ISE P G Sbjct: 172 LGCGPDVVYPRENRRLMEKII-NNGAVISEYPPG 204 >gi|227499921|ref|ZP_03930014.1| SMF family DNA processing protein [Anaerococcus tetradius ATCC 35098] gi|227218030|gb|EEI83303.1| SMF family DNA processing protein [Anaerococcus tetradius ATCC 35098] Length = 363 Score = 63.8 bits (156), Expect = 8e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +NR+L I + G+ +SE P G Sbjct: 172 IGCGIDKIYPKKNRDLYRRI-EESGLILSEFPLG 204 >gi|295111023|emb|CBL27773.1| DNA protecting protein DprA [Synergistetes bacterium SGP1] Length = 363 Score = 63.8 bits (156), Expect = 8e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP E+R L +I + G +SE P G Sbjct: 168 LGTGIDRVYPMEHRELFAQIAET-GALVSEYPMG 200 >gi|297617128|ref|YP_003702287.1| DNA protecting protein DprA [Syntrophothermus lipocalidus DSM 12680] gi|297144965|gb|ADI01722.1| DNA protecting protein DprA [Syntrophothermus lipocalidus DSM 12680] Length = 366 Score = 63.8 bits (156), Expect = 8e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN+ L I + G+ +SE P G Sbjct: 173 LGSGIDVVYPRENKGLYSRIAET-GVVVSEFPPG 205 >gi|312876485|ref|ZP_07736468.1| DNA protecting protein DprA [Caldicellulosiruptor lactoaceticus 6A] gi|311796696|gb|EFR13042.1| DNA protecting protein DprA [Caldicellulosiruptor lactoaceticus 6A] Length = 365 Score = 63.8 bits (156), Expect = 8e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN L +I +N G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIEN-GCVVSEFLPG 203 >gi|312792638|ref|YP_004025561.1| DNA protecting protein dpra [Caldicellulosiruptor kristjanssonii 177R1B] gi|312179778|gb|ADQ39948.1| DNA protecting protein DprA [Caldicellulosiruptor kristjanssonii 177R1B] Length = 365 Score = 63.8 bits (156), Expect = 8e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN L +I +N G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIEN-GCVVSEFLPG 203 >gi|312621559|ref|YP_004023172.1| DNA protecting protein dpra [Caldicellulosiruptor kronotskyensis 2002] gi|312202026|gb|ADQ45353.1| DNA protecting protein DprA [Caldicellulosiruptor kronotskyensis 2002] Length = 365 Score = 63.8 bits (156), Expect = 8e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN L +I +N G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIEN-GCVVSEFLPG 203 >gi|312126810|ref|YP_003991684.1| DNA protecting protein dpra [Caldicellulosiruptor hydrothermalis 108] gi|311776829|gb|ADQ06315.1| DNA protecting protein DprA [Caldicellulosiruptor hydrothermalis 108] Length = 365 Score = 63.8 bits (156), Expect = 8e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN L +I +N G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIEN-GCVVSEFLPG 203 >gi|312135863|ref|YP_004003201.1| DNA protecting protein dpra [Caldicellulosiruptor owensensis OL] gi|311775914|gb|ADQ05401.1| DNA protecting protein DprA [Caldicellulosiruptor owensensis OL] Length = 365 Score = 63.8 bits (156), Expect = 8e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN L +I +N G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIEN-GCVVSEFLPG 203 >gi|222530148|ref|YP_002574030.1| DNA protecting protein DprA [Caldicellulosiruptor bescii DSM 6725] gi|222456995|gb|ACM61257.1| DNA protecting protein DprA [Caldicellulosiruptor bescii DSM 6725] Length = 365 Score = 63.8 bits (156), Expect = 8e-09, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN L +I +N G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIEN-GCVVSEFLPG 203 >gi|328676429|gb|AEB27299.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Francisella cf. novicida Fx1] Length = 368 Score = 63.8 bits (156), Expect = 9e-09, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 175 GTGVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|254373799|ref|ZP_04989282.1| DNA processing protein DprA [Francisella novicida GA99-3548] gi|151571520|gb|EDN37174.1| DNA processing protein DprA [Francisella novicida GA99-3548] Length = 368 Score = 63.8 bits (156), Expect = 9e-09, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 175 GTGVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|254372325|ref|ZP_04987816.1| DNA uptake protein [Francisella tularensis subsp. novicida GA99-3549] gi|151570054|gb|EDN35708.1| DNA uptake protein [Francisella novicida GA99-3549] Length = 368 Score = 63.8 bits (156), Expect = 9e-09, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 175 GTGVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|254370428|ref|ZP_04986433.1| predicted protein [Francisella tularensis subsp. tularensis FSC033] gi|151568671|gb|EDN34325.1| predicted protein [Francisella tularensis subsp. tularensis FSC033] Length = 228 Score = 63.8 bits (156), Expect = 9e-09, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 175 GTGVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|167009201|ref|ZP_02274132.1| DNA processing protein DprA [Francisella tularensis subsp. holarctica FSC200] gi|254367122|ref|ZP_04983155.1| DNA uptake protein, SMF family [Francisella tularensis subsp. holarctica 257] gi|134252945|gb|EBA52039.1| DNA uptake protein, SMF family [Francisella tularensis subsp. holarctica 257] Length = 245 Score = 63.8 bits (156), Expect = 9e-09, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 75 GTGVDVVYPSSNRELYNKIINTNGLIISEFPLG 107 >gi|134302268|ref|YP_001122237.1| DNA processing protein DprA [Francisella tularensis subsp. tularensis WY96-3418] gi|134050045|gb|ABO47116.1| DNA processing protein DprA [Francisella tularensis subsp. tularensis WY96-3418] Length = 368 Score = 63.8 bits (156), Expect = 9e-09, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 175 GTGVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|118496955|ref|YP_898005.1| SMF family DNA uptake protein [Francisella tularensis subsp. novicida U112] gi|194324184|ref|ZP_03057958.1| DNA protecting protein DprA, putative [Francisella tularensis subsp. novicida FTE] gi|118422861|gb|ABK89251.1| DNA uptake protein, SMF family [Francisella novicida U112] gi|194321631|gb|EDX19115.1| DNA protecting protein DprA, putative [Francisella tularensis subsp. novicida FTE] Length = 368 Score = 63.8 bits (156), Expect = 9e-09, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 175 GTGVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|290954217|ref|ZP_06558838.1| DNA processing protein DprA [Francisella tularensis subsp. holarctica URFT1] gi|295312381|ref|ZP_06803163.1| DNA processing protein DprA [Francisella tularensis subsp. holarctica URFT1] Length = 268 Score = 63.4 bits (155), Expect = 9e-09, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 75 GTGVDVVYPSSNRELYNKIINTNGLIISEFPLG 107 >gi|262197810|ref|YP_003269019.1| SMF family protein [Haliangium ochraceum DSM 14365] gi|262081157|gb|ACY17126.1| SMF family protein [Haliangium ochraceum DSM 14365] Length = 297 Score = 63.4 bits (155), Expect = 9e-09, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D +YP +R L E+ +GG ISE P Sbjct: 107 LGCGIDVVYPARHRALYHEVCASGGALISEFP 138 >gi|148654174|ref|YP_001281267.1| DNA protecting protein DprA [Psychrobacter sp. PRwf-1] gi|148573258|gb|ABQ95317.1| DNA protecting protein DprA [Psychrobacter sp. PRwf-1] Length = 421 Score = 63.4 bits (155), Expect = 9e-09, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G+D YP +++ L + + GG +SE+ G Sbjct: 186 MGTGIDVCYPKQHQALFDRMIAEGGCIVSELFPG 219 >gi|260427296|ref|ZP_05781275.1| protein smf [Citreicella sp. SE45] gi|260421788|gb|EEX15039.1| protein smf [Citreicella sp. SE45] Length = 398 Score = 63.4 bits (155), Expect = 1e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D LYP EN L EEI GG +SE P G Sbjct: 182 LAGGVDVLYPSENTRLAEEIRAQGGAVVSEQPIG 215 >gi|225848022|ref|YP_002728185.1| DNA protecting protein DprA [Sulfurihydrogenibium azorense Az-Fu1] gi|225643199|gb|ACN98249.1| DNA protecting protein DprA [Sulfurihydrogenibium azorense Az-Fu1] Length = 356 Score = 63.4 bits (155), Expect = 1e-08, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP ENR L ++I +N G ISE P G Sbjct: 171 LGSGIDVVYPFENRKLYDKITEN-GCVISEFPIG 203 >gi|197123196|ref|YP_002135147.1| DNA protecting protein DprA [Anaeromyxobacter sp. K] gi|196173045|gb|ACG74018.1| DNA protecting protein DprA [Anaeromyxobacter sp. K] Length = 312 Score = 63.4 bits (155), Expect = 1e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP ++R L E I + GG +SE+P G Sbjct: 120 LGTGVDVVYPRQHRALFERIVEAGGALVSELPDG 153 >gi|258517150|ref|YP_003193372.1| DNA protecting protein DprA [Desulfotomaculum acetoxidans DSM 771] gi|257780855|gb|ACV64749.1| DNA protecting protein DprA [Desulfotomaculum acetoxidans DSM 771] Length = 368 Score = 63.4 bits (155), Expect = 1e-08, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D YP E+R L++ I + G+ +SE P Sbjct: 171 LGCGVDVCYPAEHRGLMDRIAEE-GVLLSEYPP 202 >gi|258517114|ref|YP_003193336.1| Mg chelatase, subunit ChlI [Desulfotomaculum acetoxidans DSM 771] gi|257780819|gb|ACV64713.1| Mg chelatase, subunit ChlI [Desulfotomaculum acetoxidans DSM 771] Length = 748 Score = 63.4 bits (155), Expect = 1e-08, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D YP E+R L++ I + G+ +SE P Sbjct: 551 LGCGVDVCYPAEHRGLMDRIAEE-GVLLSEYPP 582 >gi|94970368|ref|YP_592416.1| DNA processing protein DprA, putative [Candidatus Koribacter versatilis Ellin345] gi|94552418|gb|ABF42342.1| DNA protecting protein DprA [Candidatus Koribacter versatilis Ellin345] Length = 385 Score = 63.4 bits (155), Expect = 1e-08, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N+ L E+I + GG ISE P G Sbjct: 180 GTGVDEIYPRANKKLAEQIVEFGGALISEFPTG 212 >gi|254720411|ref|ZP_05182222.1| SMF protein [Brucella sp. 83/13] gi|265985430|ref|ZP_06098165.1| DNA protecting protein DprA [Brucella sp. 83/13] gi|306839012|ref|ZP_07471833.1| DNA protecting protein DprA [Brucella sp. NF 2653] gi|264664022|gb|EEZ34283.1| DNA protecting protein DprA [Brucella sp. 83/13] gi|306405918|gb|EFM62176.1| DNA protecting protein DprA [Brucella sp. NF 2653] Length = 393 Score = 63.4 bits (155), Expect = 1e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|306845936|ref|ZP_07478503.1| DNA protecting protein DprA [Brucella sp. BO1] gi|306273571|gb|EFM55416.1| DNA protecting protein DprA [Brucella sp. BO1] Length = 393 Score = 63.4 bits (155), Expect = 1e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|23500346|ref|NP_699786.1| DNA processing protein DprA [Brucella suis 1330] gi|161620664|ref|YP_001594550.1| DNA protecting protein DprA [Brucella canis ATCC 23365] gi|254702977|ref|ZP_05164805.1| DNA protecting protein DprA [Brucella suis bv. 3 str. 686] gi|260568110|ref|ZP_05838579.1| SMF protein [Brucella suis bv. 4 str. 40] gi|261753586|ref|ZP_05997295.1| DNA protecting protein DprA [Brucella suis bv. 3 str. 686] gi|23463962|gb|AAN33791.1| DNA processing protein DprA, putative [Brucella suis 1330] gi|161337475|gb|ABX63779.1| DNA protecting protein DprA [Brucella canis ATCC 23365] gi|260154775|gb|EEW89856.1| SMF protein [Brucella suis bv. 4 str. 40] gi|261743339|gb|EEY31265.1| DNA protecting protein DprA [Brucella suis bv. 3 str. 686] Length = 393 Score = 63.4 bits (155), Expect = 1e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|294853600|ref|ZP_06794272.1| DNA processing protein [Brucella sp. NVSL 07-0026] gi|294819255|gb|EFG36255.1| DNA processing protein [Brucella sp. NVSL 07-0026] Length = 393 Score = 63.4 bits (155), Expect = 1e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|254699839|ref|ZP_05161667.1| SMF protein [Brucella suis bv. 5 str. 513] gi|261750312|ref|ZP_05994021.1| DNA protecting protein DprA [Brucella suis bv. 5 str. 513] gi|261740065|gb|EEY27991.1| DNA protecting protein DprA [Brucella suis bv. 5 str. 513] Length = 393 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|225686388|ref|YP_002734360.1| DNA protecting protein DprA [Brucella melitensis ATCC 23457] gi|256262471|ref|ZP_05465003.1| SMF protein [Brucella melitensis bv. 2 str. 63/9] gi|225642493|gb|ACO02406.1| DNA protecting protein DprA [Brucella melitensis ATCC 23457] gi|263092207|gb|EEZ16504.1| SMF protein [Brucella melitensis bv. 2 str. 63/9] Length = 393 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|49474246|ref|YP_032288.1| DNA processing chain A [Bartonella quintana str. Toulouse] gi|49239750|emb|CAF26132.1| DNA processing chain A [Bartonella quintana str. Toulouse] Length = 410 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 25/33 (75%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MAGG+D +YPPEN+ L E+I +GG ISE+P Sbjct: 184 MAGGVDHIYPPENKKLHEDIITHGGAIISEMPI 216 >gi|17989012|ref|NP_541645.1| SMF protein [Brucella melitensis bv. 1 str. 16M] gi|62317541|ref|YP_223394.1| DNA processing protein DprA [Brucella abortus bv. 1 str. 9-941] gi|83269522|ref|YP_418813.1| SMF protein [Brucella melitensis biovar Abortus 2308] gi|189022796|ref|YP_001932537.1| SMF protein [Brucella abortus S19] gi|225629094|ref|ZP_03787127.1| DNA protecting protein DprA [Brucella ceti str. Cudo] gi|237817089|ref|ZP_04596081.1| DNA protecting protein DprA [Brucella abortus str. 2308 A] gi|254698822|ref|ZP_05160650.1| SMF protein [Brucella abortus bv. 2 str. 86/8/59] gi|254705901|ref|ZP_05167729.1| SMF protein [Brucella pinnipedialis M163/99/10] gi|254711129|ref|ZP_05172940.1| SMF protein [Brucella pinnipedialis B2/94] gi|254712412|ref|ZP_05174223.1| SMF protein [Brucella ceti M644/93/1] gi|254715484|ref|ZP_05177295.1| SMF protein [Brucella ceti M13/05/1] gi|254732269|ref|ZP_05190847.1| SMF protein [Brucella abortus bv. 4 str. 292] gi|256015379|ref|YP_003105388.1| DNA processing protein DprA, putative [Brucella microti CCM 4915] gi|256029510|ref|ZP_05443124.1| SMF protein [Brucella pinnipedialis M292/94/1] gi|256043499|ref|ZP_05446426.1| SMF protein [Brucella melitensis bv. 1 str. Rev.1] gi|256059205|ref|ZP_05449411.1| SMF protein [Brucella neotomae 5K33] gi|256157705|ref|ZP_05455623.1| SMF protein [Brucella ceti M490/95/1] gi|256253323|ref|ZP_05458859.1| SMF protein [Brucella ceti B1/94] gi|256256223|ref|ZP_05461759.1| SMF protein [Brucella abortus bv. 9 str. C68] gi|260167399|ref|ZP_05754210.1| DNA processing protein DprA, putative [Brucella sp. F5/99] gi|260544777|ref|ZP_05820598.1| SMF protein [Brucella abortus NCTC 8038] gi|260564694|ref|ZP_05835179.1| SMF protein [Brucella melitensis bv. 1 str. 16M] gi|260760064|ref|ZP_05872412.1| DNA protecting protein DprA [Brucella abortus bv. 4 str. 292] gi|260763303|ref|ZP_05875635.1| DNA protecting protein DprA [Brucella abortus bv. 2 str. 86/8/59] gi|260882451|ref|ZP_05894065.1| DNA protecting protein DprA [Brucella abortus bv. 9 str. C68] gi|261217219|ref|ZP_05931500.1| DNA protecting protein DprA [Brucella ceti M13/05/1] gi|261220439|ref|ZP_05934720.1| DNA protecting protein DprA [Brucella ceti B1/94] gi|261313331|ref|ZP_05952528.1| DNA protecting protein DprA [Brucella pinnipedialis M163/99/10] gi|261318720|ref|ZP_05957917.1| DNA protecting protein DprA [Brucella pinnipedialis B2/94] gi|261320090|ref|ZP_05959287.1| DNA protecting protein DprA [Brucella ceti M644/93/1] gi|261323154|ref|ZP_05962351.1| DNA protecting protein DprA [Brucella neotomae 5K33] gi|261756809|ref|ZP_06000518.1| SMF protein [Brucella sp. F5/99] gi|265986518|ref|ZP_06099075.1| DNA protecting protein DprA [Brucella pinnipedialis M292/94/1] gi|265989917|ref|ZP_06102474.1| DNA protecting protein DprA [Brucella melitensis bv. 1 str. Rev.1] gi|265996210|ref|ZP_06108767.1| DNA protecting protein DprA [Brucella ceti M490/95/1] gi|297249580|ref|ZP_06933281.1| DNA processing protein [Brucella abortus bv. 5 str. B3196] gi|17984851|gb|AAL53909.1| smf protein [Brucella melitensis bv. 1 str. 16M] gi|62197734|gb|AAX76033.1| hypothetical DprA, DNA processing protein [Brucella abortus bv. 1 str. 9-941] gi|82939796|emb|CAJ12804.1| SMF protein [Brucella melitensis biovar Abortus 2308] gi|189021370|gb|ACD74091.1| SMF protein [Brucella abortus S19] gi|225615590|gb|EEH12639.1| DNA protecting protein DprA [Brucella ceti str. Cudo] gi|237787902|gb|EEP62118.1| DNA protecting protein DprA [Brucella abortus str. 2308 A] gi|255998039|gb|ACU49726.1| DNA processing protein DprA, putative [Brucella microti CCM 4915] gi|260098048|gb|EEW81922.1| SMF protein [Brucella abortus NCTC 8038] gi|260152337|gb|EEW87430.1| SMF protein [Brucella melitensis bv. 1 str. 16M] gi|260670382|gb|EEX57322.1| DNA protecting protein DprA [Brucella abortus bv. 4 str. 292] gi|260673724|gb|EEX60545.1| DNA protecting protein DprA [Brucella abortus bv. 2 str. 86/8/59] gi|260871979|gb|EEX79048.1| DNA protecting protein DprA [Brucella abortus bv. 9 str. C68] gi|260919023|gb|EEX85676.1| DNA protecting protein DprA [Brucella ceti B1/94] gi|260922308|gb|EEX88876.1| DNA protecting protein DprA [Brucella ceti M13/05/1] gi|261292780|gb|EEX96276.1| DNA protecting protein DprA [Brucella ceti M644/93/1] gi|261297943|gb|EEY01440.1| DNA protecting protein DprA [Brucella pinnipedialis B2/94] gi|261299134|gb|EEY02631.1| DNA protecting protein DprA [Brucella neotomae 5K33] gi|261302357|gb|EEY05854.1| DNA protecting protein DprA [Brucella pinnipedialis M163/99/10] gi|261736793|gb|EEY24789.1| SMF protein [Brucella sp. F5/99] gi|262550507|gb|EEZ06668.1| DNA protecting protein DprA [Brucella ceti M490/95/1] gi|263000586|gb|EEZ13276.1| DNA protecting protein DprA [Brucella melitensis bv. 1 str. Rev.1] gi|264658715|gb|EEZ28976.1| DNA protecting protein DprA [Brucella pinnipedialis M292/94/1] gi|297173449|gb|EFH32813.1| DNA processing protein [Brucella abortus bv. 5 str. B3196] Length = 393 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|254695655|ref|ZP_05157483.1| SMF protein [Brucella abortus bv. 3 str. Tulya] gi|261216055|ref|ZP_05930336.1| DNA protecting protein DprA [Brucella abortus bv. 3 str. Tulya] gi|260917662|gb|EEX84523.1| DNA protecting protein DprA [Brucella abortus bv. 3 str. Tulya] Length = 393 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|257458421|ref|ZP_05623563.1| smf protein [Treponema vincentii ATCC 35580] gi|257444225|gb|EEV19326.1| smf protein [Treponema vincentii ATCC 35580] Length = 318 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N L I + GG +SE G Sbjct: 178 LACGLDRLYPQSNARLAGRILETGGCILSEYAPG 211 >gi|254691038|ref|ZP_05154292.1| SMF protein [Brucella abortus bv. 6 str. 870] Length = 381 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 166 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 199 >gi|260599605|ref|YP_003212176.1| hypothetical protein CTU_38130 [Cronobacter turicensis z3032] gi|260218782|emb|CBA34130.1| Protein smf [Cronobacter turicensis z3032] Length = 381 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +R L EEI + GG +SE PF Sbjct: 178 LGNGLAQVYPARHRKLAEEIIEQGGAVVSEFPF 210 >gi|56750836|ref|YP_171537.1| DNA processing protein [Synechococcus elongatus PCC 6301] gi|56685795|dbj|BAD79017.1| DNA processing protein [Synechococcus elongatus PCC 6301] Length = 406 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G++ +YPP+NR L E I + GG+ +SE P G Sbjct: 204 LGTGVNVIYPPQNRALYEAILEQGGLILSEQPSG 237 >gi|120552988|ref|YP_957339.1| DNA protecting protein DprA [Marinobacter aquaeolei VT8] gi|120322837|gb|ABM17152.1| DNA protecting protein DprA [Marinobacter aquaeolei VT8] Length = 405 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD LYP ++RNL I +N G+ +SE P G Sbjct: 202 GCGLDRLYPAQHRNLAHRIIEN-GLIVSEYPPG 233 >gi|146329048|ref|YP_001209084.1| DNA processing protein DprA [Dichelobacter nodosus VCS1703A] gi|146232518|gb|ABQ13496.1| DNA processing protein DprA [Dichelobacter nodosus VCS1703A] Length = 382 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L +I N G +SE P G Sbjct: 177 GTGLDRVYPARHRELAHQIAAN-GAIVSEFPVG 208 >gi|81299514|ref|YP_399722.1| DNA processing protein DprA, putative [Synechococcus elongatus PCC 7942] gi|81168395|gb|ABB56735.1| DNA processing protein DprA, putative [Synechococcus elongatus PCC 7942] Length = 402 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G++ +YPP+NR L E I + GG+ +SE P G Sbjct: 200 LGTGVNVIYPPQNRALYEAILEQGGLILSEQPSG 233 >gi|256111481|ref|ZP_05452495.1| SMF protein [Brucella melitensis bv. 3 str. Ether] gi|265992978|ref|ZP_06105535.1| DNA protecting protein DprA [Brucella melitensis bv. 3 str. Ether] gi|262763848|gb|EEZ09880.1| DNA protecting protein DprA [Brucella melitensis bv. 3 str. Ether] Length = 388 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|302872580|ref|YP_003841216.1| DNA protecting protein DprA [Caldicellulosiruptor obsidiansis OB47] gi|302575439|gb|ADL43230.1| DNA protecting protein DprA [Caldicellulosiruptor obsidiansis OB47] Length = 365 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN L +I ++ G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIES-GCVVSEFLPG 203 >gi|188535242|ref|YP_001909039.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Erwinia tasmaniensis Et1/99] gi|188030284|emb|CAO98173.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Erwinia tasmaniensis Et1/99] Length = 374 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP +++ L ++I D GG +SE P Sbjct: 167 LGSGLDAIYPRQHQFLAQQIIDCGGALVSEFPL 199 >gi|188586006|ref|YP_001917551.1| DNA protecting protein DprA [Natranaerobius thermophilus JW/NM-WN-LF] gi|179350693|gb|ACB84963.1| DNA protecting protein DprA [Natranaerobius thermophilus JW/NM-WN-LF] Length = 349 Score = 63.1 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YPPENR L ++I + G+ ISE P Sbjct: 163 LGNGLDIIYPPENRELYKQISE-KGLLISEYPP 194 >gi|328675504|gb|AEB28179.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Francisella cf. novicida 3523] Length = 368 Score = 62.7 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N+ L +I + G+ +SE P G Sbjct: 175 GTGIDVVYPSSNKELYNKIINTNGLIVSEFPLG 207 >gi|219871700|ref|YP_002476075.1| Smf protein, Rossmann fold nucleotide-binding protein involved in DNA uptake [Haemophilus parasuis SH0165] gi|219691904|gb|ACL33127.1| Smf protein, Rossmann fold nucleotide-binding protein involved in DNA uptake [Haemophilus parasuis SH0165] Length = 375 Score = 62.7 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP ++ L E+I G +SE Sbjct: 169 LGSGLDQVYPARHKKLAEQIVATSGALVSEFFP 201 >gi|225175754|ref|ZP_03729747.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1] gi|225168678|gb|EEG77479.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1] Length = 361 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YPPE+ L+E I +N G ISE P G Sbjct: 162 LGHGLDLCYPPEHLELMEAIVEN-GAVISEYPPG 194 >gi|291522666|emb|CBK80959.1| DNA protecting protein DprA [Coprococcus catus GD/7] Length = 359 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN +L EI NGG +SE P G Sbjct: 173 LGCGVDVCYPRENIDLYTEISRNGG-ILSEFPPG 205 >gi|241667272|ref|ZP_04754850.1| DNA processing protein DprA [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254875823|ref|ZP_05248533.1| DNA processing protein dprA [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254841844|gb|EET20258.1| DNA processing protein dprA [Francisella philomiragia subsp. philomiragia ATCC 25015] Length = 366 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L I N G+ ISE+P G Sbjct: 173 GTGVDIIYPSSNRELYSNIISNNGLIISELPLG 205 >gi|167626698|ref|YP_001677198.1| DNA processing protein DprA [Francisella philomiragia subsp. philomiragia ATCC 25017] gi|167596699|gb|ABZ86697.1| DNA processing protein DprA [Francisella philomiragia subsp. philomiragia ATCC 25017] Length = 288 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L I N G+ ISE+P G Sbjct: 95 GTGVDIIYPSSNRELYSNIISNNGLIISELPLG 127 >gi|39997645|ref|NP_953596.1| DNA processing protein DprA [Geobacter sulfurreducens PCA] gi|39984537|gb|AAR35923.1| DNA processing protein DprA [Geobacter sulfurreducens PCA] gi|298506585|gb|ADI85308.1| DNA uptake/processing protein SMF [Geobacter sulfurreducens KN400] Length = 356 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPENR L + D G +SE P G Sbjct: 168 LGCGIDVVYPPENRALFARVADR-GALVSEFPLG 200 >gi|167950829|ref|ZP_02537903.1| DNA processing protein DprA, putative [Endoriftia persephone 'Hot96_1+Hot96_2'] Length = 167 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L +I + G+ +SE P G Sbjct: 9 GTGLDRVYPARHRQLARQIAEQ-GVLVSEFPPG 40 >gi|78484539|ref|YP_390464.1| DNA processing protein DprA, putative [Thiomicrospira crunogena XCL-2] gi|78362825|gb|ABB40790.1| DNA protecting protein DprA [Thiomicrospira crunogena XCL-2] Length = 377 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD +YP NR L +I D G +SE P G Sbjct: 183 ATGLDRVYPAANRELARQIADR-GALVSEYPLG 214 >gi|306841750|ref|ZP_07474436.1| DNA protecting protein DprA [Brucella sp. BO2] gi|306288155|gb|EFM59542.1| DNA protecting protein DprA [Brucella sp. BO2] Length = 345 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 130 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 163 >gi|254796757|ref|YP_003081593.1| DNA processing chain A [Neorickettsia risticii str. Illinois] gi|254590002|gb|ACT69364.1| DNA processing chain A [Neorickettsia risticii str. Illinois] Length = 375 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN+ L E I + GG+ ++E+PFG Sbjct: 167 IGTGIDQCYPTENQKLQERIIERGGLVVTEVPFG 200 >gi|259046716|ref|ZP_05737117.1| DNA processing chain A [Granulicatella adiacens ATCC 49175] gi|259036612|gb|EEW37867.1| DNA processing chain A [Granulicatella adiacens ATCC 49175] Length = 288 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YPPEN NL +EI + G+ ISE P G Sbjct: 169 IGSGLDVVYPPENANLYKEIGE-KGLIISEYPLG 201 >gi|115525378|ref|YP_782289.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisA53] gi|115519325|gb|ABJ07309.1| DNA protecting protein DprA [Rhodopseudomonas palustris BisA53] Length = 372 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 25/34 (73%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YPPE+ +LL +I GG AISE+P G Sbjct: 175 LAGGHDRIYPPEHEDLLADILAQGGAAISEMPLG 208 >gi|301632279|ref|XP_002945218.1| PREDICTED: hypothetical protein LOC100495052 [Xenopus (Silurana) tropicalis] Length = 729 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L I G+ +SE P G Sbjct: 539 GTGLDRVYPSRHRALAHRI-ARHGLLVSEYPLG 570 >gi|260756634|ref|ZP_05868982.1| DNA protecting protein DprA [Brucella abortus bv. 6 str. 870] gi|260676742|gb|EEX63563.1| DNA protecting protein DprA [Brucella abortus bv. 6 str. 870] Length = 343 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 128 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 161 >gi|95929065|ref|ZP_01311810.1| DNA processing protein DprA, putative [Desulfuromonas acetoxidans DSM 684] gi|95134966|gb|EAT16620.1| DNA processing protein DprA, putative [Desulfuromonas acetoxidans DSM 684] Length = 363 Score = 62.7 bits (153), Expect = 2e-08, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP ENR+L E+I + GI +SE P G Sbjct: 170 LGCGIDLIYPKENRHLFEQIGE-KGIIVSEYPPG 202 >gi|149925346|ref|ZP_01913610.1| SMF protein [Limnobacter sp. MED105] gi|149825463|gb|EDM84671.1| SMF protein [Limnobacter sp. MED105] Length = 362 Score = 62.3 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YPP + L +I GG+ +SE P G Sbjct: 152 LGCGPDEIYPPHHAGLKAQIVGQGGLVLSEYPPG 185 >gi|294055361|ref|YP_003549019.1| DNA protecting protein DprA [Coraliomargarita akajimensis DSM 45221] gi|293614694|gb|ADE54849.1| DNA protecting protein DprA [Coraliomargarita akajimensis DSM 45221] Length = 373 Score = 62.3 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YPPEN +L I G +SE PFG Sbjct: 177 GCGLDIVYPPENLDLYRAIVA-KGAVVSEFPFG 208 >gi|220923237|ref|YP_002498539.1| DNA protecting protein DprA [Methylobacterium nodulans ORS 2060] gi|219947844|gb|ACL58236.1| DNA protecting protein DprA [Methylobacterium nodulans ORS 2060] Length = 391 Score = 62.3 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP E+ L I D+GG ++E+P G Sbjct: 166 LAGGHDRIYPAEHEPLAARILDHGGAIVAEMPLG 199 >gi|167855660|ref|ZP_02478418.1| Protein smf (DNA-processing chain A) [Haemophilus parasuis 29755] gi|167853232|gb|EDS24488.1| Protein smf (DNA-processing chain A) [Haemophilus parasuis 29755] Length = 375 Score = 62.3 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP ++ L E+I D G +SE Sbjct: 169 LGSGLDQVYPARHKKLAEQIVDTSGALVSEFFP 201 >gi|154500973|ref|ZP_02039011.1| hypothetical protein BACCAP_04659 [Bacteroides capillosus ATCC 29799] gi|150269997|gb|EDM97516.1| hypothetical protein BACCAP_04659 [Bacteroides capillosus ATCC 29799] Length = 408 Score = 62.3 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG+D +YP ENR L E++ G ISE P G Sbjct: 171 LGGGIDVVYPAENRWLYEDVAAA-GALISEYPPG 203 >gi|313895732|ref|ZP_07829288.1| DNA protecting protein DprA [Selenomonas sp. oral taxon 137 str. F0430] gi|320528987|ref|ZP_08030079.1| DNA protecting protein DprA [Selenomonas artemidis F0399] gi|312975858|gb|EFR41317.1| DNA protecting protein DprA [Selenomonas sp. oral taxon 137 str. F0430] gi|320138617|gb|EFW30507.1| DNA protecting protein DprA [Selenomonas artemidis F0399] Length = 363 Score = 62.3 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YPPENR L+ +I D GG +SE G Sbjct: 172 LGCGVDIAYPPENRRLIAQIIDAGGAVLSEYAPG 205 >gi|154482594|ref|ZP_02025042.1| hypothetical protein EUBVEN_00261 [Eubacterium ventriosum ATCC 27560] gi|149736619|gb|EDM52505.1| hypothetical protein EUBVEN_00261 [Eubacterium ventriosum ATCC 27560] Length = 333 Score = 62.3 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN L +I NGG ISE P G Sbjct: 144 LGSGVDVCYPTENIELYNDILKNGG-IISEYPPG 176 >gi|170742467|ref|YP_001771122.1| DNA protecting protein DprA [Methylobacterium sp. 4-46] gi|168196741|gb|ACA18688.1| DNA protecting protein DprA [Methylobacterium sp. 4-46] Length = 391 Score = 62.3 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP E+ L I GG ++E+P G Sbjct: 166 LAGGQDRIYPAEHEALAARILAQGGAIVAEMPLG 199 >gi|73748517|ref|YP_307756.1| putative DNA processing protein DprA [Dehalococcoides sp. CBDB1] gi|73660233|emb|CAI82840.1| putative DNA processing protein DprA [Dehalococcoides sp. CBDB1] Length = 383 Score = 62.3 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN +L +I +N G ISE P G Sbjct: 184 GCGLDIIYPSENHSLARQIAEN-GALISEHPPG 215 >gi|119475270|ref|ZP_01615623.1| SMF protein [marine gamma proteobacterium HTCC2143] gi|119451473|gb|EAW32706.1| SMF protein [marine gamma proteobacterium HTCC2143] Length = 368 Score = 62.3 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N+ L E I G ISE P G Sbjct: 173 LGTGIDIVYPRRNKELFESIV-CQGAVISEFPMG 205 >gi|189218918|ref|YP_001939559.1| DNA uptake Rossmann fold nucleotide-binding protein [Methylacidiphilum infernorum V4] gi|189185776|gb|ACD82961.1| Rossmann fold nucleotide-binding protein involved in DNA uptake [Methylacidiphilum infernorum V4] Length = 380 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP +N L E I G+ ISE P G Sbjct: 183 LGSGIDHCYPAQNYELSERISAQ-GLLISEFPMG 215 >gi|222099410|ref|YP_002533978.1| DNA protecting protein DprA [Thermotoga neapolitana DSM 4359] gi|221571800|gb|ACM22612.1| DNA protecting protein DprA [Thermotoga neapolitana DSM 4359] Length = 337 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N L I ++ G +SE P G Sbjct: 156 LGAGVDVIYPRSNEGLFYRILES-GCVVSEYPMG 188 >gi|145295932|ref|YP_001138753.1| hypothetical protein cgR_1857 [Corynebacterium glutamicum R] gi|140845852|dbj|BAF54851.1| hypothetical protein [Corynebacterium glutamicum R] Length = 394 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 2 AGGLDCLYPPENRNLLEEIWDNG-GIAISEIPFG 34 A GLD YP NR+L +I +G G +SE P G Sbjct: 192 ACGLDRSYPSHNRDLFNQIAKSGKGALVSEYPPG 225 >gi|89902621|ref|YP_525092.1| DNA processing protein DprA [Rhodoferax ferrireducens T118] gi|89347358|gb|ABD71561.1| DNA processing protein DprA, putative [Rhodoferax ferrireducens T118] Length = 409 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L I G+ ISE P G Sbjct: 211 GTGLDRVYPKRHLALAHRI-AQNGLLISEYPLG 242 >gi|88608661|ref|YP_506277.1| putative DNA processing protein DprA [Neorickettsia sennetsu str. Miyayama] gi|88600830|gb|ABD46298.1| putative DNA processing protein DprA [Neorickettsia sennetsu str. Miyayama] Length = 378 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN+ L E I + GG+ ++E+PFG Sbjct: 167 IGTGIDQCYPIENQRLQERIIERGGLVVTEVPFG 200 >gi|19553232|ref|NP_601234.1| Rossmann-fold nucleotide-binding protein [Corynebacterium glutamicum ATCC 13032] gi|62390868|ref|YP_226270.1| DNA uptake Rossmann fold nucleotide-binding protein [Corynebacterium glutamicum ATCC 13032] gi|21324799|dbj|BAB99422.1| Predicted Rossmann-fold nucleotide-binding protein involved in DNA uptake [Corynebacterium glutamicum ATCC 13032] gi|41326207|emb|CAF20369.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Corynebacterium glutamicum ATCC 13032] Length = 394 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 2 AGGLDCLYPPENRNLLEEIWDNG-GIAISEIPFG 34 A GLD YP NR+L +I +G G +SE P G Sbjct: 192 ACGLDRSYPSHNRDLFNQIAKSGKGALVSEYPPG 225 >gi|312882740|ref|ZP_07742475.1| nucleotide-binding protein [Vibrio caribbenthicus ATCC BAA-2122] gi|309369598|gb|EFP97115.1| nucleotide-binding protein [Vibrio caribbenthicus ATCC BAA-2122] Length = 372 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ++R L + I G ++E P Sbjct: 172 LGCGLGNVYPAQHRGLAQRILAEKGALVAEFPP 204 >gi|88811386|ref|ZP_01126641.1| SMF protein [Nitrococcus mobilis Nb-231] gi|88791275|gb|EAR22387.1| SMF protein [Nitrococcus mobilis Nb-231] Length = 371 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP +R+L I + G ISE P G Sbjct: 176 LGTGPDRIYPARHRDLAHAIAER-GALISEFPIG 208 >gi|304436896|ref|ZP_07396860.1| DNA processing protein DprA [Selenomonas sp. oral taxon 149 str. 67H29BP] gi|304370095|gb|EFM23756.1| DNA processing protein DprA [Selenomonas sp. oral taxon 149 str. 67H29BP] Length = 363 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YPPENR LL EI G +SE G Sbjct: 172 LGCGVDIAYPPENRRLLTEIVAADGAVLSEYAPG 205 >gi|258514507|ref|YP_003190729.1| DNA protecting protein DprA [Desulfotomaculum acetoxidans DSM 771] gi|257778212|gb|ACV62106.1| DNA protecting protein DprA [Desulfotomaculum acetoxidans DSM 771] Length = 366 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP ENR L+E I + G ISE P Sbjct: 172 LGSGLNVIYPRENRKLMERIAAS-GAVISEFPL 203 >gi|296133059|ref|YP_003640306.1| transcriptional regulator, MarR family [Thermincola sp. JR] gi|296031637|gb|ADG82405.1| transcriptional regulator, MarR family [Thermincola potens JR] Length = 359 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP ENR L++ I G +SE P G Sbjct: 172 LGTGVDIVYPRENRRLMDNII-THGAVVSEFPPG 204 >gi|289432565|ref|YP_003462438.1| DNA protecting protein DprA [Dehalococcoides sp. GT] gi|288946285|gb|ADC73982.1| DNA protecting protein DprA [Dehalococcoides sp. GT] Length = 373 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN +L +I +N G ISE P G Sbjct: 174 GCGLDIIYPSENHSLARQIAEN-GALISEHPPG 205 >gi|291299698|ref|YP_003510976.1| DNA protecting protein DprA [Stackebrandtia nassauensis DSM 44728] gi|290568918|gb|ADD41883.1| DNA protecting protein DprA [Stackebrandtia nassauensis DSM 44728] Length = 384 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP N L E I + G+ +SE P G Sbjct: 185 LACGVDRPYPAANAGLFERIAET-GLLVSEWPPG 217 >gi|305681197|ref|ZP_07404004.1| DNA protecting protein DprA [Corynebacterium matruchotii ATCC 14266] gi|305659402|gb|EFM48902.1| DNA protecting protein DprA [Corynebacterium matruchotii ATCC 14266] Length = 405 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP N ++L I + G +SE P G Sbjct: 197 ACGLDRPYPRRNHDMLTTIAQHNGALVSEYPPG 229 >gi|225021105|ref|ZP_03710297.1| hypothetical protein CORMATOL_01117 [Corynebacterium matruchotii ATCC 33806] gi|224946105|gb|EEG27314.1| hypothetical protein CORMATOL_01117 [Corynebacterium matruchotii ATCC 33806] Length = 405 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP N ++L I + G +SE P G Sbjct: 197 ACGLDRPYPRRNHDMLTTIAQHNGALVSEYPPG 229 >gi|317050447|ref|YP_004111563.1| DNA protecting protein DprA [Desulfurispirillum indicum S5] gi|316945531|gb|ADU65007.1| DNA protecting protein DprA [Desulfurispirillum indicum S5] Length = 354 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G++ +YP NR L ++I + GG I+E G Sbjct: 156 MGCGIERVYPAGNRRLAQQIVNQGGAVITEFAPG 189 >gi|238926948|ref|ZP_04658708.1| SMF family DNA processing protein [Selenomonas flueggei ATCC 43531] gi|238885182|gb|EEQ48820.1| SMF family DNA processing protein [Selenomonas flueggei ATCC 43531] Length = 369 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP ENR LL EI +GG +SE G Sbjct: 178 LGCGVDVAYPSENRRLLAEICTSGGAVLSEYAPG 211 >gi|225568716|ref|ZP_03777741.1| hypothetical protein CLOHYLEM_04795 [Clostridium hylemonae DSM 15053] gi|225162215|gb|EEG74834.1| hypothetical protein CLOHYLEM_04795 [Clostridium hylemonae DSM 15053] Length = 362 Score = 61.9 bits (151), Expect = 3e-08, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP E+ L +I +GG +SE P G Sbjct: 171 LGCGVDVCYPREHIGLYMDIQKHGG-ILSEYPPG 203 >gi|208780407|ref|ZP_03247748.1| DNA protecting protein DprA, putative [Francisella novicida FTG] gi|208743775|gb|EDZ90078.1| DNA protecting protein DprA, putative [Francisella novicida FTG] Length = 368 Score = 61.5 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE+P G Sbjct: 175 GTGVDVVYPSSNRELYNKIINTNGLIISELPLG 207 >gi|118443914|ref|YP_878225.1| DNA uptake protein [Clostridium novyi NT] gi|118134370|gb|ABK61414.1| DNA uptake protein [Clostridium novyi NT] Length = 359 Score = 61.5 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN+N+ +EI N G IS+ P G Sbjct: 169 LGSGIDVIYPRENKNIYDEIIKN-GCVISQFPPG 201 >gi|326410760|gb|ADZ67824.1| DNA protecting protein DprA [Brucella melitensis M28] gi|326554052|gb|ADZ88691.1| DNA protecting protein DprA [Brucella melitensis M5-90] Length = 393 Score = 61.5 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPKNGGALITEMPMG 211 >gi|313905318|ref|ZP_07838684.1| DNA protecting protein DprA [Eubacterium cellulosolvens 6] gi|313469788|gb|EFR65124.1| DNA protecting protein DprA [Eubacterium cellulosolvens 6] Length = 375 Score = 61.5 bits (150), Expect = 4e-08, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 16/34 (47%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP +N L I GG ISE G Sbjct: 125 LGTGVDVCYPKQNYALYRRIIREGGGIISEFEPG 158 >gi|325267229|ref|ZP_08133892.1| DNA protecting protein DprA [Kingella denitrificans ATCC 33394] gi|324981290|gb|EGC16939.1| DNA protecting protein DprA [Kingella denitrificans ATCC 33394] Length = 397 Score = 61.5 bits (150), Expect = 4e-08, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N+ L +I + G +SE P G Sbjct: 176 GTGIDRIYPQSNQKLAYQIAEQ-GAIVSEFPLG 207 >gi|260889465|ref|ZP_05900728.1| DNA protecting protein DprA [Leptotrichia hofstadii F0254] gi|260860876|gb|EEX75376.1| DNA protecting protein DprA [Leptotrichia hofstadii F0254] Length = 279 Score = 61.5 bits (150), Expect = 4e-08, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ENR+L E I + G ISE P G Sbjct: 176 GTGLDVVYPYENRDLWERIGET-GTLISEYPLG 207 >gi|317508418|ref|ZP_07966088.1| DNA recombination-mediator protein A [Segniliparus rugosus ATCC BAA-974] gi|316253265|gb|EFV12665.1| DNA recombination-mediator protein A [Segniliparus rugosus ATCC BAA-974] Length = 382 Score = 61.5 bits (150), Expect = 4e-08, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L I N G +SE P G Sbjct: 188 LACGVDVAYPAGHVQLFRRIAAN-GAVLSEYPPG 220 >gi|254491244|ref|ZP_05104425.1| DNA protecting protein DprA, putative [Methylophaga thiooxidans DMS010] gi|224463757|gb|EEF80025.1| DNA protecting protein DprA, putative [Methylophaga thiooxydans DMS010] Length = 345 Score = 61.5 bits (150), Expect = 4e-08, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD +YP ++R L +I N G +SE P G Sbjct: 150 ATGLDRVYPAQHRQLAHDIAAN-GAIVSEFPLG 181 >gi|33599233|ref|NP_886793.1| hypothetical protein BB0244 [Bordetella bronchiseptica RB50] gi|33575279|emb|CAE30742.1| conserved hypothetical protein [Bordetella bronchiseptica RB50] Length = 370 Score = 61.5 bits (150), Expect = 4e-08, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G+D +YP +R+L I G +SE+P G Sbjct: 182 MGTGIDRIYPAAHRDLAHRIV-QHGALVSELPLG 214 >gi|187476713|ref|YP_784736.1| Smf protein [Bordetella avium 197N] gi|115421299|emb|CAJ47804.1| Smf protein [Bordetella avium 197N] Length = 373 Score = 61.5 bits (150), Expect = 4e-08, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP NR L I N G +SE P G Sbjct: 182 LGTGLDRVYPASNRQLAHAIAAN-GALLSEFPLG 214 >gi|225163857|ref|ZP_03726152.1| DNA protecting protein DprA [Opitutaceae bacterium TAV2] gi|224801538|gb|EEG19839.1| DNA protecting protein DprA [Opitutaceae bacterium TAV2] Length = 388 Score = 61.5 bits (150), Expect = 4e-08, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D +YPPEN +L I + GG SE PF Sbjct: 173 LGTGIDIIYPPENLDLYRRIENEGGAICSEFPF 205 >gi|33594956|ref|NP_882599.1| hypothetical protein BPP0240 [Bordetella parapertussis 12822] gi|33565032|emb|CAE39981.1| conserved hypothetical protein [Bordetella parapertussis] Length = 370 Score = 61.5 bits (150), Expect = 4e-08, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G+D +YP +R+L I G +SE+P G Sbjct: 182 MGTGIDRIYPAAHRDLAHRIV-QHGALVSELPLG 214 >gi|25028474|ref|NP_738528.1| putative DNA processing protein [Corynebacterium efficiens YS-314] gi|259507533|ref|ZP_05750433.1| Rossmann-fold nucleotide-binding protein [Corynebacterium efficiens YS-314] gi|23493759|dbj|BAC18728.1| putative DNA processing protein [Corynebacterium efficiens YS-314] gi|259164918|gb|EEW49472.1| Rossmann-fold nucleotide-binding protein [Corynebacterium efficiens YS-314] Length = 403 Score = 61.5 bits (150), Expect = 4e-08, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP NR L EE+ + GG ++E P G Sbjct: 194 ACGLDRSYPAHNRGLFEEVVNRGGAIVTEYPPG 226 >gi|284992379|ref|YP_003410933.1| DNA protecting protein DprA [Geodermatophilus obscurus DSM 43160] gi|284065624|gb|ADB76562.1| DNA protecting protein DprA [Geodermatophilus obscurus DSM 43160] Length = 422 Score = 61.5 bits (150), Expect = 4e-08, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +YP + L I ++ G+ +SE P G Sbjct: 215 LACGVDRVYPSAHGALFHRIAES-GLLVSEWPPG 247 >gi|206900964|ref|YP_002251236.1| DNA processing protein DprA [Dictyoglomus thermophilum H-6-12] gi|206740067|gb|ACI19125.1| DNA processing protein DprA [Dictyoglomus thermophilum H-6-12] Length = 364 Score = 61.5 bits (150), Expect = 4e-08, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + LD +YP N L E I +N G ISE P G Sbjct: 172 LGSSLDHIYPSGNLKLAERIIEN-GAIISEYPLG 204 >gi|251772341|gb|EES52909.1| putative DNA processing protein DprA [Leptospirillum ferrodiazotrophum] Length = 292 Score = 61.1 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 20/33 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YPPEN L EI GG+ +SE P G Sbjct: 175 GTGLDRVYPPENVGLAREIERTGGLILSEYPPG 207 >gi|33591759|ref|NP_879403.1| hypothetical protein BP0555 [Bordetella pertussis Tohama I] gi|33571402|emb|CAE44883.1| conserved hypothetical protein [Bordetella pertussis Tohama I] gi|332381176|gb|AEE66023.1| hypothetical protein BPTD_0564 [Bordetella pertussis CS] Length = 370 Score = 61.1 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G+D +YP +R+L I G +SE+P G Sbjct: 182 MGTGIDRIYPAAHRDLAHRIV-QHGALVSELPLG 214 >gi|227488615|ref|ZP_03918931.1| DNA processing protein [Corynebacterium glucuronolyticum ATCC 51867] gi|227543218|ref|ZP_03973267.1| DNA processing protein [Corynebacterium glucuronolyticum ATCC 51866] gi|227091509|gb|EEI26821.1| DNA processing protein [Corynebacterium glucuronolyticum ATCC 51867] gi|227181027|gb|EEI61999.1| DNA processing protein [Corynebacterium glucuronolyticum ATCC 51866] Length = 412 Score = 61.1 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP N +L I G +SE P G Sbjct: 214 ASGLDVTYPASNADLFARI-ATHGCLVSEYPPG 245 >gi|327395470|dbj|BAK12892.1| protein Smf [Pantoea ananatis AJ13355] Length = 374 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L +EI + GG ISE P Sbjct: 167 LGSGLAHLYPRRHVALAQEIVEQGGAVISEFPL 199 >gi|311109269|ref|YP_003982122.1| DNA protecting protein DprA [Achromobacter xylosoxidans A8] gi|310763958|gb|ADP19407.1| DNA protecting protein DprA [Achromobacter xylosoxidans A8] Length = 370 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G+D +YP ++R+L I + G +SE+P G Sbjct: 182 MGTGIDRIYPAKHRDLAHRIAAH-GALVSELPLG 214 >gi|291619141|ref|YP_003521883.1| Smf [Pantoea ananatis LMG 20103] gi|291154171|gb|ADD78755.1| Smf [Pantoea ananatis LMG 20103] Length = 376 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L +EI + GG ISE P Sbjct: 169 LGSGLAHLYPRRHVALAQEIVEQGGAVISEFPL 201 >gi|253583758|ref|ZP_04860956.1| smf protein [Fusobacterium varium ATCC 27725] gi|251834330|gb|EES62893.1| smf protein [Fusobacterium varium ATCC 27725] Length = 352 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ENR L E I + G+ ISE P G Sbjct: 167 GSGLDVIYPKENRILWENI-EKSGLIISEYPLG 198 >gi|226306022|ref|YP_002765982.1| DNA processing protein [Rhodococcus erythropolis PR4] gi|226185139|dbj|BAH33243.1| putative DNA processing protein [Rhodococcus erythropolis PR4] Length = 375 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + LL++I + G ISE P G Sbjct: 181 LACGVDRAYPSGHARLLKQI-ASSGAVISEYPPG 213 >gi|269925224|ref|YP_003321847.1| DNA protecting protein DprA [Thermobaculum terrenum ATCC BAA-798] gi|269788884|gb|ACZ41025.1| DNA protecting protein DprA [Thermobaculum terrenum ATCC BAA-798] Length = 365 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN+ L ++I G +SE P G Sbjct: 177 LGSGLDQVYPWENKKLADDIV-RSGALVSEYPLG 209 >gi|268317536|ref|YP_003291255.1| DNA protecting protein DprA [Rhodothermus marinus DSM 4252] gi|262335070|gb|ACY48867.1| DNA protecting protein DprA [Rhodothermus marinus DSM 4252] Length = 385 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP + L I G +SE P G Sbjct: 195 LGSGVDRIYPSRHERLARAITAQ-GALVSEFPLG 227 >gi|312797603|ref|YP_004030525.1| DNA processing protein [Burkholderia rhizoxinica HKI 454] gi|312169378|emb|CBW76381.1| DNA processing protein [Burkholderia rhizoxinica HKI 454] Length = 629 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D +YP + L EI + GG ++E P G Sbjct: 272 GSGADVIYPQRHTGLAAEIVERGGAILTEWPLG 304 >gi|163844754|ref|YP_001622409.1| DNA protecting protein DprA [Brucella suis ATCC 23445] gi|163675477|gb|ABY39587.1| DNA protecting protein DprA [Brucella suis ATCC 23445] Length = 393 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEVPMG 211 >gi|290512103|ref|ZP_06551471.1| DNA processing protein [Klebsiella sp. 1_1_55] gi|289775893|gb|EFD83893.1| DNA processing protein [Klebsiella sp. 1_1_55] Length = 374 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + NL ++I DNGG +SE P Sbjct: 167 LGNGLEQVYPRRHANLAQQIIDNGGTLVSEFPL 199 >gi|251788005|ref|YP_003002726.1| DNA protecting protein DprA [Dickeya zeae Ech1591] gi|247536626|gb|ACT05247.1| DNA protecting protein DprA [Dickeya zeae Ech1591] Length = 377 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++ L + I GG +SE P Sbjct: 167 LGSGLNQLYPRRHQALADAIVAKGGALVSEFPL 199 >gi|237795718|ref|YP_002863270.1| DNA uptake protein [Clostridium botulinum Ba4 str. 657] gi|229261789|gb|ACQ52822.1| DNA uptake protein [Clostridium botulinum Ba4 str. 657] Length = 385 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP EN L + I +NGG ISE P G Sbjct: 178 LAHGLDMIYPRENIELSKSILNNGGTLISEYPVG 211 >gi|288933301|ref|YP_003437360.1| DNA protecting protein DprA [Klebsiella variicola At-22] gi|288888030|gb|ADC56348.1| DNA protecting protein DprA [Klebsiella variicola At-22] Length = 374 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + NL ++I DNGG +SE P Sbjct: 167 LGNGLEQVYPRRHANLAQQIIDNGGTLVSEFPL 199 >gi|237749119|ref|ZP_04579599.1| DNA processing protein [Oxalobacter formigenes OXCC13] gi|229380481|gb|EEO30572.1| DNA processing protein [Oxalobacter formigenes OXCC13] Length = 375 Score = 61.1 bits (149), Expect = 5e-08, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP NR L I N G ISE P G Sbjct: 181 IGTGADIVYPARNRELAHRI-ANEGCIISEFPLG 213 >gi|240948039|ref|ZP_04752456.1| Smf protein [Actinobacillus minor NM305] gi|240297655|gb|EER48132.1| Smf protein [Actinobacillus minor NM305] Length = 382 Score = 61.1 bits (149), Expect = 6e-08, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP ++ L E+I + GG +SE Sbjct: 169 LGSGLAQIYPARHKKLAEQIIEKGGALVSEF 199 >gi|294789444|ref|ZP_06754681.1| putative DNA processing protein DprA [Simonsiella muelleri ATCC 29453] gi|294482657|gb|EFG30347.1| putative DNA processing protein DprA [Simonsiella muelleri ATCC 29453] Length = 421 Score = 60.7 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP EN+ L +I + G+ +SE P G Sbjct: 176 GTGIDRIYPNENKKLAYQIAE-KGLIVSEFPLG 207 >gi|15603464|ref|NP_246538.1| hypothetical protein PM1599 [Pasteurella multocida subsp. multocida str. Pm70] gi|12721995|gb|AAK03683.1| DprA [Pasteurella multocida subsp. multocida str. Pm70] Length = 373 Score = 60.7 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 20/31 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP ++R L E+I ++ G +SE Sbjct: 169 LGSGLEVIYPKKHRGLAEKIIEHQGALVSEF 199 >gi|15639384|ref|NP_218833.1| smf protein (smf) [Treponema pallidum subsp. pallidum str. Nichols] gi|189025626|ref|YP_001933398.1| protein Smf [Treponema pallidum subsp. pallidum SS14] gi|3322671|gb|AAC65377.1| smf protein (smf) [Treponema pallidum subsp. pallidum str. Nichols] gi|189018201|gb|ACD70819.1| protein Smf [Treponema pallidum subsp. pallidum SS14] gi|291059783|gb|ADD72518.1| DNA protecting protein DprA [Treponema pallidum subsp. pallidum str. Chicago] Length = 302 Score = 60.7 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G+D LYP N L I + GG +SE Sbjct: 178 LACGVDQLYPRSNSALAARIIETGGCILSEYAP 210 >gi|16329968|ref|NP_440696.1| hypothetical protein slr1197 [Synechocystis sp. PCC 6803] gi|3914979|sp|P73345|SMF_SYNY3 RecName: Full=Protein smf gi|1652454|dbj|BAA17376.1| slr1197 [Synechocystis sp. PCC 6803] Length = 398 Score = 60.7 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YPP+NR L E+I G+ +SE P G Sbjct: 178 LGTGLDLIYPPQNRQLFEQIAAE-GLILSEYPVG 210 >gi|57234466|ref|YP_181459.1| DNA processing protein DprA, putative [Dehalococcoides ethenogenes 195] gi|57224914|gb|AAW39971.1| DNA processing protein DprA, putative [Dehalococcoides ethenogenes 195] Length = 406 Score = 60.7 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN L +I +N G +SE P G Sbjct: 207 GCGLDIIYPSENSCLARQIAEN-GALVSEHPPG 238 >gi|220917985|ref|YP_002493289.1| DNA protecting protein DprA [Anaeromyxobacter dehalogenans 2CP-1] gi|219955839|gb|ACL66223.1| DNA protecting protein DprA [Anaeromyxobacter dehalogenans 2CP-1] Length = 320 Score = 60.7 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP ++R L E I + GG +SE+P G Sbjct: 128 LGTGVDVVYPRQHRALFEGILETGGALVSELPDG 161 >gi|300718671|ref|YP_003743474.1| DNA protecting protein [Erwinia billingiae Eb661] gi|299064507|emb|CAX61627.1| DNA protecting protein [Erwinia billingiae Eb661] Length = 374 Score = 60.7 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++ +L +EI +GG ISE P Sbjct: 167 LGSGLNHLYPRQHISLAKEIIASGGAVISEFPL 199 >gi|332967865|gb|EGK06961.1| SMF-family protein [Kingella kingae ATCC 23330] Length = 401 Score = 60.7 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N+ L +I + G ISE P G Sbjct: 183 GTGIDRIYPQSNQKLAYQIAER-GAIISEFPLG 214 >gi|229491474|ref|ZP_04385298.1| transcriptional regulator, TrmB [Rhodococcus erythropolis SK121] gi|229321759|gb|EEN87556.1| transcriptional regulator, TrmB [Rhodococcus erythropolis SK121] Length = 375 Score = 60.7 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + LL++I + G ISE P G Sbjct: 181 LACGVDRAYPSGHARLLKQI-ASSGAVISEYPPG 213 >gi|147669298|ref|YP_001214116.1| DNA protecting protein DprA [Dehalococcoides sp. BAV1] gi|146270246|gb|ABQ17238.1| DNA protecting protein DprA [Dehalococcoides sp. BAV1] Length = 373 Score = 60.7 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN +L +I + G ISE P G Sbjct: 174 GCGLDIIYPSENHSLARQIAE-DGALISEHPPG 205 >gi|304399255|ref|ZP_07381121.1| DNA protecting protein DprA [Pantoea sp. aB] gi|304353181|gb|EFM17562.1| DNA protecting protein DprA [Pantoea sp. aB] Length = 374 Score = 60.7 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + +L EI + GG ISE P Sbjct: 167 LGSGLQNLYPKNHADLAAEIVEQGGAVISEFPL 199 >gi|270264339|ref|ZP_06192605.1| DNA protecting protein DprA [Serratia odorifera 4Rx13] gi|270041475|gb|EFA14573.1| DNA protecting protein DprA [Serratia odorifera 4Rx13] Length = 373 Score = 60.7 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP +R L E+I ++GG ISE Sbjct: 167 LGSGLANIYPRRHRRLAEQIVEHGGAVISEY 197 >gi|169838993|ref|ZP_02872181.1| DNA uptake protein, SMF family [candidate division TM7 single-cell isolate TM7a] Length = 169 Score = 60.7 bits (148), Expect = 7e-08, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +NR L E I +N G +SE P G Sbjct: 31 GTGLDIVYPYDNRGLWERIAEN-GTIVSEYPLG 62 >gi|206579194|ref|YP_002236312.1| DNA protecting protein DprA [Klebsiella pneumoniae 342] gi|206568252|gb|ACI10028.1| DNA protecting protein DprA [Klebsiella pneumoniae 342] Length = 360 Score = 60.7 bits (148), Expect = 7e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + NL ++I DNGG +SE P Sbjct: 167 LGNGLEQVYPRRHANLAQQIIDNGGTLVSEFPL 199 >gi|160947178|ref|ZP_02094345.1| hypothetical protein PEPMIC_01111 [Parvimonas micra ATCC 33270] gi|158446312|gb|EDP23307.1| hypothetical protein PEPMIC_01111 [Parvimonas micra ATCC 33270] Length = 364 Score = 60.7 bits (148), Expect = 7e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP N L +EI +N G +SE P G Sbjct: 173 LGCGVDIAYPKTNYRLYDEIIEN-GAVMSEFPIG 205 >gi|152980408|ref|YP_001351831.1| DNA processing protein [Janthinobacterium sp. Marseille] gi|151280485|gb|ABR88895.1| DNA processing protein [Janthinobacterium sp. Marseille] Length = 371 Score = 60.7 bits (148), Expect = 7e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP NR L +I +N G +SE P G Sbjct: 182 IGTGMDIVYPARNRQLAHQIAEN-GCILSEYPLG 214 >gi|258545463|ref|ZP_05705697.1| DNA processing protein DprA [Cardiobacterium hominis ATCC 15826] gi|258519296|gb|EEV88155.1| DNA processing protein DprA [Cardiobacterium hominis ATCC 15826] Length = 369 Score = 60.7 bits (148), Expect = 7e-08, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + +L I G +SE P G Sbjct: 176 GTGLDRVYPARHHDLAHRISAQ-GAIVSEYPIG 207 >gi|260221948|emb|CBA31022.1| Protein smf [Curvibacter putative symbiont of Hydra magnipapillata] Length = 392 Score = 60.7 bits (148), Expect = 7e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + +L I GG+ +SE P G Sbjct: 192 GTGLDRVYPKAHLDLAHRIAA-GGVLLSEYPLG 223 >gi|218263971|ref|ZP_03477902.1| hypothetical protein PRABACTJOHN_03592 [Parabacteroides johnsonii DSM 18315] gi|218222382|gb|EEC95032.1| hypothetical protein PRABACTJOHN_03592 [Parabacteroides johnsonii DSM 18315] Length = 322 Score = 60.7 bits (148), Expect = 7e-08, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Query: 1 MAGGLDC--LYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP EN L ++I + GG+ +SE P G Sbjct: 179 LANGLDWESIYPKENLELAKDIVEKGGLLLSEYPVG 214 >gi|163859049|ref|YP_001633347.1| hypothetical protein Bpet4728 [Bordetella petrii DSM 12804] gi|163262777|emb|CAP45080.1| conserved hypothetical protein [Bordetella petrii] Length = 371 Score = 60.7 bits (148), Expect = 7e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G+D +YP +R L I + G ISE+P G Sbjct: 182 MGTGIDRVYPASHRELAHRIAAH-GALISELPMG 214 >gi|260892472|ref|YP_003238569.1| DNA protecting protein DprA [Ammonifex degensii KC4] gi|260864613|gb|ACX51719.1| DNA protecting protein DprA [Ammonifex degensii KC4] Length = 375 Score = 60.7 bits (148), Expect = 7e-08, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP EN NL EI + G +SE P G Sbjct: 172 LGTGCDRCYPRENWNLWREI-ERKGALVSEFPLG 204 >gi|238021547|ref|ZP_04601973.1| hypothetical protein GCWU000324_01447 [Kingella oralis ATCC 51147] gi|237866161|gb|EEP67203.1| hypothetical protein GCWU000324_01447 [Kingella oralis ATCC 51147] Length = 389 Score = 60.7 bits (148), Expect = 7e-08, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YP NR L +I + G+ +SE P Sbjct: 176 GTGIDRIYPASNRALAHQIAEQ-GLIVSEFPL 206 >gi|319764919|ref|YP_004128856.1| DNA protecting protein dpra [Alicycliphilus denitrificans BC] gi|317119480|gb|ADV01969.1| DNA protecting protein DprA [Alicycliphilus denitrificans BC] Length = 379 Score = 60.7 bits (148), Expect = 7e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP N+ L I G+ +SE P G Sbjct: 189 GTGLDRVYPRANKELAHRI-ARHGLLVSEYPLG 220 >gi|120613317|ref|YP_972995.1| DNA protecting protein DprA [Acidovorax citrulli AAC00-1] gi|120591781|gb|ABM35221.1| DNA protecting protein DprA [Acidovorax citrulli AAC00-1] Length = 408 Score = 60.7 bits (148), Expect = 7e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R+L I G+ +SE P G Sbjct: 207 GTGLDRVYPARHRDLAHRI-ARQGVVVSEYPLG 238 >gi|325673466|ref|ZP_08153157.1| DNA protecting protein DprA [Rhodococcus equi ATCC 33707] gi|325555487|gb|EGD25158.1| DNA protecting protein DprA [Rhodococcus equi ATCC 33707] Length = 373 Score = 60.4 bits (147), Expect = 7e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + LL++I G ISE P G Sbjct: 181 LACGVDRAYPAGHGRLLQQI-ARDGAVISEYPPG 213 >gi|156932269|ref|YP_001436185.1| DNA protecting protein DprA [Cronobacter sakazakii ATCC BAA-894] gi|156530523|gb|ABU75349.1| hypothetical protein ESA_00040 [Cronobacter sakazakii ATCC BAA-894] Length = 370 Score = 60.4 bits (147), Expect = 7e-08, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +R L EEI + GG +SE PF Sbjct: 167 LGNGLAQVYPTRHRKLAEEIVERGGALVSEFPF 199 >gi|312139229|ref|YP_004006565.1| smf family protein [Rhodococcus equi 103S] gi|311888568|emb|CBH47880.1| putative SMF family protein [Rhodococcus equi 103S] Length = 373 Score = 60.4 bits (147), Expect = 7e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + LL++I G ISE P G Sbjct: 181 LACGVDRAYPAGHGRLLQQI-ARDGAVISEYPPG 213 >gi|261250602|ref|ZP_05943177.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio orientalis CIP 102891] gi|260939171|gb|EEX95158.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio orientalis CIP 102891] Length = 371 Score = 60.4 bits (147), Expect = 7e-08, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +R+L I D+GG +SE Sbjct: 171 LGCGLNTIYPARHRDLALRIIDSGGALVSEF 201 >gi|110832994|ref|YP_691853.1| peptide deformylase, DNA processing protein [Alcanivorax borkumensis SK2] gi|110646105|emb|CAL15581.1| peptide deformylase, DNA processing protein [Alcanivorax borkumensis SK2] Length = 353 Score = 60.4 bits (147), Expect = 7e-08, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G D +YPP N +L EEI D GG +SE G Sbjct: 165 MGNGPDRIYPPRNGSLAEEIVDTGGALVSEFAPG 198 >gi|164686892|ref|ZP_02210920.1| hypothetical protein CLOBAR_00488 [Clostridium bartlettii DSM 16795] gi|164604282|gb|EDQ97747.1| hypothetical protein CLOBAR_00488 [Clostridium bartlettii DSM 16795] Length = 329 Score = 60.4 bits (147), Expect = 8e-08, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M GLD +YP N +L + I +N G ISE P Sbjct: 178 MPCGLDMVYPNNNCDLFKRIINNNGCVISEYPP 210 >gi|241766762|ref|ZP_04764592.1| DNA protecting protein DprA [Acidovorax delafieldii 2AN] gi|241362868|gb|EER58607.1| DNA protecting protein DprA [Acidovorax delafieldii 2AN] Length = 390 Score = 60.4 bits (147), Expect = 8e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +N L I G+ +SE P G Sbjct: 193 GTGLDRVYPRQNLGLARRIAAQ-GLLVSEYPLG 224 >gi|262202034|ref|YP_003273242.1| DNA protecting protein DprA [Gordonia bronchialis DSM 43247] gi|262085381|gb|ACY21349.1| DNA protecting protein DprA [Gordonia bronchialis DSM 43247] Length = 374 Score = 60.4 bits (147), Expect = 8e-08, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MA G+D YP + LL EI G ISE P G Sbjct: 183 MACGIDRDYPAAHAQLLREI-ARVGAVISEYPPG 215 >gi|257125884|ref|YP_003163998.1| DNA protecting protein DprA [Leptotrichia buccalis C-1013-b] gi|257049823|gb|ACV39007.1| DNA protecting protein DprA [Leptotrichia buccalis C-1013-b] Length = 363 Score = 60.4 bits (147), Expect = 8e-08, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ENR+L E I + G ISE P G Sbjct: 176 GTGLDIVYPYENRDLWERIGE-VGTLISEYPLG 207 >gi|223041758|ref|ZP_03611951.1| protein smf (DNA-processing chain A) [Actinobacillus minor 202] gi|223017442|gb|EEF15860.1| protein smf (DNA-processing chain A) [Actinobacillus minor 202] Length = 382 Score = 60.4 bits (147), Expect = 8e-08, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP ++ L E+I + GG +SE Sbjct: 169 LGSGLAQIYPARHKKLAEQIIEKGGALVSEF 199 >gi|134299832|ref|YP_001113328.1| DNA protecting protein DprA [Desulfotomaculum reducens MI-1] gi|134052532|gb|ABO50503.1| DNA protecting protein DprA [Desulfotomaculum reducens MI-1] Length = 364 Score = 60.4 bits (147), Expect = 8e-08, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP EN L+++I + G I+E P G Sbjct: 172 LGCGPDIVYPRENEKLMKQIIE-KGAIITEFPPG 204 >gi|291459162|ref|ZP_06598552.1| DNA processing protein DprA [Oribacterium sp. oral taxon 078 str. F0262] gi|291418416|gb|EFE92135.1| DNA processing protein DprA [Oribacterium sp. oral taxon 078 str. F0262] Length = 329 Score = 60.4 bits (147), Expect = 8e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP N L E I + GG +SE P G Sbjct: 110 LGCGADICYPRSNYELYERIAEQGG-ILSEFPAG 142 >gi|261823199|ref|YP_003261305.1| DNA protecting protein DprA [Pectobacterium wasabiae WPP163] gi|261607212|gb|ACX89698.1| DNA protecting protein DprA [Pectobacterium wasabiae WPP163] Length = 373 Score = 60.4 bits (147), Expect = 8e-08, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + L E I +GG +SE P Sbjct: 167 LGSGLENIYPKRHAKLAERICGDGGALVSEFPL 199 >gi|237736954|ref|ZP_04567435.1| topoisomerase [Fusobacterium mortiferum ATCC 9817] gi|229420816|gb|EEO35863.1| topoisomerase [Fusobacterium mortiferum ATCC 9817] Length = 356 Score = 60.4 bits (147), Expect = 8e-08, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ENR + EEI + G+ +SE P G Sbjct: 170 GSGLDIIYPYENRKIWEEIGE-KGLLLSEYPMG 201 >gi|163759336|ref|ZP_02166422.1| putative smf protein [Hoeflea phototrophica DFL-43] gi|162283740|gb|EDQ34025.1| putative smf protein [Hoeflea phototrophica DFL-43] Length = 383 Score = 60.4 bits (147), Expect = 8e-08, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 25/34 (73%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN +L +EI G+AISE+P G Sbjct: 178 LAGGLDQPYPPENLDLYDEIRAGKGLAISEMPMG 211 >gi|270308041|ref|YP_003330099.1| Rossmann fold DNA uptake nucleotide-binding protein [Dehalococcoides sp. VS] gi|270153933|gb|ACZ61771.1| Rossmann fold DNA uptake nucleotide-binding protein [Dehalococcoides sp. VS] Length = 373 Score = 60.4 bits (147), Expect = 8e-08, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN L +I +N G +SE P G Sbjct: 174 GCGLDIIYPSENSCLARQIAEN-GALVSEHPPG 205 >gi|260655606|ref|ZP_05861092.1| DNA protecting protein DprA [Jonquetella anthropi E3_33 E1] gi|260629659|gb|EEX47853.1| DNA protecting protein DprA [Jonquetella anthropi E3_33 E1] Length = 366 Score = 60.4 bits (147), Expect = 9e-08, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D ++P + L I +GG ISE P G Sbjct: 170 LGTGVDVVWPRGHEELFSRIIGSGGSLISEYPLG 203 >gi|330827123|ref|YP_004390426.1| DNA protecting protein DprA [Alicycliphilus denitrificans K601] gi|329312495|gb|AEB86910.1| DNA protecting protein DprA [Alicycliphilus denitrificans K601] Length = 379 Score = 60.4 bits (147), Expect = 9e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP N+ L I G+ +SE P G Sbjct: 189 GTGLDRVYPRANKELAHRI-ARHGLLVSEYPLG 220 >gi|225375312|ref|ZP_03752533.1| hypothetical protein ROSEINA2194_00937 [Roseburia inulinivorans DSM 16841] gi|225212801|gb|EEG95155.1| hypothetical protein ROSEINA2194_00937 [Roseburia inulinivorans DSM 16841] Length = 359 Score = 60.4 bits (147), Expect = 9e-08, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ YP N+ L E+I +GG ISE P Sbjct: 169 LGCGVNICYPRTNQKLYEDILSHGG-IISEYPP 200 >gi|124516263|gb|EAY57771.1| DNA processing protein DprA [Leptospirillum rubarum] Length = 306 Score = 60.4 bits (147), Expect = 9e-08, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L EEI GG +SE P G Sbjct: 177 GTGLDRVYPDFHRALAEEILAKGGGIVSEFPPG 209 >gi|207727556|ref|YP_002255950.1| smf protein (predicted rossmann fold nucleotide-binding protein involved in dna uptake) [Ralstonia solanacearum MolK2] gi|206590793|emb|CAQ56405.1| smf protein (predicted rossmann fold nucleotide-binding protein involved in dna uptake) [Ralstonia solanacearum MolK2] Length = 403 Score = 60.4 bits (147), Expect = 9e-08, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR L I + G+ +SE P G Sbjct: 198 GTGLDMVYPARNRALAHRIAET-GLIVSEYPLG 229 >gi|150396156|ref|YP_001326623.1| DNA protecting protein DprA [Sinorhizobium medicae WSM419] gi|150027671|gb|ABR59788.1| DNA protecting protein DprA [Sinorhizobium medicae WSM419] Length = 383 Score = 60.4 bits (147), Expect = 9e-08, Method: Composition-based stats. Identities = 23/34 (67%), Positives = 27/34 (79%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN LL+EI GG+AISE+PFG Sbjct: 178 LAGGLDRPYPPENIGLLQEIVSGGGLAISEMPFG 211 >gi|117928755|ref|YP_873306.1| DNA protecting protein DprA [Acidothermus cellulolyticus 11B] gi|117649218|gb|ABK53320.1| DNA protecting protein DprA [Acidothermus cellulolyticus 11B] Length = 391 Score = 60.4 bits (147), Expect = 9e-08, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP N L I + G+ +SE P G Sbjct: 196 LACGVDVCYPRGNATLFHRIL-STGLLLSEWPPG 228 >gi|253690149|ref|YP_003019339.1| DNA protecting protein DprA [Pectobacterium carotovorum subsp. carotovorum PC1] gi|251756727|gb|ACT14803.1| DNA protecting protein DprA [Pectobacterium carotovorum subsp. carotovorum PC1] Length = 373 Score = 60.4 bits (147), Expect = 9e-08, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + L E I +GG +SE P Sbjct: 167 LGSGLENIYPKRHAKLAERICGDGGALVSEFPL 199 >gi|154504527|ref|ZP_02041265.1| hypothetical protein RUMGNA_02031 [Ruminococcus gnavus ATCC 29149] gi|153795009|gb|EDN77429.1| hypothetical protein RUMGNA_02031 [Ruminococcus gnavus ATCC 29149] Length = 360 Score = 60.4 bits (147), Expect = 9e-08, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP + L +I + G +SE+P G Sbjct: 169 LGSGVDVCYPKNHMGLYLDILEQEGGILSELPPG 202 >gi|94266973|ref|ZP_01290622.1| SMF protein [delta proteobacterium MLMS-1] gi|93452328|gb|EAT02959.1| SMF protein [delta proteobacterium MLMS-1] Length = 381 Score = 60.4 bits (147), Expect = 9e-08, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YPP+NR L I G+ + E P G Sbjct: 176 LGCGLDVVYPPQNRQLFHTIGRQRGLLLGEYPLG 209 >gi|83748635|ref|ZP_00945653.1| Smf protein [Ralstonia solanacearum UW551] gi|207741947|ref|YP_002258339.1| smf protein (predicted rossmann fold nucleotide-binding protein involved in dna uptake) [Ralstonia solanacearum IPO1609] gi|83724679|gb|EAP71839.1| Smf protein [Ralstonia solanacearum UW551] gi|206593333|emb|CAQ60260.1| smf protein (predicted rossmann fold nucleotide-binding protein involved in dna uptake) [Ralstonia solanacearum IPO1609] Length = 403 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR L I + G+ +SE P G Sbjct: 198 GTGLDMVYPARNRALAHRIAET-GLIVSEYPLG 229 >gi|298372209|ref|ZP_06982199.1| DNA processing protein DprA [Bacteroidetes oral taxon 274 str. F0058] gi|298275113|gb|EFI16664.1| DNA processing protein DprA [Bacteroidetes oral taxon 274 str. F0058] Length = 363 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 A GLD +YP +++ L I GG I+E P Sbjct: 174 AHGLDRVYPAQHKGLAASIVQQGGAIITEYP 204 >gi|326319400|ref|YP_004237072.1| DNA protecting protein DprA [Acidovorax avenae subsp. avenae ATCC 19860] gi|323376236|gb|ADX48505.1| DNA protecting protein DprA [Acidovorax avenae subsp. avenae ATCC 19860] Length = 403 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R+L I G+ +SE P G Sbjct: 202 GTGLDRVYPARHRDLAHRI-ARQGVVVSEYPLG 233 >gi|170079101|ref|YP_001735739.1| DNA protecting protein [Synechococcus sp. PCC 7002] gi|169886770|gb|ACB00484.1| DNA protecting protein [Synechococcus sp. PCC 7002] Length = 381 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +RNL EI G+ +SE P G Sbjct: 175 LGTGIDQIYPASHRNLYNEILAQ-GLILSEYPAG 207 >gi|73543092|ref|YP_297612.1| SMF protein [Ralstonia eutropha JMP134] gi|72120505|gb|AAZ62768.1| SMF protein [Ralstonia eutropha JMP134] Length = 379 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP N L I + G +SE P G Sbjct: 190 IGTGADRVYPARNLKLAHRIAEQ-GAIVSEFPLG 222 >gi|320161003|ref|YP_004174227.1| putative DNA processing protein [Anaerolinea thermophila UNI-1] gi|319994856|dbj|BAJ63627.1| putative DNA processing protein [Anaerolinea thermophila UNI-1] Length = 370 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YPPE+ L E+I G IS+ G Sbjct: 172 LGCGLDRIYPPEHSKLAEKII-QQGALISDYAPG 204 >gi|259909965|ref|YP_002650321.1| DNA protecting protein [Erwinia pyrifoliae Ep1/96] gi|224965587|emb|CAX57119.1| DNA protecting protein [Erwinia pyrifoliae Ep1/96] gi|283480065|emb|CAY75981.1| Protein smf [Erwinia pyrifoliae DSM 12163] Length = 374 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L ++I D+GG +SE P Sbjct: 167 LGSGLQAVYPRQHQALAQQIIDSGGALVSEFPL 199 >gi|222112557|ref|YP_002554821.1| DNA protecting protein dpra [Acidovorax ebreus TPSY] gi|221732001|gb|ACM34821.1| DNA protecting protein DprA [Acidovorax ebreus TPSY] Length = 386 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP N+ L I G+ +SE P G Sbjct: 193 GTGLDRVYPRANKELAHRI-ARHGLLVSEYPLG 224 >gi|121596333|ref|YP_988229.1| Fis family transcriptional regulator [Acidovorax sp. JS42] gi|120608413|gb|ABM44153.1| DNA protecting protein DprA [Acidovorax sp. JS42] Length = 386 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP N+ L I G+ +SE P G Sbjct: 193 GTGLDRVYPRANKELAHRI-ARHGLLVSEYPLG 224 >gi|260886588|ref|ZP_05897851.1| DNA processing protein DprA [Selenomonas sputigena ATCC 35185] gi|260863731|gb|EEX78231.1| DNA processing protein DprA [Selenomonas sputigena ATCC 35185] Length = 370 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN LL EI + G ISE G Sbjct: 177 LGCGVDVAYPRENARLLAEIAE-KGAVISEYAPG 209 >gi|114566375|ref|YP_753529.1| DNA uptake Rossmann fold nucleotide-binding protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] gi|114337310|gb|ABI68158.1| Rossmann-fold nucleotide-binding protein involved in DNA uptake [Syntrophomonas wolfei subsp. wolfei str. Goettingen] Length = 362 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP N+ L EI + G+ ISE P Sbjct: 172 LGSGLNIIYPRSNKRLFHEIIEQ-GVVISEFPL 203 >gi|94263095|ref|ZP_01286914.1| SMF protein [delta proteobacterium MLMS-1] gi|93456638|gb|EAT06746.1| SMF protein [delta proteobacterium MLMS-1] Length = 381 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YPP+NR L I G+ + E P G Sbjct: 176 LGCGLDVVYPPQNRQLFHTIGRQRGLLLGEYPLG 209 >gi|332976751|gb|EGK13582.1| DNA processing protein DprA [Desmospora sp. 8437] Length = 396 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +R+L +E+ G ISE+P G Sbjct: 205 LGCGVDVVYPRHHRDLYKEVV-RKGAVISEVPPG 237 >gi|296139360|ref|YP_003646603.1| DNA protecting protein DprA [Tsukamurella paurometabola DSM 20162] gi|296027494|gb|ADG78264.1| DNA protecting protein DprA [Tsukamurella paurometabola DSM 20162] Length = 388 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGLD YP + L I + G ISE P G Sbjct: 192 AGGLDRPYPAGHAGLFRRIAE-DGAVISEYPPG 223 >gi|300705528|ref|YP_003747131.1| smf, DNA processing chain a (drpa) [Ralstonia solanacearum CFBP2957] gi|299073192|emb|CBJ44550.1| putative smf, DNA processing chain A (drpA) [Ralstonia solanacearum CFBP2957] Length = 403 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR L I + G+ +SE P G Sbjct: 198 GTGLDMVYPARNRALAHRIAET-GLIVSEYPLG 229 >gi|56459131|ref|YP_154412.1| DNA uptake Rossmann fold nucleotide-binding protein [Idiomarina loihiensis L2TR] gi|56178141|gb|AAV80863.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Idiomarina loihiensis L2TR] Length = 336 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP N+ L ++ + G+ ISE P G Sbjct: 145 LGTGIDQYYPRRNKAL-QDFIAHQGLLISEFPPG 177 >gi|330839578|ref|YP_004414158.1| DNA protecting protein DprA [Selenomonas sputigena ATCC 35185] gi|329747342|gb|AEC00699.1| DNA protecting protein DprA [Selenomonas sputigena ATCC 35185] Length = 364 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN LL EI + G ISE G Sbjct: 171 LGCGVDVAYPRENARLLAEIAE-KGAVISEYAPG 203 >gi|331007628|ref|ZP_08330770.1| Rossmann fold nucleotide-binding protein [gamma proteobacterium IMCC1989] gi|330418568|gb|EGG93092.1| Rossmann fold nucleotide-binding protein [gamma proteobacterium IMCC1989] Length = 391 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 24/33 (72%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MA G++ +YP ++NL E+I ++GG+ I+E P Sbjct: 194 MATGINSVYPKRHQNLAEQIVEDGGVLITEFPP 226 >gi|225677140|ref|ZP_03788139.1| DNA processing chain A [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|225590807|gb|EEH12035.1| DNA processing chain A [Wolbachia endosymbiont of Muscidifurax uniraptor] Length = 362 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 25/32 (78%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP EN +L ++I +NGG+ ++E+PF Sbjct: 164 ASGIDVVYPKENFDLYKKITENGGLVVTELPF 195 >gi|225025550|ref|ZP_03714742.1| hypothetical protein EIKCOROL_02450 [Eikenella corrodens ATCC 23834] gi|224941696|gb|EEG22905.1| hypothetical protein EIKCOROL_02450 [Eikenella corrodens ATCC 23834] Length = 430 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N+ L I + G +SE P G Sbjct: 176 GTGIDRVYPVANKALAHRIAEQ-GCVLSEFPLG 207 >gi|91790470|ref|YP_551422.1| DNA processing protein DprA [Polaromonas sp. JS666] gi|91699695|gb|ABE46524.1| DNA protecting protein DprA [Polaromonas sp. JS666] Length = 374 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L I G+ ISE P G Sbjct: 183 GTGLDRVYPKRHLALAHRI-AQQGMLISEFPLG 214 >gi|332297601|ref|YP_004439523.1| DNA protecting protein DprA [Treponema brennaborense DSM 12168] gi|332180704|gb|AEE16392.1| DNA protecting protein DprA [Treponema brennaborense DSM 12168] Length = 329 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP NR L + + GG +SE G Sbjct: 172 LPCGADTVYPAANRRLAAAMIETGGCLLSEYAPG 205 >gi|329295655|ref|ZP_08252991.1| DNA protecting protein DprA [Plautia stali symbiont] Length = 374 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++ L +EI +GG +SE+P Sbjct: 167 LGSGLNHLYPKSHQPLAQEIIASGGALVSELPL 199 >gi|254477402|ref|ZP_05090788.1| DNA protecting protein DprA [Ruegeria sp. R11] gi|214031645|gb|EEB72480.1| DNA protecting protein DprA [Ruegeria sp. R11] Length = 362 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YP EN L +I D G+ +SE P G Sbjct: 145 MAGGVDVIYPAENLQLARDIADQ-GLLLSEHPPG 177 >gi|320355022|ref|YP_004196361.1| DNA protecting protein DprA [Desulfobulbus propionicus DSM 2032] gi|320123524|gb|ADW19070.1| DNA protecting protein DprA [Desulfobulbus propionicus DSM 2032] Length = 376 Score = 60.0 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP + +L +E+ G+ +SE P G Sbjct: 178 LGCGVDVVYPRAHADLFQELAAQ-GLLLSEYPLG 210 >gi|325292667|ref|YP_004278531.1| DNA processing chain A [Agrobacterium sp. H13-3] gi|325060520|gb|ADY64211.1| DNA processing chain A [Agrobacterium sp. H13-3] Length = 379 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP EN LL++I++ GG ISE+PFG Sbjct: 178 LAGGLDRPYPQENFGLLQDIYEEGGATISEMPFG 211 >gi|148256077|ref|YP_001240662.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. BTAi1] gi|146408250|gb|ABQ36756.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. BTAi1] Length = 372 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 24/34 (70%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YPPE+ +LL I + G AISE+P G Sbjct: 175 LAGGHDRIYPPEHIDLLGAIVERNGAAISEMPLG 208 >gi|307822753|ref|ZP_07652984.1| DNA protecting protein DprA [Methylobacter tundripaludum SV96] gi|307736357|gb|EFO07203.1| DNA protecting protein DprA [Methylobacter tundripaludum SV96] Length = 350 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +++L EI N G ISE P G Sbjct: 160 GTGLDRVYPARHKDLATEIV-NTGAMISEFPPG 191 >gi|158337778|ref|YP_001518954.1| DNA protecting protein DprA [Acaryochloris marina MBIC11017] gi|158308019|gb|ABW29636.1| DNA protecting protein DprA [Acaryochloris marina MBIC11017] Length = 376 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPP N+ L ++I + G+ +SE P G Sbjct: 176 LGTGVDMIYPPRNQGLYQKI-EQQGLLLSEYPSG 208 >gi|251779444|ref|ZP_04822364.1| DNA protecting protein DprA [Clostridium botulinum E1 str. 'BoNT E Beluga'] gi|243083759|gb|EES49649.1| DNA protecting protein DprA [Clostridium botulinum E1 str. 'BoNT E Beluga'] Length = 352 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN +L ++ G+ ISE P G Sbjct: 168 LGCGIDVVYPSENIDLFSKVIK-DGLIISEFPLG 200 >gi|150390497|ref|YP_001320546.1| DNA protecting protein DprA [Alkaliphilus metalliredigens QYMF] gi|149950359|gb|ABR48887.1| DNA protecting protein DprA [Alkaliphilus metalliredigens QYMF] Length = 365 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GL+ YP N+ L +I ++ G +SE G Sbjct: 173 LGCGLEQCYPASNQMLFNKIIESDGCILSEYAPG 206 >gi|310765563|gb|ADP10513.1| DNA protecting protein [Erwinia sp. Ejp617] Length = 374 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L +I D+GG +SE P Sbjct: 167 LGSGLQAVYPRQHQALARQIIDSGGALVSEFPL 199 >gi|144898216|emb|CAM75080.1| DNA processing chain A [Magnetospirillum gryphiswaldense MSR-1] Length = 377 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPPEN+ L ++I G A+SE+P G Sbjct: 173 LAGGVDVVYPPENQRLYDDIVAM-GCAVSEMPPG 205 >gi|188589719|ref|YP_001920600.1| DNA protecting protein DprA [Clostridium botulinum E3 str. Alaska E43] gi|188500000|gb|ACD53136.1| DNA protecting protein DprA [Clostridium botulinum E3 str. Alaska E43] Length = 352 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN +L ++ G+ ISE P G Sbjct: 168 LGCGIDVVYPSENIDLFSKVIK-DGLIISEFPLG 200 >gi|86607132|ref|YP_475895.1| DNA protecting protein DprA [Synechococcus sp. JA-3-3Ab] gi|86555674|gb|ABD00632.1| DNA protecting protein DprA [Synechococcus sp. JA-3-3Ab] Length = 381 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP +R+L I + G +SE P G Sbjct: 192 GTGVDQVYPAHHRSLYRRILEQ-GAVLSEYPPG 223 >gi|254361451|ref|ZP_04977591.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia haemolytica PHL213] gi|153092961|gb|EDN73987.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia haemolytica PHL213] Length = 382 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP ++ L E+I D GG +SE Sbjct: 169 LGSGLNQVYPARHKKLAEQIVDLGGALVSEFSP 201 >gi|281421987|ref|ZP_06252986.1| putative DNA protecting protein DprA [Prevotella copri DSM 18205] gi|281403945|gb|EFB34625.1| putative DNA protecting protein DprA [Prevotella copri DSM 18205] Length = 321 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Query: 1 MAGGLDC--LYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP EN L + I ++GG+ +SE P G Sbjct: 179 LANGLDWESIYPKENLELAKNIVESGGLLLSEYPVG 214 >gi|85859218|ref|YP_461420.1| SMF family protein involved in DNA uptake [Syntrophus aciditrophicus SB] gi|85722309|gb|ABC77252.1| SMF family protein involved in DNA uptake [Syntrophus aciditrophicus SB] Length = 394 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YPPEN+NL E+I G ISE+ G Sbjct: 173 LGCGLDIVYPPENKNLYEKIAA-DGAVISELALG 205 >gi|52424096|ref|YP_087233.1| Smf protein [Mannheimia succiniciproducens MBEL55E] gi|52306148|gb|AAU36648.1| Smf protein [Mannheimia succiniciproducens MBEL55E] Length = 343 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 15/33 (45%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ++ L I + G +SE Sbjct: 145 LGSGLQHIYPARHKKLARRIIETNGALVSEFFP 177 >gi|187930744|ref|YP_001901231.1| DNA protecting protein DprA [Ralstonia pickettii 12J] gi|187727634|gb|ACD28799.1| DNA protecting protein DprA [Ralstonia pickettii 12J] Length = 402 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR L I + G+ ISE P G Sbjct: 198 GTGLDIVYPARNRALAHRIAEA-GVIISEYPLG 229 >gi|327399011|ref|YP_004339880.1| DNA protecting protein DprA [Hippea maritima DSM 10411] gi|327181640|gb|AEA33821.1| DNA protecting protein DprA [Hippea maritima DSM 10411] Length = 333 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN+ L +++ G I+E P G Sbjct: 146 LGCGIDIIYPKENKPLFDKM-SQEGCIITEFPLG 178 >gi|307611476|emb|CBX01147.1| hypothetical protein LPW_28461 [Legionella pneumophila 130b] Length = 361 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+DC+YP + L E+I +N G+ +SE P Sbjct: 171 LGTGIDCIYPRRHLKLAEQITEN-GLLLSEFPL 202 >gi|182412005|ref|YP_001817071.1| DNA protecting protein DprA [Opitutus terrae PB90-1] gi|177839219|gb|ACB73471.1| DNA protecting protein DprA [Opitutus terrae PB90-1] Length = 382 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPPEN L +I + G +SE PFG Sbjct: 178 GCGIDIIYPPENLALYRQI-EATGAVLSEFPFG 209 >gi|169630293|ref|YP_001703942.1| hypothetical protein MAB_3212c [Mycobacterium abscessus ATCC 19977] gi|169242260|emb|CAM63288.1| Conserved hypothetical protein [Mycobacterium abscessus] Length = 378 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + LL I G+ +SE P G Sbjct: 180 LAGGVDVPYPAGHSGLLYRI-ARHGLVVSEYPPG 212 >gi|329118699|ref|ZP_08247400.1| SMF-family protein [Neisseria bacilliformis ATCC BAA-1200] gi|327465202|gb|EGF11486.1| SMF-family protein [Neisseria bacilliformis ATCC BAA-1200] Length = 422 Score = 59.6 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI ++ G+ +SE P G Sbjct: 195 GTGIDRIYPPSNKNLAYEIAEH-GLIVSEFPLG 226 >gi|330818689|ref|YP_004362394.1| DNA processing protein DprA, putative [Burkholderia gladioli BSR3] gi|327371082|gb|AEA62438.1| DNA processing protein DprA, putative [Burkholderia gladioli BSR3] Length = 460 Score = 59.6 bits (145), Expect = 2e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L +I + G +SE P G Sbjct: 181 GTGLDRVYPAAHRQLARQIAAH-GALLSEWPLG 212 >gi|322420083|ref|YP_004199306.1| DNA protecting protein DprA [Geobacter sp. M18] gi|320126470|gb|ADW14030.1| DNA protecting protein DprA [Geobacter sp. M18] Length = 359 Score = 59.6 bits (145), Expect = 2e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPEN L + + G ISE P G Sbjct: 170 LGCGIDVVYPPENDTLYRSLCEQ-GAVISEFPMG 202 >gi|299531888|ref|ZP_07045288.1| DNA protecting protein DprA [Comamonas testosteroni S44] gi|298720063|gb|EFI61020.1| DNA protecting protein DprA [Comamonas testosteroni S44] Length = 397 Score = 59.6 bits (145), Expect = 2e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L ++I G+ ISE P G Sbjct: 203 GTGLDQVYPRAHTKLAQQI-ARNGLVISEYPLG 234 >gi|297570259|ref|YP_003691603.1| DNA protecting protein DprA [Desulfurivibrio alkaliphilus AHT2] gi|296926174|gb|ADH86984.1| DNA protecting protein DprA [Desulfurivibrio alkaliphilus AHT2] Length = 381 Score = 59.6 bits (145), Expect = 2e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YPP+N+ L +I G+ +SE P G Sbjct: 178 LGCGLDVVYPPQNKKLFAKIAAT-GMLLSEYPPG 210 >gi|54295434|ref|YP_127849.1| hypothetical protein lpl2520 [Legionella pneumophila str. Lens] gi|53755266|emb|CAH16760.1| hypothetical protein lpl2520 [Legionella pneumophila str. Lens] Length = 361 Score = 59.6 bits (145), Expect = 2e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+DC+YP + L E+I +N G+ +SE P Sbjct: 171 LGTGIDCIYPRRHLKLAEQITEN-GLLLSEFPL 202 >gi|325473778|gb|EGC76966.1| DNA processing protein DprA [Treponema denticola F0402] Length = 310 Score = 59.6 bits (145), Expect = 2e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G + +YP N+ L I ++GG +SE G Sbjct: 174 LACGPEMIYPRSNKKLAANILESGGCILSEYAPG 207 >gi|89092293|ref|ZP_01165247.1| SMF protein [Oceanospirillum sp. MED92] gi|89083381|gb|EAR62599.1| SMF protein [Oceanospirillum sp. MED92] Length = 373 Score = 59.6 bits (145), Expect = 2e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N++L E I N G +SE G Sbjct: 179 LGTGVDRIYPSRNQSLAESILSNKGAWVSEFFPG 212 >gi|264680867|ref|YP_003280777.1| DNA protecting protein DprA [Comamonas testosteroni CNB-2] gi|262211383|gb|ACY35481.1| DNA protecting protein DprA [Comamonas testosteroni CNB-2] Length = 397 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L ++I G+ ISE P G Sbjct: 203 GTGLDQVYPRAHTKLAQQI-ARNGLVISEYPLG 234 >gi|256545486|ref|ZP_05472848.1| DNA processing protein DprA [Anaerococcus vaginalis ATCC 51170] gi|256398882|gb|EEU12497.1| DNA processing protein DprA [Anaerococcus vaginalis ATCC 51170] Length = 359 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP N+ L E+I + G ISE P Sbjct: 167 IGSGLDIIYPKANKYLYEKI-EEKGAIISEFPL 198 >gi|164687263|ref|ZP_02211291.1| hypothetical protein CLOBAR_00904 [Clostridium bartlettii DSM 16795] gi|164603687|gb|EDQ97152.1| hypothetical protein CLOBAR_00904 [Clostridium bartlettii DSM 16795] Length = 304 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YPPEN +L +EI +N G ISE G Sbjct: 175 LPCGLDKYYPPENCDLGDEILENEGCLISEYKIG 208 >gi|296108241|ref|YP_003619942.1| DNA processing enzyme DprA (SMF family) [Legionella pneumophila 2300/99 Alcoy] gi|295650143|gb|ADG25990.1| DNA processing enzyme DprA (SMF family) [Legionella pneumophila 2300/99 Alcoy] Length = 361 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+DC+YP + L E+I +N G+ +SE P Sbjct: 171 LGTGIDCIYPRRHLKLAEQITEN-GLLLSEFPL 202 >gi|54298586|ref|YP_124955.1| hypothetical protein lpp2650 [Legionella pneumophila str. Paris] gi|53752371|emb|CAH13803.1| hypothetical protein lpp2650 [Legionella pneumophila str. Paris] Length = 361 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+DC+YP + L E+I +N G+ +SE P Sbjct: 171 LGTGIDCIYPRRHLKLAEQITEN-GLLLSEFPL 202 >gi|148358669|ref|YP_001249876.1| DNA processing enzyme DprA [Legionella pneumophila str. Corby] gi|148280442|gb|ABQ54530.1| DNA processing enzyme DprA (SMF family) [Legionella pneumophila str. Corby] Length = 361 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+DC+YP + L E+I +N G+ +SE P Sbjct: 171 LGTGIDCIYPRRHLKLAEQITEN-GLLLSEFPL 202 >gi|227329890|ref|ZP_03833914.1| hypothetical protein PcarcW_22156 [Pectobacterium carotovorum subsp. carotovorum WPP14] Length = 278 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + L E I +GG +SE P Sbjct: 72 LGSGLENIYPKRHAKLAERICGDGGALVSEFPL 104 >gi|255617781|ref|XP_002539880.1| Protein smf, putative [Ricinus communis] gi|223501526|gb|EEF22503.1| Protein smf, putative [Ricinus communis] Length = 283 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ++ L +I G+ +SE P G Sbjct: 114 GTGLDIVYPARHKALAHQI-AQYGLILSEYPLG 145 >gi|52842803|ref|YP_096602.1| DNA processing enzyme DprA [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52629914|gb|AAU28655.1| DNA processing enzyme DprA (SMF family) [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 361 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+DC+YP + L E+I +N G+ +SE P Sbjct: 171 LGTGIDCIYPRRHLKLAEQITEN-GLLLSEFPL 202 >gi|300780927|ref|ZP_07090781.1| smf family protein [Corynebacterium genitalium ATCC 33030] gi|300532634|gb|EFK53695.1| smf family protein [Corynebacterium genitalium ATCC 33030] Length = 398 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G +YP N L + I GG ++E P G Sbjct: 198 ACGPGQIYPKRNGKLFDRIAAEGGAIVTEYPPG 230 >gi|189426316|ref|YP_001953493.1| DNA protecting protein DprA [Geobacter lovleyi SZ] gi|189422575|gb|ACD96973.1| DNA protecting protein DprA [Geobacter lovleyi SZ] Length = 364 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D YPPENR L E+I N G ISE P Sbjct: 170 LGCGVDVDYPPENRQLAEQISGN-GCIISEFPM 201 >gi|228471288|ref|ZP_04056094.1| Smf protein DNA processing chain A [Porphyromonas uenonis 60-3] gi|228306930|gb|EEK16028.1| Smf protein DNA processing chain A [Porphyromonas uenonis 60-3] Length = 384 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GL +YP +RNL I +GG +SE P G Sbjct: 179 LAHGLHMIYPSNHRNLARSIVSHGGALLSEYPAG 212 >gi|333030447|ref|ZP_08458508.1| SMF family protein [Bacteroides coprosuis DSM 18011] gi|332741044|gb|EGJ71526.1| SMF family protein [Bacteroides coprosuis DSM 18011] Length = 310 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GL+ +YP +N +L + I +GG+ +SE P G Sbjct: 186 LAHGLEKVYPYKNSSLADRILASGGVVLSEYPIG 219 >gi|260913484|ref|ZP_05919962.1| DNA protecting protein DprA [Pasteurella dagmatis ATCC 43325] gi|260632424|gb|EEX50597.1| DNA protecting protein DprA [Pasteurella dagmatis ATCC 43325] Length = 377 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP +++ L ++I + G+ +SE Sbjct: 175 LGSGLERIYPKKHQYLAQQIIEQQGVLVSEFFP 207 >gi|297623876|ref|YP_003705310.1| DNA protecting protein DprA [Truepera radiovictrix DSM 17093] gi|297165056|gb|ADI14767.1| DNA protecting protein DprA [Truepera radiovictrix DSM 17093] Length = 372 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP +N L I D GG +SE G Sbjct: 182 LGSGVDRPYPAQNARLARRIADGGGAVVSEYRLG 215 >gi|146296271|ref|YP_001180042.1| DNA protecting protein DprA [Caldicellulosiruptor saccharolyticus DSM 8903] gi|145409847|gb|ABP66851.1| DNA protecting protein DprA [Caldicellulosiruptor saccharolyticus DSM 8903] Length = 380 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP EN L +I + G ISE Sbjct: 188 LGCGVDIVYPKENYKLYNQIVE-KGCVISEF 217 >gi|307132805|ref|YP_003884821.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Dickeya dadantii 3937] gi|306530334|gb|ADN00265.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Dickeya dadantii 3937] Length = 377 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP + L + I GG +SE P Sbjct: 167 LGSGLNQLYPRRHLTLADAIVQQGGALVSEFPL 199 >gi|85711004|ref|ZP_01042065.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Idiomarina baltica OS145] gi|85695408|gb|EAQ33345.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Idiomarina baltica OS145] Length = 347 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP NR L E I + G+ ISE G Sbjct: 157 LGTGIDQIYPRRNRELYELI-SHQGLIISEFSPG 189 >gi|315633583|ref|ZP_07888873.1| DNA protecting protein DprA [Aggregatibacter segnis ATCC 33393] gi|315477625|gb|EFU68367.1| DNA protecting protein DprA [Aggregatibacter segnis ATCC 33393] Length = 371 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP ++R L + I + GG +SE Sbjct: 170 LGSGLEEVYPAKHRKLAQHIIEQGGALVSEFFP 202 >gi|332653525|ref|ZP_08419270.1| DNA processing protein DprA [Ruminococcaceae bacterium D16] gi|332518671|gb|EGJ48274.1| DNA processing protein DprA [Ruminococcaceae bacterium D16] Length = 410 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP ENR L +++ G ISE P G Sbjct: 172 LAGGVDVPYPKENRFLYQDVAA-VGALISEYPPG 204 >gi|284032637|ref|YP_003382568.1| DNA protecting protein DprA [Kribbella flavida DSM 17836] gi|283811930|gb|ADB33769.1| DNA protecting protein DprA [Kribbella flavida DSM 17836] Length = 445 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP N L + I G+ +SE+P G Sbjct: 246 LACGVDVSYPKRNSALFDRIAAE-GLLLSELPPG 278 >gi|15888630|ref|NP_354311.1| DNA processing chain A [Agrobacterium tumefaciens str. C58] gi|15156358|gb|AAK87096.1| DNA processing chain A [Agrobacterium tumefaciens str. C58] Length = 380 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP EN LL++I+D GG ISE+PFG Sbjct: 178 LAGGLDRPYPQENFGLLQDIYDQGGATISEMPFG 211 >gi|212695500|ref|ZP_03303628.1| hypothetical protein ANHYDRO_00016 [Anaerococcus hydrogenalis DSM 7454] gi|212677500|gb|EEB37107.1| hypothetical protein ANHYDRO_00016 [Anaerococcus hydrogenalis DSM 7454] Length = 359 Score = 59.2 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP N+ L E+I + G+ ISE P Sbjct: 167 IGSGLDIIYPKANKYLYEKI-EEKGLIISEFPL 198 >gi|218885875|ref|YP_002435196.1| DNA protecting protein DprA [Desulfovibrio vulgaris str. 'Miyazaki F'] gi|218756829|gb|ACL07728.1| DNA protecting protein DprA [Desulfovibrio vulgaris str. 'Miyazaki F'] Length = 553 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPE+ L E + + G+ +SE G Sbjct: 192 LGTGIDVVYPPEHAELFERM-EATGLLVSEYAPG 224 >gi|152972194|ref|YP_001337340.1| DNA protecting protein DprA [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|330002242|ref|ZP_08304253.1| DNA protecting protein DprA [Klebsiella sp. MS 92-3] gi|150957043|gb|ABR79073.1| putative competence protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|328537381|gb|EGF63630.1| DNA protecting protein DprA [Klebsiella sp. MS 92-3] Length = 374 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L +I DNGG +SE P Sbjct: 167 LGNGLSQVYPRRHATLARQIIDNGGTLVSEFPL 199 >gi|304415446|ref|ZP_07396095.1| hypothetical protein REG_1635 [Candidatus Regiella insecticola LSR1] gi|304282710|gb|EFL91224.1| hypothetical protein REG_1635 [Candidatus Regiella insecticola LSR1] Length = 361 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 16/31 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L I + GG +SE Sbjct: 167 LGSGLENIYPRHHYGLAHRIVEQGGALVSEF 197 >gi|301058272|ref|ZP_07199312.1| DNA protecting protein DprA [delta proteobacterium NaphS2] gi|300447606|gb|EFK11331.1| DNA protecting protein DprA [delta proteobacterium NaphS2] Length = 369 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N+ L E+I + G +SE P G Sbjct: 176 LGTGIDVVYPGSNQKLFEKIMEA-GAIVSEFPMG 208 >gi|158320506|ref|YP_001513013.1| DNA protecting protein DprA [Alkaliphilus oremlandii OhILAs] gi|158140705|gb|ABW19017.1| DNA protecting protein DprA [Alkaliphilus oremlandii OhILAs] Length = 365 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N L+ + +N G +SE P G Sbjct: 174 LGCGLDQCYPASNERLMSTMIEN-GCVLSEYPLG 206 >gi|238896782|ref|YP_002921527.1| DNA protecting protein DprA [Klebsiella pneumoniae NTUH-K2044] gi|238549109|dbj|BAH65460.1| putative competence protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] Length = 374 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L +I DNGG +SE P Sbjct: 167 LGNGLSQVYPRRHATLARQIIDNGGTLVSEFPL 199 >gi|218283549|ref|ZP_03489539.1| hypothetical protein EUBIFOR_02129 [Eubacterium biforme DSM 3989] gi|218215817|gb|EEC89355.1| hypothetical protein EUBIFOR_02129 [Eubacterium biforme DSM 3989] Length = 243 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN L E + N G+ ISE P Sbjct: 129 LGCGINVIYPKENTYLFERM-KNNGLIISEYPM 160 >gi|157413603|ref|YP_001484469.1| DNA uptake Rossmann fold nucleotide-binding protein [Prochlorococcus marinus str. MIT 9215] gi|157388178|gb|ABV50883.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Prochlorococcus marinus str. MIT 9215] Length = 311 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN NL EI D GG +SE G Sbjct: 169 LPNGLDEIYPKENANLASEIIDYGGCLVSEYLIG 202 >gi|262040755|ref|ZP_06013986.1| DNA protecting protein DprA [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|259041899|gb|EEW42939.1| DNA protecting protein DprA [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length = 379 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L +I DNGG +SE P Sbjct: 172 LGNGLSQVYPRRHATLARQIIDNGGTLVSEFPL 204 >gi|227115517|ref|ZP_03829173.1| hypothetical protein PcarbP_21290 [Pectobacterium carotovorum subsp. brasiliensis PBR1692] Length = 364 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E I GG +SE P Sbjct: 158 LGSGLKNIYPKRHAKLAERICGGGGALVSEFPL 190 >gi|241664934|ref|YP_002983294.1| DNA protecting protein DprA [Ralstonia pickettii 12D] gi|240866961|gb|ACS64622.1| DNA protecting protein DprA [Ralstonia pickettii 12D] Length = 401 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR L I + G+ ISE P G Sbjct: 198 GTGLDIVYPARNRVLAHRIAEA-GVIISEYPLG 229 >gi|288923345|ref|ZP_06417477.1| DNA protecting protein DprA [Frankia sp. EUN1f] gi|288345308|gb|EFC79705.1| DNA protecting protein DprA [Frankia sp. EUN1f] Length = 311 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + +L +I + G +SE P G Sbjct: 182 LAGGVDIPYPAAHADLFHDI-AHHGALVSEAPPG 214 >gi|150005910|ref|YP_001300654.1| putative DNA processing enzyme DprA [Bacteroides vulgatus ATCC 8482] gi|149934334|gb|ABR41032.1| putative DNA processing enzyme DprA [Bacteroides vulgatus ATCC 8482] Length = 326 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Query: 1 MAGGLDC--LYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP EN +L +EI NGG+ +SE P G Sbjct: 180 LANGLDWASIYPKENLSLAKEIVSNGGLLLSEYPVG 215 >gi|257465867|ref|ZP_05630178.1| Smf protein [Fusobacterium gonidiaformans ATCC 25563] gi|315917024|ref|ZP_07913264.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC 25563] gi|313690899|gb|EFS27734.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC 25563] Length = 283 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +N NL I G+ +SE P G Sbjct: 98 GSGLDEIYPKQNTNLWNRIAKE-GLLVSEYPLG 129 >gi|257452341|ref|ZP_05617640.1| Smf protein [Fusobacterium sp. 3_1_5R] gi|317058884|ref|ZP_07923369.1| SMF family protein [Fusobacterium sp. 3_1_5R] gi|313684560|gb|EFS21395.1| SMF family protein [Fusobacterium sp. 3_1_5R] Length = 283 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +N NL I G+ +SE P G Sbjct: 98 GSGLDEIYPKQNTNLWNRIAKE-GLLVSEYPLG 129 >gi|332976017|gb|EGK12888.1| DNA processing chain A [Psychrobacter sp. 1501(2011)] Length = 434 Score = 58.8 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G+D YP +R L E I + GG ISE+ G Sbjct: 190 MGTGIDVYYPVPHRALFERIINEGGCIISELLPG 223 >gi|88606798|ref|YP_505506.1| putative DNA processing protein DprA [Anaplasma phagocytophilum HZ] gi|88597861|gb|ABD43331.1| putative DNA processing protein DprA [Anaplasma phagocytophilum HZ] Length = 344 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G++ +YP EN L + I GG+ ISE+PF Sbjct: 143 IANGINVIYPRENAKLYKSIVREGGLLISELPF 175 >gi|271502212|ref|YP_003335238.1| DNA protecting protein DprA [Dickeya dadantii Ech586] gi|270345767|gb|ACZ78532.1| DNA protecting protein DprA [Dickeya dadantii Ech586] Length = 377 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L + I GG +SE P Sbjct: 167 LGSGLRRLYPRRHVALADAIVAQGGALVSEFPL 199 >gi|254294345|ref|YP_003060368.1| DNA protecting protein DprA [Hirschia baltica ATCC 49814] gi|254042876|gb|ACT59671.1| DNA protecting protein DprA [Hirschia baltica ATCC 49814] Length = 373 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPPE+ L + I + G +SE P G Sbjct: 175 LAGGVDAIYPPEHAKLYDAILER-GAIVSESPLG 207 >gi|134093406|ref|YP_001098481.1| putative nucleotide-binding protein involved in DNA uptake (Smf protein) [Herminiimonas arsenicoxydans] gi|133737309|emb|CAL60352.1| putative DNA protecting protein DprA [Herminiimonas arsenicoxydans] Length = 372 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP NR L +I + G +SE P G Sbjct: 182 IGTGADIVYPARNRALAHQIAEA-GCILSEYPLG 214 >gi|309780260|ref|ZP_07675011.1| SMF family protein [Ralstonia sp. 5_7_47FAA] gi|308920963|gb|EFP66609.1| SMF family protein [Ralstonia sp. 5_7_47FAA] Length = 401 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR L I + G+ ISE P G Sbjct: 198 GTGLDIVYPARNRVLAHRIAEA-GVIISEYPLG 229 >gi|254805838|ref|YP_003084059.1| DNA processing protein DprA [Neisseria meningitidis alpha14] gi|254669380|emb|CBA08516.1| DNA processing protein DprA [Neisseria meningitidis alpha14] Length = 395 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|91774545|ref|YP_544301.1| DNA processing protein DprA, putative [Methylobacillus flagellatus KT] gi|91708532|gb|ABE48460.1| DNA protecting protein DprA [Methylobacillus flagellatus KT] Length = 336 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L +I + G+ ISE G Sbjct: 148 GTGLDIVYPARHRALAHQIAEQ-GLIISEFALG 179 >gi|225181360|ref|ZP_03734804.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1] gi|225167941|gb|EEG76748.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1] Length = 357 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YPPEN L E+I +GGI +SE P G Sbjct: 171 LGCGPDVCYPPENLKLREKIV-SGGIILSEFPPG 203 >gi|330720128|gb|EGG98532.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [gamma proteobacterium IMCC2047] Length = 383 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MA G+D +YP ++ L ++I G ++E P G Sbjct: 184 MATGIDQIYPKQHVALAQQI-RQRGALVTEFPLG 216 >gi|254428234|ref|ZP_05041941.1| DNA protecting protein DprA, putative [Alcanivorax sp. DG881] gi|196194403|gb|EDX89362.1| DNA protecting protein DprA, putative [Alcanivorax sp. DG881] Length = 353 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G DC+YPP + L +I + GG +SE G Sbjct: 165 MGSGPDCIYPPRHGLLASQIVEAGGALVSEFAPG 198 >gi|78044382|ref|YP_360615.1| putative DNA proccessing protein DprA [Carboxydothermus hydrogenoformans Z-2901] gi|77996497|gb|ABB15396.1| putative DNA proccessing protein DprA [Carboxydothermus hydrogenoformans Z-2901] Length = 358 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN NL EI G+ ISE G Sbjct: 168 LGSGIDVPYPRENENLYREII-QKGLIISEFLPG 200 >gi|332300411|ref|YP_004442332.1| DNA protecting protein DprA [Porphyromonas asaccharolytica DSM 20707] gi|332177474|gb|AEE13164.1| DNA protecting protein DprA [Porphyromonas asaccharolytica DSM 20707] Length = 384 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GL +YP +RNL I +GG +SE P G Sbjct: 179 LAHGLHMIYPSNHRNLARNIVTHGGALLSEYPAG 212 >gi|308180666|ref|YP_003924794.1| DNA processing protein [Lactobacillus plantarum subsp. plantarum ST-III] gi|308046157|gb|ADN98700.1| DNA processing protein [Lactobacillus plantarum subsp. plantarum ST-III] Length = 288 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ++R+L ++I G+ ISE P G Sbjct: 169 IGTGLDISYPRQHRDLQQQI-SQVGLLISEYPLG 201 >gi|307301126|ref|ZP_07580895.1| DNA protecting protein DprA [Sinorhizobium meliloti BL225C] gi|306904081|gb|EFN34667.1| DNA protecting protein DprA [Sinorhizobium meliloti BL225C] Length = 383 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN LL+EI G+A+SE+PFG Sbjct: 178 LAGGLDRPYPPENLGLLQEIVSGEGLAVSEMPFG 211 >gi|254671143|emb|CBA08189.1| DNA processing chain A [Neisseria meningitidis alpha153] Length = 395 Score = 58.8 bits (143), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|71277761|ref|YP_266804.1| putative DNA processing protein DprA [Colwellia psychrerythraea 34H] gi|71143501|gb|AAZ23974.1| putative DNA processing protein DprA [Colwellia psychrerythraea 34H] Length = 383 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD +YP + +L ++I D+ G ISE G Sbjct: 178 ATGLDQVYPARHHSLAQKIIDSSGAIISEFVPG 210 >gi|54026111|ref|YP_120353.1| putative Rossmann-fold nucleotide-binding protein [Nocardia farcinica IFM 10152] gi|54017619|dbj|BAD58989.1| putative Rossmann-fold nucleotide-binding protein [Nocardia farcinica IFM 10152] Length = 392 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP ++ LL EI + G+ +SE P G Sbjct: 188 LACGVDRPYPAQHDRLLAEIAE-VGLVVSEYPPG 220 >gi|299144231|ref|ZP_07037311.1| DNA processing protein DprA [Peptoniphilus sp. oral taxon 386 str. F0131] gi|298518716|gb|EFI42455.1| DNA processing protein DprA [Peptoniphilus sp. oral taxon 386 str. F0131] Length = 362 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D +YP +N+ L +I +N G +SE P Sbjct: 173 LGSGVDVIYPIKNKKLYYDIVEN-GAVVSEYPP 204 >gi|261867100|ref|YP_003255022.1| DNA-processing chain A [Aggregatibacter actinomycetemcomitans D11S-1] gi|261412432|gb|ACX81803.1| protein smf (DNA-processing chain A) [Aggregatibacter actinomycetemcomitans D11S-1] Length = 372 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP ++R L + I ++GG +SE Sbjct: 170 LGSGLEEVYPAKHRKLAQNIIEHGGALVSEFFP 202 >gi|299068357|emb|CBJ39581.1| putative smf, DNA processing chain A (drpA) [Ralstonia solanacearum CMR15] Length = 401 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR L I + G+ +SE P G Sbjct: 198 GTGLDMVYPARNRALAHRIAEA-GLILSEYPLG 229 >gi|304388917|ref|ZP_07370964.1| DNA protecting protein DprA [Neisseria meningitidis ATCC 13091] gi|304337051|gb|EFM03238.1| DNA protecting protein DprA [Neisseria meningitidis ATCC 13091] Length = 395 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|254556723|ref|YP_003063140.1| DNA processing protein [Lactobacillus plantarum JDM1] gi|254045650|gb|ACT62443.1| DNA processing protein [Lactobacillus plantarum JDM1] Length = 288 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ++R+L ++I G+ ISE P G Sbjct: 169 IGTGLDISYPRQHRDLQQQI-SQVGLLISEYPLG 201 >gi|313887109|ref|ZP_07820805.1| DNA protecting protein DprA [Porphyromonas asaccharolytica PR426713P-I] gi|312923338|gb|EFR34151.1| DNA protecting protein DprA [Porphyromonas asaccharolytica PR426713P-I] Length = 384 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GL +YP +RNL I ++GG +SE P G Sbjct: 179 LAHGLHMIYPSNHRNLARNIVNHGGALLSEYPAG 212 >gi|161870938|ref|YP_001600118.1| DNA processing chain A [Neisseria meningitidis 053442] gi|161596491|gb|ABX74151.1| DNA processing chain A [Neisseria meningitidis 053442] Length = 395 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|218767196|ref|YP_002341708.1| DprA homolog [Neisseria meningitidis Z2491] gi|121051204|emb|CAM07475.1| DprA homolog [Neisseria meningitidis Z2491] Length = 395 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|226366014|ref|YP_002783797.1| DNA processing protein [Rhodococcus opacus B4] gi|226244504|dbj|BAH54852.1| putative DNA processing protein [Rhodococcus opacus B4] Length = 384 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + LL +I G ISE G Sbjct: 193 LACGVDRAYPSGHARLLRQI-AQNGAVISEYAPG 225 >gi|28378509|ref|NP_785401.1| DNA processing protein [Lactobacillus plantarum WCFS1] gi|300767455|ref|ZP_07077367.1| DNA protecting protein DprA [Lactobacillus plantarum subsp. plantarum ATCC 14917] gi|28271345|emb|CAD64250.1| DNA processing protein [Lactobacillus plantarum WCFS1] gi|300495274|gb|EFK30430.1| DNA protecting protein DprA [Lactobacillus plantarum subsp. plantarum ATCC 14917] Length = 288 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ++R+L ++I G+ ISE P G Sbjct: 169 IGTGLDISYPRQHRDLQQQI-SQVGLLISEYPLG 201 >gi|237746965|ref|ZP_04577445.1| DNA processing protein [Oxalobacter formigenes HOxBLS] gi|229378316|gb|EEO28407.1| DNA processing protein [Oxalobacter formigenes HOxBLS] Length = 373 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D +YP NR L +I + G ISE P G Sbjct: 182 GTGADIVYPARNRELALQIAEE-GCVISEFPLG 213 >gi|299771933|ref|YP_003733959.1| Rossmann fold nucleotide-binding protein [Acinetobacter sp. DR1] gi|298702021|gb|ADI92586.1| Rossmann fold nucleotide-binding protein [Acinetobacter sp. DR1] Length = 377 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E+I G I+E G Sbjct: 180 GTGLDSTYPAQNKKLAEQILAQNGAIITEFLPG 212 >gi|292493777|ref|YP_003529216.1| DNA protecting protein DprA [Nitrosococcus halophilus Nc4] gi|291582372|gb|ADE16829.1| DNA protecting protein DprA [Nitrosococcus halophilus Nc4] Length = 368 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L I GG +SE P G Sbjct: 168 GTGLDRVYPARHRALAHAI-AKGGALVSEFPIG 199 >gi|217967909|ref|YP_002353415.1| DNA protecting protein DprA [Dictyoglomus turgidum DSM 6724] gi|217337008|gb|ACK42801.1| DNA protecting protein DprA [Dictyoglomus turgidum DSM 6724] Length = 364 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + LD +YP N L E+I ++ G ISE P G Sbjct: 172 LGSSLDHIYPSGNLKLAEKIMES-GAIISEYPLG 204 >gi|159043687|ref|YP_001532481.1| DNA protecting protein DprA [Dinoroseobacter shibae DFL 12] gi|157911447|gb|ABV92880.1| DNA protecting protein DprA [Dinoroseobacter shibae DFL 12] Length = 379 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGLD +YP EN L + I G+ +SE P G Sbjct: 184 AGGLDVIYPKENTELFKRIAKQ-GLIVSEQPLG 215 >gi|325203235|gb|ADY98688.1| putative DNA processing protein DprA [Neisseria meningitidis M01-240355] Length = 395 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|325197405|gb|ADY92861.1| putative DNA processing protein DprA [Neisseria meningitidis G2136] Length = 395 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|261391654|emb|CAX49102.1| Smf protein (DNA processing chain A) [Neisseria meningitidis 8013] Length = 395 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|154253273|ref|YP_001414097.1| DNA protecting protein DprA [Parvibaculum lavamentivorans DS-1] gi|154157223|gb|ABS64440.1| DNA protecting protein DprA [Parvibaculum lavamentivorans DS-1] Length = 372 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD +YP ENR L I + G +SE+P G Sbjct: 170 LAGGLDIVYPEENRELQTAI-ASQGALVSEMPPG 202 >gi|15965054|ref|NP_385407.1| hypothetical protein SMc01363 [Sinorhizobium meliloti 1021] gi|15074233|emb|CAC45880.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] Length = 383 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN LL+EI G+A+SE+PFG Sbjct: 178 LAGGLDRPYPPENLGLLQEIVSGEGLAVSEMPFG 211 >gi|254672820|emb|CBA06971.1| DNA processing chain A [Neisseria meningitidis alpha275] Length = 395 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|169334550|ref|ZP_02861743.1| hypothetical protein ANASTE_00953 [Anaerofustis stercorihominis DSM 17244] gi|169259267|gb|EDS73233.1| hypothetical protein ANASTE_00953 [Anaerofustis stercorihominis DSM 17244] Length = 383 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N L +EI + G+ ISE G Sbjct: 173 LGSGVDKIYPKSNAKLYDEIIER-GMVISEYFPG 205 >gi|319411401|emb|CBY91812.1| Smf protein (DNA processing chain A) [Neisseria meningitidis WUE 2594] Length = 395 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|308388334|gb|ADO30654.1| SMF-family protein [Neisseria meningitidis alpha710] gi|325131151|gb|EGC53872.1| putative DNA processing protein DprA [Neisseria meningitidis OX99.30304] gi|325137175|gb|EGC59770.1| putative DNA processing protein DprA [Neisseria meningitidis M0579] gi|325203049|gb|ADY98503.1| putative DNA processing protein DprA [Neisseria meningitidis M01-240149] gi|325207153|gb|ADZ02605.1| putative DNA processing protein DprA [Neisseria meningitidis NZ-05/33] Length = 395 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|153873640|ref|ZP_02002157.1| SMF protein [Beggiatoa sp. PS] gi|152069893|gb|EDN67842.1| SMF protein [Beggiatoa sp. PS] Length = 295 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YPP +R L ++I + G +SE P G Sbjct: 174 LGWGLDQIYPPAHRELGDKIAET-GALVSEFPPG 206 >gi|329894844|ref|ZP_08270644.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [gamma proteobacterium IMCC3088] gi|328922738|gb|EGG30072.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [gamma proteobacterium IMCC3088] Length = 373 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP + L ++I + G +S+ P G Sbjct: 180 LGTGIDQVYPKRHHRLAQQILER-GCLLSDHPIG 212 >gi|325133183|gb|EGC55854.1| putative DNA processing protein DprA [Neisseria meningitidis M6190] Length = 395 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|307317859|ref|ZP_07597297.1| DNA protecting protein DprA [Sinorhizobium meliloti AK83] gi|306896621|gb|EFN27369.1| DNA protecting protein DprA [Sinorhizobium meliloti AK83] Length = 383 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN LL+EI G+A+SE+PFG Sbjct: 178 LAGGLDRPYPPENLGLLQEIVSGEGLAVSEMPFG 211 >gi|197119085|ref|YP_002139512.1| DNA uptake/processing protein SMF [Geobacter bemidjiensis Bem] gi|197088445|gb|ACH39716.1| DNA uptake/processing protein SMF [Geobacter bemidjiensis Bem] Length = 359 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPEN L + + ++ G ISE P G Sbjct: 170 LGCGIDLVYPPENGALYQALAES-GALISEFPMG 202 >gi|332531649|ref|ZP_08407546.1| DNA protecting protein dpra [Hylemonella gracilis ATCC 19624] gi|332039012|gb|EGI75441.1| DNA protecting protein dpra [Hylemonella gracilis ATCC 19624] Length = 416 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L I G+ +SE P G Sbjct: 202 GTGLDQVYPKRHAALARRIAAQ-GVILSEYPLG 233 >gi|325135225|gb|EGC57850.1| putative DNA processing protein DprA [Neisseria meningitidis M13399] Length = 397 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|15837526|ref|NP_298214.1| DNA processing chain A [Xylella fastidiosa 9a5c] gi|9105845|gb|AAF83734.1|AE003931_11 DNA processing chain A [Xylella fastidiosa 9a5c] Length = 387 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP ++ L I G ISE P G Sbjct: 184 LGTGPDVPYPARHKKLYARIT-TDGAVISEYPPG 216 >gi|126729116|ref|ZP_01744930.1| DNA processing protein DprA, putative [Sagittula stellata E-37] gi|126710106|gb|EBA09158.1| DNA processing protein DprA, putative [Sagittula stellata E-37] Length = 372 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D LYP EN L ++I G ISE P G Sbjct: 159 LAGGVDVLYPAENAGLADDIVTCHGARISEQPMG 192 >gi|332637402|ref|ZP_08416265.1| putative DNA processing enzyme DprA [Weissella cibaria KACC 11862] Length = 341 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query: 1 MAGGLDC-LYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +NR L E+I GG +SE P G Sbjct: 180 LAAGLDEPVYPAKNRELAEKILTEGGALVSEYPAG 214 >gi|190571736|ref|YP_001976094.1| DNA processing chain A [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|213019224|ref|ZP_03335031.1| DNA processing chain A [Wolbachia endosymbiont of Culex quinquefasciatus JHB] gi|190358008|emb|CAQ55476.1| DNA processing chain A [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|212995333|gb|EEB55974.1| DNA processing chain A [Wolbachia endosymbiont of Culex quinquefasciatus JHB] Length = 361 Score = 58.4 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 25/32 (78%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP EN +L ++I +NGG+ ++E+PF Sbjct: 163 ASGIDVVYPRENFDLYKKITENGGLVMTELPF 194 >gi|157363159|ref|YP_001469926.1| DNA protecting protein DprA [Thermotoga lettingae TMO] gi|157313763|gb|ABV32862.1| DNA protecting protein DprA [Thermotoga lettingae TMO] Length = 339 Score = 58.4 bits (142), Expect = 4e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP N+++ E I N G +SE P G Sbjct: 162 LGTGVDVCYPVSNKDIYEVILKN-GCLVSEYPLG 194 >gi|325145438|gb|EGC67714.1| putative DNA processing protein DprA [Neisseria meningitidis M01-240013] gi|325205209|gb|ADZ00662.1| putative DNA processing protein DprA [Neisseria meningitidis M04-240196] Length = 397 Score = 58.4 bits (142), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|297544718|ref|YP_003677020.1| DNA protecting protein DprA [Thermoanaerobacter mathranii subsp. mathranii str. A3] gi|296842493|gb|ADH61009.1| DNA protecting protein DprA [Thermoanaerobacter mathranii subsp. mathranii str. A3] Length = 362 Score = 58.4 bits (142), Expect = 4e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I + G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQISEE-GLLVSEFPL 202 >gi|187935056|ref|YP_001885453.1| DNA uptake protein [Clostridium botulinum B str. Eklund 17B] gi|187723209|gb|ACD24430.1| DNA uptake protein [Clostridium botulinum B str. Eklund 17B] Length = 352 Score = 58.4 bits (142), Expect = 4e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN L ++ G+ ISE P G Sbjct: 168 LGCGIDVVYPSENIALFSKVIK-DGLIISEFPLG 200 >gi|20807897|ref|NP_623068.1| Rossmann-fold nucleotide-binding protein involved in DNA uptake [Thermoanaerobacter tengcongensis MB4] gi|254479480|ref|ZP_05092805.1| DNA protecting protein DprA, putative [Carboxydibrachium pacificum DSM 12653] gi|20516463|gb|AAM24672.1| predicted Rossmann-fold nucleotide-binding protein involved in DNA uptake [Thermoanaerobacter tengcongensis MB4] gi|214034584|gb|EEB75333.1| DNA protecting protein DprA, putative [Carboxydibrachium pacificum DSM 12653] Length = 362 Score = 58.4 bits (142), Expect = 4e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I + G+ +SE P Sbjct: 171 LGCGINVVYPTENKKLMEQIGEE-GLLVSEYPL 202 >gi|254497988|ref|ZP_05110751.1| DNA processing enzyme DprA [Legionella drancourtii LLAP12] gi|254352765|gb|EET11537.1| DNA processing enzyme DprA [Legionella drancourtii LLAP12] Length = 357 Score = 58.4 bits (142), Expect = 4e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M G+DC+YP + L E+I G+ +SE P Sbjct: 171 MGTGIDCIYPRRHAKLAEQIT-QSGLLLSEFPL 202 >gi|83642945|ref|YP_431380.1| DNA uptake Rossmann fold nucleotide-binding protein [Hahella chejuensis KCTC 2396] gi|83630988|gb|ABC26955.1| predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Hahella chejuensis KCTC 2396] Length = 389 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP ++R+L +++ ++ G+ +SE P Sbjct: 179 LGSGLNVIYPAKHRDLAQKMMES-GLLVSEFPP 210 >gi|53803082|ref|YP_115235.1| DNA processing protein DprA [Methylococcus capsulatus str. Bath] gi|53756843|gb|AAU91134.1| putative DNA processing protein DprA [Methylococcus capsulatus str. Bath] Length = 364 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D +YP ++ L + I +GG+ +SE P G Sbjct: 173 GCGPDRVYPSRHQRLADAIVGSGGVLVSEAPPG 205 >gi|239626521|ref|ZP_04669552.1| smf family protein [Clostridiales bacterium 1_7_47_FAA] gi|239516667|gb|EEQ56533.1| smf family protein [Clostridiales bacterium 1_7_47FAA] Length = 328 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ YP N L E+I +NGG +SE P Sbjct: 135 LGCGVNICYPRTNYRLFEQILENGG-ILSEYPP 166 >gi|153005554|ref|YP_001379879.1| DNA protecting protein DprA [Anaeromyxobacter sp. Fw109-5] gi|152029127|gb|ABS26895.1| DNA protecting protein DprA [Anaeromyxobacter sp. Fw109-5] Length = 287 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D LYP NR LLE + + GG +SE+P G Sbjct: 97 LGTGVDVLYPASNRALLERVLEQGGAILSELPDG 130 >gi|221069821|ref|ZP_03545926.1| DNA protecting protein DprA [Comamonas testosteroni KF-1] gi|220714844|gb|EED70212.1| DNA protecting protein DprA [Comamonas testosteroni KF-1] Length = 397 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L ++I + G+ ISE P G Sbjct: 203 GTGLDQVYPRAHARLAQQIALH-GLVISEYPLG 234 >gi|313667412|ref|YP_004047696.1| SMF-family protein [Neisseria lactamica ST-640] gi|313004874|emb|CBN86300.1| SMF-family protein [Neisseria lactamica 020-06] Length = 395 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 209 >gi|253997552|ref|YP_003049616.1| DNA protecting protein DprA [Methylotenera mobilis JLW8] gi|253984231|gb|ACT49089.1| DNA protecting protein DprA [Methylotenera mobilis JLW8] Length = 370 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ++R L +I ++ G+ +SE G Sbjct: 178 GTGLDIVYPAKHRELAHQIAEH-GLLLSEFALG 209 >gi|240118948|ref|ZP_04733010.1| DprA [Neisseria gonorrhoeae PID1] Length = 398 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 181 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 212 >gi|240129161|ref|ZP_04741822.1| DprA [Neisseria gonorrhoeae SK-93-1035] gi|268687544|ref|ZP_06154406.1| DNA processing chain A [Neisseria gonorrhoeae SK-93-1035] gi|268627828|gb|EEZ60228.1| DNA processing chain A [Neisseria gonorrhoeae SK-93-1035] Length = 398 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 181 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 212 >gi|172040495|ref|YP_001800209.1| putative DNA processing protein [Corynebacterium urealyticum DSM 7109] gi|171851799|emb|CAQ04775.1| putative DNA processing protein [Corynebacterium urealyticum DSM 7109] Length = 416 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD YP ++ L ++I ++ G+ +SE G Sbjct: 213 LACGLDVDYPRQHVGLFKQIAES-GVVVSEYALG 245 >gi|240116726|ref|ZP_04730788.1| DprA [Neisseria gonorrhoeae PID18] gi|268602397|ref|ZP_06136564.1| DNA processing chain A [Neisseria gonorrhoeae PID18] gi|268586528|gb|EEZ51204.1| DNA processing chain A [Neisseria gonorrhoeae PID18] Length = 398 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 181 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 212 >gi|193873566|gb|ACF23472.1| DNA protecting protein [uncultured bacterium] Length = 160 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +N L I + GI +SE P G Sbjct: 70 GTGLDRVYPRQNLGLARRIAAH-GILVSEYPLG 101 >gi|331698494|ref|YP_004334733.1| DNA protecting protein DprA [Pseudonocardia dioxanivorans CB1190] gi|326953183|gb|AEA26880.1| DNA protecting protein DprA [Pseudonocardia dioxanivorans CB1190] Length = 396 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MA G+D YP + LL I G+ +SE P G Sbjct: 200 MACGVDRAYPAAHSELLARIAAT-GLVVSEYPPG 232 >gi|262281297|ref|ZP_06059078.1| DNA protecting protein DprA [Acinetobacter calcoaceticus RUH2202] gi|262257123|gb|EEY75860.1| DNA protecting protein DprA [Acinetobacter calcoaceticus RUH2202] Length = 376 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E+I G I+E G Sbjct: 180 GTGLDSTYPAQNKKLAEQILAQNGAIITEFLPG 212 >gi|194099892|ref|YP_002003029.1| DprA [Neisseria gonorrhoeae NCCP11945] gi|240015122|ref|ZP_04722035.1| DprA [Neisseria gonorrhoeae DGI18] gi|240017572|ref|ZP_04724112.1| DprA [Neisseria gonorrhoeae FA6140] gi|240113990|ref|ZP_04728480.1| DprA [Neisseria gonorrhoeae MS11] gi|240122193|ref|ZP_04735155.1| DprA [Neisseria gonorrhoeae PID24-1] gi|268600055|ref|ZP_06134222.1| DNA processing chain A [Neisseria gonorrhoeae MS11] gi|193935182|gb|ACF31006.1| DprA [Neisseria gonorrhoeae NCCP11945] gi|268584186|gb|EEZ48862.1| DNA processing chain A [Neisseria gonorrhoeae MS11] Length = 398 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 181 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 212 >gi|51244646|ref|YP_064530.1| SMF protein (DNA processing chain A) [Desulfotalea psychrophila LSv54] gi|50875683|emb|CAG35523.1| probable SMF protein (DNA processing chain A) [Desulfotalea psychrophila LSv54] Length = 357 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP +N+ L + I G+ I+E P G Sbjct: 168 LGCGLDIVYPYQNKKLYK-IIAGEGLVITEYPLG 200 >gi|253700153|ref|YP_003021342.1| DNA protecting protein DprA [Geobacter sp. M21] gi|251775003|gb|ACT17584.1| DNA protecting protein DprA [Geobacter sp. M21] Length = 359 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPEN L + + DN G ISE P G Sbjct: 170 LGCGIDLVYPPENGALYQALADN-GALISEFPMG 202 >gi|126668174|ref|ZP_01739135.1| probable smf protein [Marinobacter sp. ELB17] gi|126627323|gb|EAZ97959.1| probable smf protein [Marinobacter sp. ELB17] Length = 412 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP +++ L E + N G+ +SE P G Sbjct: 219 IGSGLDKIYPRQHQRLGERVIAN-GLLVSEYPPG 251 >gi|152994061|ref|YP_001338896.1| DNA protecting protein DprA [Marinomonas sp. MWYL1] gi|150834985|gb|ABR68961.1| DNA protecting protein DprA [Marinomonas sp. MWYL1] Length = 442 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M GL YP NR + EEI + GG ISE P Sbjct: 210 MGTGLFHRYPHHNRQMFEEILEQGGALISEYPL 242 >gi|237801644|ref|ZP_04590105.1| DNA processing protein DprA [Pseudomonas syringae pv. oryzae str. 1_6] gi|331024503|gb|EGI04559.1| DNA processing protein DprA [Pseudomonas syringae pv. oryzae str. 1_6] Length = 371 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L + + GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALADRMAAQGGAVISEFPL 213 >gi|261378982|ref|ZP_05983555.1| putative DNA processing protein DprA [Neisseria cinerea ATCC 14685] gi|269144597|gb|EEZ71015.1| putative DNA processing protein DprA [Neisseria cinerea ATCC 14685] Length = 397 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|240081714|ref|ZP_04726257.1| DprA [Neisseria gonorrhoeae FA19] gi|268597812|ref|ZP_06131979.1| DNA processing chain A [Neisseria gonorrhoeae FA19] gi|268604659|ref|ZP_06138826.1| DNA processing chain A [Neisseria gonorrhoeae PID1] gi|268551600|gb|EEZ46619.1| DNA processing chain A [Neisseria gonorrhoeae FA19] gi|268588790|gb|EEZ53466.1| DNA processing chain A [Neisseria gonorrhoeae PID1] Length = 395 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 209 >gi|300854485|ref|YP_003779469.1| putative Smf protein [Clostridium ljungdahlii DSM 13528] gi|300434600|gb|ADK14367.1| predicted Smf protein [Clostridium ljungdahlii DSM 13528] Length = 366 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP +NR L E I GG +SE Sbjct: 172 LGSGVDVIYPRQNRKLYENILK-GGCVLSEF 201 >gi|240124645|ref|ZP_04737531.1| DprA [Neisseria gonorrhoeae SK-92-679] gi|268683219|ref|ZP_06150081.1| DNA processing chain A [Neisseria gonorrhoeae SK-92-679] gi|268623503|gb|EEZ55903.1| DNA processing chain A [Neisseria gonorrhoeae SK-92-679] Length = 397 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 181 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 212 >gi|239997897|ref|ZP_04717821.1| DprA [Neisseria gonorrhoeae 35/02] Length = 398 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 181 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 212 >gi|59802185|ref|YP_208897.1| hypothetical protein NGO1865 [Neisseria gonorrhoeae FA 1090] gi|293398230|ref|ZP_06642435.1| DNA processing protein [Neisseria gonorrhoeae F62] gi|59719080|gb|AAW90485.1| putative DNA processing chain A [Neisseria gonorrhoeae FA 1090] gi|291611493|gb|EFF40563.1| DNA processing protein [Neisseria gonorrhoeae F62] Length = 395 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 209 >gi|256750729|ref|ZP_05491614.1| DNA protecting protein DprA [Thermoanaerobacter ethanolicus CCSD1] gi|256750312|gb|EEU63331.1| DNA protecting protein DprA [Thermoanaerobacter ethanolicus CCSD1] Length = 362 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I + G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQISEE-GLLVSEFPL 202 >gi|289578442|ref|YP_003477069.1| DNA protecting protein DprA [Thermoanaerobacter italicus Ab9] gi|289528155|gb|ADD02507.1| DNA protecting protein DprA [Thermoanaerobacter italicus Ab9] Length = 362 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I + G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQISEE-GLLVSEFPL 202 >gi|330957383|gb|EGH57643.1| DNA processing protein DprA [Pseudomonas syringae pv. maculicola str. ES4326] Length = 371 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ + GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAEQGGAVISEFPL 213 >gi|260439513|ref|ZP_05793329.1| DprA [Neisseria gonorrhoeae DGI2] gi|291042750|ref|ZP_06568491.1| DNA protecting protein DprA [Neisseria gonorrhoeae DGI2] gi|291013184|gb|EFE05150.1| DNA protecting protein DprA [Neisseria gonorrhoeae DGI2] Length = 395 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 209 >gi|34499722|ref|NP_903937.1| smf protein [Chromobacterium violaceum ATCC 12472] gi|34105573|gb|AAQ61927.1| smf protein [Chromobacterium violaceum ATCC 12472] Length = 359 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP NR L + ++ G+ +SE P G Sbjct: 171 IGTGIDRVYPASNRQLAHRVAEH-GLILSEFPLG 203 >gi|240124486|ref|ZP_04737442.1| DprA [Neisseria gonorrhoeae PID332] gi|317165352|gb|ADV08893.1| DprA [Neisseria gonorrhoeae TCDC-NG08107] Length = 398 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 181 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 212 >gi|254494747|ref|ZP_05107918.1| DNA processing chain A [Neisseria gonorrhoeae 1291] gi|226513787|gb|EEH63132.1| DNA processing chain A [Neisseria gonorrhoeae 1291] Length = 395 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 209 >gi|262376935|ref|ZP_06070162.1| DNA protecting protein DprA [Acinetobacter lwoffii SH145] gi|262308280|gb|EEY89416.1| DNA protecting protein DprA [Acinetobacter lwoffii SH145] Length = 379 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 22/31 (70%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 MA GLD YP ++++L ++I ++GG ISE Sbjct: 179 MATGLDQTYPAQHQSLRQQIIEHGGAVISEF 209 >gi|146305098|ref|YP_001185563.1| DNA protecting protein DprA [Pseudomonas mendocina ymp] gi|145573299|gb|ABP82831.1| DNA protecting protein DprA [Pseudomonas mendocina ymp] Length = 368 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+CLYP ++ L +I + GG +SE+P Sbjct: 179 LGTGLECLYPARHKRLAAQIIEQGGALVSELPL 211 >gi|310641535|ref|YP_003946293.1| DNA protecting protein dpra [Paenibacillus polymyxa SC2] gi|309246485|gb|ADO56052.1| DNA protecting protein DprA [Paenibacillus polymyxa SC2] Length = 409 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + +D +YPP+N +L E+ + G+ +SE P G Sbjct: 208 LGTAIDQIYPPQNASLFAEM-ASKGLIVSEYPPG 240 >gi|308068644|ref|YP_003870249.1| Smf protein [Paenibacillus polymyxa E681] gi|305857923|gb|ADM69711.1| Smf protein [Paenibacillus polymyxa E681] Length = 395 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + +D +YPP+N +L E+ + G+ +SE P G Sbjct: 194 LGTAIDQIYPPQNASLFAEM-ASKGLIVSEYPPG 226 >gi|296315164|ref|ZP_06865105.1| putative DNA processing protein DprA [Neisseria polysaccharea ATCC 43768] gi|296837973|gb|EFH21911.1| putative DNA processing protein DprA [Neisseria polysaccharea ATCC 43768] Length = 397 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPIG 209 >gi|294678614|ref|YP_003579229.1| DNA protecting protein DprA [Rhodobacter capsulatus SB 1003] gi|294477434|gb|ADE86822.1| DNA protecting protein DprA [Rhodobacter capsulatus SB 1003] Length = 383 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGGLD +YPPENR+L I GG+ ++E+P G Sbjct: 180 MAGGLDVIYPPENRDLASRI-ATGGLLLAELPPG 212 >gi|268593749|ref|ZP_06127916.1| DNA processing chain A [Neisseria gonorrhoeae 35/02] gi|268547138|gb|EEZ42556.1| DNA processing chain A [Neisseria gonorrhoeae 35/02] Length = 395 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 209 >gi|153869947|ref|ZP_01999450.1| DNA processing chain A [Beggiatoa sp. PS] gi|152073589|gb|EDN70552.1| DNA processing chain A [Beggiatoa sp. PS] Length = 420 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ++ L +I + G ISE+P G Sbjct: 175 GTGLDRVYPAKHHELAHKIAET-GALISELPLG 206 >gi|17228820|ref|NP_485368.1| DNA processing protein [Nostoc sp. PCC 7120] gi|17130672|dbj|BAB73282.1| DNA processing protein [Nostoc sp. PCC 7120] Length = 372 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D +YP +NR+L ++I G+ +SE P Sbjct: 177 LGTGVDVVYPHKNRDLYQQIL-TNGLVVSEYP 207 >gi|86608165|ref|YP_476927.1| DNA protecting protein DprA [Synechococcus sp. JA-2-3B'a(2-13)] gi|86556707|gb|ABD01664.1| DNA protecting protein DprA [Synechococcus sp. JA-2-3B'a(2-13)] Length = 385 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP ++ L I G +SE P G Sbjct: 196 GTGVDKVYPAHHQALYRRILAQ-GAILSEYPPG 227 >gi|323493840|ref|ZP_08098958.1| Smf protein [Vibrio brasiliensis LMG 20546] gi|323311974|gb|EGA65120.1| Smf protein [Vibrio brasiliensis LMG 20546] Length = 372 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP +R L I + G +SE Sbjct: 172 LGCGLQTIYPARHRQLASRIIEAQGALVSEF 202 >gi|308188322|ref|YP_003932453.1| Protein smf [Pantoea vagans C9-1] gi|308058832|gb|ADO11004.1| Protein smf [Pantoea vagans C9-1] Length = 374 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L EI GG +SE P Sbjct: 167 LGSGLQHLYPKNHTRLAAEIVGQGGAIVSEFPL 199 >gi|268683117|ref|ZP_06149979.1| DNA processing chain A [Neisseria gonorrhoeae PID332] gi|268623401|gb|EEZ55801.1| DNA processing chain A [Neisseria gonorrhoeae PID332] Length = 395 Score = 58.0 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 209 >gi|319945033|ref|ZP_08019295.1| DNA processing SMF protein [Lautropia mirabilis ATCC 51599] gi|319741603|gb|EFV94028.1| DNA processing SMF protein [Lautropia mirabilis ATCC 51599] Length = 424 Score = 58.0 bits (141), Expect = 5e-07, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP + L + + GG+ +SE P G Sbjct: 193 GAGIDRIYPAHHLPLARRVLEQGGLVLSEQPLG 225 >gi|255524245|ref|ZP_05391204.1| DNA protecting protein DprA [Clostridium carboxidivorans P7] gi|296185366|ref|ZP_06853776.1| DNA protecting protein DprA [Clostridium carboxidivorans P7] gi|255512070|gb|EET88351.1| DNA protecting protein DprA [Clostridium carboxidivorans P7] gi|296050200|gb|EFG89624.1| DNA protecting protein DprA [Clostridium carboxidivorans P7] Length = 359 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN+ + ++I +N G +SE G Sbjct: 169 LGSGIDVVYPKENKKIYDKISEN-GCVLSEFLPG 201 >gi|238916740|ref|YP_002930257.1| DNA processing protein [Eubacterium eligens ATCC 27750] gi|238872100|gb|ACR71810.1| DNA processing protein [Eubacterium eligens ATCC 27750] Length = 379 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP N +L + N G +SE P G Sbjct: 172 LGCGVDVCYPRSNIDLYTQ-LQNAGGIMSEYPPG 204 >gi|255280064|ref|ZP_05344619.1| DNA processing protein DprA [Bryantella formatexigens DSM 14469] gi|255269155|gb|EET62360.1| DNA processing protein DprA [Bryantella formatexigens DSM 14469] Length = 367 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP ENR L E + +GG ISE G Sbjct: 179 GCGVDICYPRENRRLYEALIQSGG-VISEFYPG 210 >gi|254422740|ref|ZP_05036458.1| DNA protecting protein DprA, putative [Synechococcus sp. PCC 7335] gi|196190229|gb|EDX85193.1| DNA protecting protein DprA, putative [Synechococcus sp. PCC 7335] Length = 411 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N++L +++ +N G+ +SE P G Sbjct: 176 GTGVDIVYPARNQSLYQQVVEN-GLVVSEYPDG 207 >gi|308047747|ref|YP_003911313.1| DNA protecting protein DprA [Ferrimonas balearica DSM 9799] gi|307629937|gb|ADN74239.1| DNA protecting protein DprA [Ferrimonas balearica DSM 9799] Length = 366 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L E+I + G +SE G Sbjct: 173 GCGLDRIYPRRHRTLAEQI-EQQGARVSEFWPG 204 >gi|326382894|ref|ZP_08204584.1| DNA protecting protein DprA [Gordonia neofelifaecis NRRL B-59395] gi|326198484|gb|EGD55668.1| DNA protecting protein DprA [Gordonia neofelifaecis NRRL B-59395] Length = 374 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + LL EI + G ++E P G Sbjct: 182 LACGIDRDYPAGHAQLLREIGER-GAVLTEYPPG 214 >gi|153854395|ref|ZP_01995673.1| hypothetical protein DORLON_01668 [Dorea longicatena DSM 13814] gi|149752921|gb|EDM62852.1| hypothetical protein DORLON_01668 [Dorea longicatena DSM 13814] Length = 238 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN L +I + GG +SE G Sbjct: 48 LGCGVDVCYPRENIGLYMDIQEKGG-IVSEFSPG 80 >gi|319796459|ref|YP_004158099.1| DNA protecting protein dpra [Variovorax paradoxus EPS] gi|315598922|gb|ADU39988.1| DNA protecting protein DprA [Variovorax paradoxus EPS] Length = 383 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R+L I G+ +SE+P G Sbjct: 188 GTGLDRVYPARHRDLAHRITLQ-GLIVSELPLG 219 >gi|229826296|ref|ZP_04452365.1| hypothetical protein GCWU000182_01668 [Abiotrophia defectiva ATCC 49176] gi|229789166|gb|EEP25280.1| hypothetical protein GCWU000182_01668 [Abiotrophia defectiva ATCC 49176] Length = 366 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YPP N L I + GG ISE P G Sbjct: 174 LGCGADVCYPPNNIELYLSIIEKGG-VISEFPLG 206 >gi|304316916|ref|YP_003852061.1| DNA protecting protein DprA [Thermoanaerobacterium thermosaccharolyticum DSM 571] gi|302778418|gb|ADL68977.1| DNA protecting protein DprA [Thermoanaerobacterium thermosaccharolyticum DSM 571] Length = 362 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I + G +SE P Sbjct: 171 LGCGVNIVYPEENKRLMEDII-SNGAVVSEYPL 202 >gi|330447318|ref|ZP_08310968.1| DNA protecting protein DprA [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] gi|328491509|dbj|GAA05465.1| DNA protecting protein DprA [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] Length = 367 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP +R L +I + G +SE Sbjct: 170 LGSGLDQIYPARHRKLANDIVEQ-GALVSEF 199 >gi|319783706|ref|YP_004143182.1| DNA protecting protein DprA [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317169594|gb|ADV13132.1| DNA protecting protein DprA [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 379 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L EEI + G ISE+PFG Sbjct: 175 LAGGLDQPYPPENAGLCEEIAER-GAIISEMPFG 207 >gi|302342564|ref|YP_003807093.1| DNA protecting protein DprA [Desulfarculus baarsii DSM 2075] gi|301639177|gb|ADK84499.1| DNA protecting protein DprA [Desulfarculus baarsii DSM 2075] Length = 376 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YPPE+ L+E + G +SE P G Sbjct: 183 LGCGLDVAYPPEHAGLIERMAGQ-GAVVSEFPMG 215 >gi|182416693|ref|ZP_02948094.1| DNA uptake protein [Clostridium butyricum 5521] gi|237667207|ref|ZP_04527191.1| DNA protecting protein DprA [Clostridium butyricum E4 str. BoNT E BL5262] gi|182379455|gb|EDT76948.1| DNA uptake protein [Clostridium butyricum 5521] gi|237655555|gb|EEP53111.1| DNA protecting protein DprA [Clostridium butyricum E4 str. BoNT E BL5262] Length = 353 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP EN+ L +I + G+ ISE Sbjct: 167 LGCGIDRVYPAENKKLFSQI-EEKGVVISEF 196 >gi|28867415|ref|NP_790034.1| DNA processing protein DprA [Pseudomonas syringae pv. tomato str. DC3000] gi|28850649|gb|AAO53729.1| DNA processing protein DprA, putative [Pseudomonas syringae pv. tomato str. DC3000] Length = 394 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP ++R L +I GG ISE P Sbjct: 204 LGTGLGKLYPQQHRALATQIAAQGGAVISEFPL 236 >gi|56477102|ref|YP_158691.1| SMF protein, Rossmann fold nucleotide-binding protein involved in DNA uptake [Aromatoleum aromaticum EbN1] gi|56313145|emb|CAI07790.1| SMF protein, Rossmann fold nucleotide-binding protein involved in DNA uptake [Aromatoleum aromaticum EbN1] Length = 390 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP N+ L +I + G+ ISE P G Sbjct: 175 IGTGADRVYPARNQALARQIAER-GVIISEYPLG 207 >gi|325138795|gb|EGC61347.1| putative DNA processing protein DprA [Neisseria meningitidis ES14902] Length = 395 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 209 >gi|255067823|ref|ZP_05319678.1| DNA processing protein DprA [Neisseria sicca ATCC 29256] gi|255047914|gb|EET43378.1| DNA processing protein DprA [Neisseria sicca ATCC 29256] Length = 403 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI + G+ +SE P Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPL 208 >gi|261380552|ref|ZP_05985125.1| DNA processing protein DprA [Neisseria subflava NJ9703] gi|284796520|gb|EFC51867.1| DNA processing protein DprA [Neisseria subflava NJ9703] Length = 396 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI + G+ +SE P Sbjct: 178 GTGIDRIYPPSNKNLAYEIAER-GLIVSEFPL 208 >gi|227821656|ref|YP_002825626.1| DNA processing chain A [Sinorhizobium fredii NGR234] gi|227340655|gb|ACP24873.1| DNA processing chain A [Sinorhizobium fredii NGR234] Length = 386 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 22/34 (64%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN LL+EI G+AISE+PFG Sbjct: 178 LAGGLDRPYPPENIGLLQEITAGEGLAISEMPFG 211 >gi|42526716|ref|NP_971814.1| DNA processing protein DprA, putative [Treponema denticola ATCC 35405] gi|41817031|gb|AAS11725.1| DNA processing protein DprA, putative [Treponema denticola ATCC 35405] Length = 310 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G + +YP N+ L I ++ G +SE G Sbjct: 174 LACGPEMIYPRSNKKLAANILESSGCILSEYAPG 207 >gi|58696725|ref|ZP_00372270.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila simulans] gi|225630004|ref|YP_002726795.1| DNA processing chain A [Wolbachia sp. wRi] gi|58537093|gb|EAL60213.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila simulans] gi|225591985|gb|ACN95004.1| DNA processing chain A [Wolbachia sp. wRi] Length = 362 Score = 57.7 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 24/32 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP EN +L ++I NGG+ I+E+PF Sbjct: 164 ASGIDVVYPKENFDLYKKITGNGGLVITELPF 195 >gi|309378540|emb|CBX22812.1| unnamed protein product [Neisseria lactamica Y92-1009] Length = 397 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 209 >gi|225019249|ref|ZP_03708441.1| hypothetical protein CLOSTMETH_03202 [Clostridium methylpentosum DSM 5476] gi|224947880|gb|EEG29089.1| hypothetical protein CLOSTMETH_03202 [Clostridium methylpentosum DSM 5476] Length = 369 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 ++ LD YP N L EI +GG +SE P G Sbjct: 172 LSCPLDKNYPASNEGLRREILRHGGALVSEFPPG 205 >gi|121611000|ref|YP_998807.1| DNA protecting protein DprA [Verminephrobacter eiseniae EF01-2] gi|121555640|gb|ABM59789.1| DNA protecting protein DprA [Verminephrobacter eiseniae EF01-2] Length = 399 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +N +L I + G+ ISE P G Sbjct: 192 GTGLDQVYPRKNIDLARRIAAS-GLLISEYPLG 223 >gi|86159122|ref|YP_465907.1| DNA processing protein DprA [Anaeromyxobacter dehalogenans 2CP-C] gi|85775633|gb|ABC82470.1| DNA protecting protein DprA [Anaeromyxobacter dehalogenans 2CP-C] Length = 291 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP ++R L I GG +SE+P G Sbjct: 99 LGTGVDVAYPAQHRALFARILGAGGALVSELPDG 132 >gi|326389491|ref|ZP_08211058.1| DNA protecting protein DprA [Thermoanaerobacter ethanolicus JW 200] gi|325994496|gb|EGD52921.1| DNA protecting protein DprA [Thermoanaerobacter ethanolicus JW 200] Length = 362 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I + G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQISEE-GLLVSEFPL 202 >gi|307264857|ref|ZP_07546419.1| DNA protecting protein DprA [Thermoanaerobacter wiegelii Rt8.B1] gi|306920115|gb|EFN50327.1| DNA protecting protein DprA [Thermoanaerobacter wiegelii Rt8.B1] Length = 362 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I + G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQISEE-GLLVSEFPL 202 >gi|90581178|ref|ZP_01236977.1| Hypothetical Smf protein [Vibrio angustum S14] gi|90437699|gb|EAS62891.1| Hypothetical Smf protein [Vibrio angustum S14] Length = 365 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP +R L EI + G +SE Sbjct: 170 LGSGLDQVYPARHRQLANEIVEQ-GALVSEF 199 >gi|17544787|ref|NP_518189.1| SMF protein [Ralstonia solanacearum GMI1000] gi|17427076|emb|CAD13596.1| putative smf protein (predicted rossmann fold nucleotide-binding protein involved in dna uptake) [Ralstonia solanacearum GMI1000] Length = 401 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR L I + G+ +SE P G Sbjct: 198 GTGLDMVYPARNRALAHHIAEA-GLILSEYPLG 229 >gi|83309780|ref|YP_420044.1| Rossmann fold nucleotide-binding protein [Magnetospirillum magneticum AMB-1] gi|82944621|dbj|BAE49485.1| Predicted Rossmann fold nucleotide-binding protein [Magnetospirillum magneticum AMB-1] Length = 383 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPPEN +L EI G +SE+P G Sbjct: 181 LAGGVDVVYPPENTDLWREIGAA-GAVVSEMPVG 213 >gi|241760431|ref|ZP_04758525.1| DNA protecting protein DprA [Neisseria flavescens SK114] gi|241319100|gb|EER55593.1| DNA protecting protein DprA [Neisseria flavescens SK114] Length = 396 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI + G+ +SE P Sbjct: 178 GTGIDRIYPPSNKNLAYEIAER-GLIVSEFPL 208 >gi|167037677|ref|YP_001665255.1| DNA protecting protein DprA [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|320116092|ref|YP_004186251.1| DNA protecting protein DprA [Thermoanaerobacter brockii subsp. finnii Ako-1] gi|166856511|gb|ABY94919.1| DNA protecting protein DprA [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|319929183|gb|ADV79868.1| DNA protecting protein DprA [Thermoanaerobacter brockii subsp. finnii Ako-1] Length = 362 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I + G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQISEE-GLLVSEFPL 202 >gi|317494306|ref|ZP_07952720.1| DNA protecting protein DprA [Enterobacteriaceae bacterium 9_2_54FAA] gi|316917556|gb|EFV38901.1| DNA protecting protein DprA [Enterobacteriaceae bacterium 9_2_54FAA] Length = 377 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+ LYP + +L I +N G ISE P Sbjct: 172 LGCGIAQLYPTCHEHLAARIVENNGAIISEFPP 204 >gi|92114982|ref|YP_574910.1| DNA processing protein DprA, putative [Chromohalobacter salexigens DSM 3043] gi|91798072|gb|ABE60211.1| DNA protecting protein DprA [Chromohalobacter salexigens DSM 3043] Length = 371 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G++ +YPP + L + D GG+ +SE P Sbjct: 177 LGCGVEVIYPPRHAGLYRRLLDEGGLLLSEHP 208 >gi|269219630|ref|ZP_06163484.1| DNA protecting protein DprA [Actinomyces sp. oral taxon 848 str. F0332] gi|269210872|gb|EEZ77212.1| DNA protecting protein DprA [Actinomyces sp. oral taxon 848 str. F0332] Length = 468 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 17/33 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G+D YP + +L EI GG SE P G Sbjct: 261 ACGVDRYYPASHADLYLEILRRGGAICSEAPPG 293 >gi|260554283|ref|ZP_05826533.1| DNA protecting protein DprA [Acinetobacter sp. RUH2624] gi|260404592|gb|EEW98112.1| DNA protecting protein DprA [Acinetobacter sp. RUH2624] Length = 376 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 180 GTGLDTTYPAQNKKLAEHILAQNGAIITEFLPG 212 >gi|91977499|ref|YP_570158.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisB5] gi|91683955|gb|ABE40257.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisB5] Length = 422 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 25/34 (73%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YPPE+ +LL +I + G AISE+P G Sbjct: 225 LAGGHDKIYPPEHEDLLLDIVEARGAAISEMPLG 258 >gi|58698108|ref|ZP_00373031.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila ananassae] gi|58535354|gb|EAL59430.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila ananassae] Length = 346 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 24/32 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP EN +L ++I NGG+ I+E+PF Sbjct: 148 ASGIDVVYPKENFDLYKKITGNGGLVITELPF 179 >gi|288575792|ref|ZP_06393972.1| DNA protecting protein DprA [Neisseria mucosa ATCC 25996] gi|288566999|gb|EFC88559.1| DNA protecting protein DprA [Neisseria mucosa ATCC 25996] Length = 355 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI + G+ +SE P Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPL 208 >gi|224826192|ref|ZP_03699295.1| DNA protecting protein DprA [Lutiella nitroferrum 2002] gi|224601829|gb|EEG08009.1| DNA protecting protein DprA [Lutiella nitroferrum 2002] Length = 366 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +R L + G+ +SE P G Sbjct: 171 IGTGIDRVYPASHRQLAHQ-LAEDGLILSEFPLG 203 >gi|261400041|ref|ZP_05986166.1| putative DNA processing protein DprA [Neisseria lactamica ATCC 23970] gi|269210264|gb|EEZ76719.1| putative DNA processing protein DprA [Neisseria lactamica ATCC 23970] Length = 397 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPANKNLAYEIAE-KGLIVSEFPIG 209 >gi|42520001|ref|NP_965916.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila melanogaster] gi|42409738|gb|AAS13850.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila melanogaster] Length = 362 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 24/32 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP EN +L ++I NGG+ I+E+PF Sbjct: 164 ASGIDVVYPKENFDLYKKITGNGGLVITELPF 195 >gi|50122918|ref|YP_052085.1| DNA protecting protein DprA [Pectobacterium atrosepticum SCRI1043] gi|49613444|emb|CAG76895.1| conserved hypothetical protein [Pectobacterium atrosepticum SCRI1043] Length = 373 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E I +GG +SE P Sbjct: 167 LGSGLGNIYPKRHVKLAERICGDGGALVSEFPL 199 >gi|89074762|ref|ZP_01161220.1| Hypothetical Smf protein [Photobacterium sp. SKA34] gi|89049526|gb|EAR55087.1| Hypothetical Smf protein [Photobacterium sp. SKA34] Length = 365 Score = 57.7 bits (140), Expect = 6e-07, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP +R L EI + G +SE Sbjct: 170 LGSGLDQVYPARHRQLANEIVEQ-GALVSEF 199 >gi|325124150|gb|ADY83673.1| putative Rossmann-fold nucleotide-binding protein involved in DNA uptake (smf) [Acinetobacter calcoaceticus PHEA-2] Length = 377 Score = 57.3 bits (139), Expect = 6e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 180 GTGLDSTYPAQNKKLAEHILAQNGAIITEFLPG 212 >gi|268608877|ref|ZP_06142604.1| DNA protecting protein DprA [Ruminococcus flavefaciens FD-1] Length = 422 Score = 57.3 bits (139), Expect = 6e-07, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G+D YP N+ E+I GG+ ISE P G Sbjct: 171 MGCGVDVDYPKPNQQFREKILQCGGVFISEFPPG 204 >gi|193076054|gb|ABO10649.2| putative Rossmann-fold nucleotide-binding DNA uptake protein (Smf) [Acinetobacter baumannii ATCC 17978] Length = 383 Score = 57.3 bits (139), Expect = 6e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 187 GTGLDTTYPAQNKKLAEHILAQNGAIITEFLPG 219 >gi|225075474|ref|ZP_03718673.1| hypothetical protein NEIFLAOT_00479 [Neisseria flavescens NRL30031/H210] gi|224953193|gb|EEG34402.1| hypothetical protein NEIFLAOT_00479 [Neisseria flavescens NRL30031/H210] Length = 396 Score = 57.3 bits (139), Expect = 6e-07, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI + G+ +SE P Sbjct: 178 GTGIDRIYPPSNKNLAYEIAER-GLIVSEFPL 208 >gi|148558431|ref|YP_001257589.1| SMF protein [Brucella ovis ATCC 25840] gi|148369716|gb|ABQ62588.1| SMF protein [Brucella ovis ATCC 25840] Length = 393 Score = 57.3 bits (139), Expect = 6e-07, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AG LD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGRLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|206603104|gb|EDZ39584.1| DNA processing protein DprA [Leptospirillum sp. Group II '5-way CG'] Length = 306 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 18/33 (54%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L EI GG +SE P G Sbjct: 177 GTGLDRVYPDFHRTLAGEILSGGGCIVSEFPPG 209 >gi|260557578|ref|ZP_05829792.1| rossmann fold nucleotide-binding protein [Acinetobacter baumannii ATCC 19606] gi|260408751|gb|EEX02055.1| rossmann fold nucleotide-binding protein [Acinetobacter baumannii ATCC 19606] Length = 376 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 180 GTGLDTTYPAQNKKLAEHILAQNGAIITEFLPG 212 >gi|113968377|ref|YP_732170.1| DNA protecting protein DprA [Shewanella sp. MR-4] gi|113883061|gb|ABI37113.1| DNA protecting protein DprA [Shewanella sp. MR-4] Length = 338 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP ++ L E+I + G ISE Sbjct: 142 LGTGIDIIYPRRHKQLYEDI-QHQGCIISEF 171 >gi|114045542|ref|YP_736092.1| DNA protecting protein DprA [Shewanella sp. MR-7] gi|113886984|gb|ABI41035.1| DNA protecting protein DprA [Shewanella sp. MR-7] Length = 338 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP ++ L E+I + G ISE Sbjct: 142 LGTGIDIIYPRRHKQLYEDI-QHQGCIISEF 171 >gi|117918496|ref|YP_867688.1| DNA protecting protein DprA [Shewanella sp. ANA-3] gi|117610828|gb|ABK46282.1| DNA protecting protein DprA [Shewanella sp. ANA-3] Length = 338 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP ++ L E+I + G ISE Sbjct: 142 LGTGIDIIYPRRHKQLYEDI-QHQGCIISEF 171 >gi|303240294|ref|ZP_07326813.1| DNA protecting protein DprA [Acetivibrio cellulolyticus CD2] gi|302592204|gb|EFL61933.1| DNA protecting protein DprA [Acetivibrio cellulolyticus CD2] Length = 369 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN+ L+E I +N G +SE G Sbjct: 172 LGCGLDIVYPYENKKLMENIIEN-GACLSEFLPG 204 >gi|332852663|ref|ZP_08434317.1| DNA protecting protein DprA [Acinetobacter baumannii 6013150] gi|332869379|ref|ZP_08438757.1| DNA protecting protein DprA [Acinetobacter baumannii 6013113] gi|332729131|gb|EGJ60478.1| DNA protecting protein DprA [Acinetobacter baumannii 6013150] gi|332732797|gb|EGJ64013.1| DNA protecting protein DprA [Acinetobacter baumannii 6013113] Length = 383 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 187 GTGLDTTYPAQNKKLAEHILAQNGAIITEFLPG 219 >gi|167767275|ref|ZP_02439328.1| hypothetical protein CLOSS21_01794 [Clostridium sp. SS2/1] gi|317497303|ref|ZP_07955626.1| DNA protecting protein DprA [Lachnospiraceae bacterium 5_1_63FAA] gi|167711250|gb|EDS21829.1| hypothetical protein CLOSS21_01794 [Clostridium sp. SS2/1] gi|291559414|emb|CBL38214.1| DNA protecting protein DprA [butyrate-producing bacterium SSC/2] gi|316895372|gb|EFV17531.1| DNA protecting protein DprA [Lachnospiraceae bacterium 5_1_63FAA] Length = 360 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN L +++ N ISE P G Sbjct: 170 LGCGIDLIYPKENFQLFYDMYANQ-TVISEYPPG 202 >gi|167040338|ref|YP_001663323.1| DNA protecting protein DprA [Thermoanaerobacter sp. X514] gi|300914422|ref|ZP_07131738.1| DNA protecting protein DprA [Thermoanaerobacter sp. X561] gi|307724342|ref|YP_003904093.1| DNA protecting protein DprA [Thermoanaerobacter sp. X513] gi|166854578|gb|ABY92987.1| DNA protecting protein DprA [Thermoanaerobacter sp. X514] gi|300889357|gb|EFK84503.1| DNA protecting protein DprA [Thermoanaerobacter sp. X561] gi|307581403|gb|ADN54802.1| DNA protecting protein DprA [Thermoanaerobacter sp. X513] Length = 362 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I + G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQISE-KGLLVSEFPL 202 >gi|88860595|ref|ZP_01135232.1| hypothetical protein PTD2_05040 [Pseudoalteromonas tunicata D2] gi|88817190|gb|EAR27008.1| hypothetical protein PTD2_05040 [Pseudoalteromonas tunicata D2] Length = 363 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N+ L +I + G+ +SE G Sbjct: 174 LGTGVDVIYPKRNKLLAMQIIER-GLLVSEFLPG 206 >gi|75909996|ref|YP_324292.1| SMF protein [Anabaena variabilis ATCC 29413] gi|75703721|gb|ABA23397.1| SMF protein [Anabaena variabilis ATCC 29413] Length = 372 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D +YP +NR+L ++I G+ +SE P Sbjct: 177 LGTGVDVVYPHKNRDLYKQIL-TNGLVVSEYP 207 >gi|293611138|ref|ZP_06693436.1| conserved hypothetical protein [Acinetobacter sp. SH024] gi|292826389|gb|EFF84756.1| conserved hypothetical protein [Acinetobacter sp. SH024] Length = 377 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 180 GTGLDSTYPAQNKKLAEHILAQNGAIITEFLPG 212 >gi|293390730|ref|ZP_06635064.1| DNA protecting protein DprA [Aggregatibacter actinomycetemcomitans D7S-1] gi|290951264|gb|EFE01383.1| DNA protecting protein DprA [Aggregatibacter actinomycetemcomitans D7S-1] Length = 372 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP ++R L + I ++ G +SE Sbjct: 170 LGSGLEEVYPAKHRKLAQNIIEHDGALVSEFFP 202 >gi|319639529|ref|ZP_07994276.1| SMF-family protein [Neisseria mucosa C102] gi|317399100|gb|EFV79774.1| SMF-family protein [Neisseria mucosa C102] Length = 396 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI + G+ +SE P Sbjct: 178 GTGIDRIYPPSNKNLAYEIAE-KGLIVSEFPL 208 >gi|239618024|ref|YP_002941346.1| DNA protecting protein DprA [Kosmotoga olearia TBF 19.5.1] gi|239506855|gb|ACR80342.1| DNA protecting protein DprA [Kosmotoga olearia TBF 19.5.1] Length = 343 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP NR L I ++ G +SE G Sbjct: 160 LGSGIDIVYPKSNRKLFSFITEH-GCIVSEFLPG 192 >gi|237806931|ref|YP_002891371.1| DNA protecting protein DprA [Tolumonas auensis DSM 9187] gi|237499192|gb|ACQ91785.1| DNA protecting protein DprA [Tolumonas auensis DSM 9187] Length = 374 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GL +YP +++ L +I + GG ISE Sbjct: 178 GCGLRHVYPAKHKRLASQILEQGGALISEFFP 209 >gi|154250247|ref|YP_001411072.1| DNA protecting protein DprA [Fervidobacterium nodosum Rt17-B1] gi|154154183|gb|ABS61415.1| DNA protecting protein DprA [Fervidobacterium nodosum Rt17-B1] Length = 333 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP N L +EI N G ISE Sbjct: 151 LGCGVDYIYPKSNERLYQEIIKN-GCVISEY 180 >gi|15676044|ref|NP_273174.1| DNA processing chain A [Neisseria meningitidis MC58] gi|7225332|gb|AAF40575.1| DNA processing chain A [Neisseria meningitidis MC58] gi|316985962|gb|EFV64901.1| DNA protecting protein DprA [Neisseria meningitidis H44/76] gi|325141261|gb|EGC63760.1| putative DNA processing protein DprA [Neisseria meningitidis CU385] gi|325199330|gb|ADY94785.1| putative DNA processing protein DprA [Neisseria meningitidis H44/76] Length = 397 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G+ +SE P G Sbjct: 178 GTGIDRIYPPVNKNLAYEIAE-KGLIVSEFPIG 209 >gi|121606769|ref|YP_984098.1| DNA protecting protein DprA [Polaromonas naphthalenivorans CJ2] gi|120595738|gb|ABM39177.1| DNA protecting protein DprA [Polaromonas naphthalenivorans CJ2] Length = 399 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ++ L I G+ ISE P G Sbjct: 199 GTGLDRVYPKKHLALAHRI-ARQGMIISEFPLG 230 >gi|294138836|ref|YP_003554814.1| DNA processing protein DprA [Shewanella violacea DSS12] gi|293325305|dbj|BAJ00036.1| DNA processing protein DprA, putative [Shewanella violacea DSS12] Length = 339 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +R + EEI + G +SE G Sbjct: 143 LGSGVDVIYPRRHRTIYEEI-QHHGAIVSEFWPG 175 >gi|253997895|ref|YP_003049958.1| DNA protecting protein DprA [Methylovorus sp. SIP3-4] gi|253984574|gb|ACT49431.1| DNA protecting protein DprA [Methylovorus sp. SIP3-4] Length = 371 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ++R L +I + G+ ISE G Sbjct: 178 GTGLDIVYPSKHRALAHQIVEQ-GLIISEFALG 209 >gi|169797635|ref|YP_001715428.1| putative Rossmann-fold nucleotide-binding protein involved in DNA uptake (Smf) [Acinetobacter baumannii AYE] gi|213155571|ref|YP_002317616.1| DNA protecting protein DprA [Acinetobacter baumannii AB0057] gi|215484989|ref|YP_002327230.1| DNA protecting protein DprA [Acinetobacter baumannii AB307-0294] gi|301346866|ref|ZP_07227607.1| DNA protecting protein DprA [Acinetobacter baumannii AB056] gi|301512294|ref|ZP_07237531.1| DNA protecting protein DprA [Acinetobacter baumannii AB058] gi|301594508|ref|ZP_07239516.1| DNA protecting protein DprA [Acinetobacter baumannii AB059] gi|169150562|emb|CAM88471.1| putative Rossmann-fold nucleotide-binding protein involved in DNA uptake (Smf) [Acinetobacter baumannii AYE] gi|213054731|gb|ACJ39633.1| DNA protecting protein DprA [Acinetobacter baumannii AB0057] gi|213988661|gb|ACJ58960.1| DNA protecting protein DprA [Acinetobacter baumannii AB307-0294] Length = 376 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 180 GTGLDTTYPAQNKKLAEHILAQNGAIITEFLPG 212 >gi|313199960|ref|YP_004038618.1| DNA protecting protein dpra [Methylovorus sp. MP688] gi|312439276|gb|ADQ83382.1| DNA protecting protein DprA [Methylovorus sp. MP688] Length = 371 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ++R L +I + G+ ISE G Sbjct: 178 GTGLDIVYPSKHRALAHQIVEQ-GLIISEFALG 209 >gi|297588473|ref|ZP_06947116.1| SMF family DNA processing protein [Finegoldia magna ATCC 53516] gi|297573846|gb|EFH92567.1| SMF family DNA processing protein [Finegoldia magna ATCC 53516] Length = 356 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIW-DNGGIAISEIPFG 34 + G+D +YP N + +++ + G+ +SE PFG Sbjct: 167 LGCGIDQVYPRSNYRVFQDMISSHNGVIMSEYPFG 201 >gi|126733565|ref|ZP_01749312.1| DNA processing protein DprA, putative [Roseobacter sp. CCS2] gi|126716431|gb|EBA13295.1| DNA processing protein DprA, putative [Roseobacter sp. CCS2] Length = 379 Score = 57.3 bits (139), Expect = 7e-07, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YP EN L +I G+ +SE+P G Sbjct: 180 MAGGVDIIYPAENTQLAHDIAKR-GLRLSEMPMG 212 >gi|186682634|ref|YP_001865830.1| DNA protecting protein DprA [Nostoc punctiforme PCC 73102] gi|186465086|gb|ACC80887.1| DNA protecting protein DprA [Nostoc punctiforme PCC 73102] Length = 371 Score = 57.3 bits (139), Expect = 8e-07, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D +YP +NR+L ++I G+ +SE P Sbjct: 177 LGTGVDVIYPHKNRDLYKQIL-TAGLVVSEYP 207 >gi|126640267|ref|YP_001083251.1| putative Rossmann-fold nucleotide-binding DNA uptake protein (Smf) [Acinetobacter baumannii ATCC 17978] Length = 362 Score = 57.3 bits (139), Expect = 8e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 166 GTGLDTTYPAQNKKLAEHILAQNGAIITEFLPG 198 >gi|94499924|ref|ZP_01306460.1| Smf protein [Oceanobacter sp. RED65] gi|94428125|gb|EAT13099.1| Smf protein [Oceanobacter sp. RED65] Length = 391 Score = 57.3 bits (139), Expect = 8e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP EN L E+I G +SE Sbjct: 182 LGSGLNHIYPKENAELAEQIC-QKGALVSEFAL 213 >gi|331091326|ref|ZP_08340166.1| hypothetical protein HMPREF9477_00809 [Lachnospiraceae bacterium 2_1_46FAA] gi|330404487|gb|EGG84031.1| hypothetical protein HMPREF9477_00809 [Lachnospiraceae bacterium 2_1_46FAA] Length = 361 Score = 57.3 bits (139), Expect = 8e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN L E++ + GG +SE P G Sbjct: 171 LGSGVDVCYPRENIGLYEDLQEKGG-ILSEQPLG 203 >gi|146341416|ref|YP_001206464.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. ORS278] gi|146194222|emb|CAL78244.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. ORS278] Length = 371 Score = 57.3 bits (139), Expect = 8e-07, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 24/34 (70%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YPPE+ +LL I + G AISE+P G Sbjct: 174 LAGGHDRIYPPEHVDLLGAIIGSHGAAISEMPLG 207 >gi|148658666|ref|YP_001278871.1| DNA protecting protein DprA [Roseiflexus sp. RS-1] gi|148570776|gb|ABQ92921.1| DNA protecting protein DprA [Roseiflexus sp. RS-1] Length = 360 Score = 57.3 bits (139), Expect = 8e-07, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP + L I D+ G ISE P G Sbjct: 171 LPCGIDLVYPERHDTLARRITDH-GALISEFPPG 203 >gi|73666848|ref|YP_302864.1| SMF protein [Ehrlichia canis str. Jake] gi|72393989|gb|AAZ68266.1| SMF protein [Ehrlichia canis str. Jake] Length = 374 Score = 57.3 bits (139), Expect = 8e-07, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 23/33 (69%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MA G++ +YP EN +L + I D GG+ I+E PF Sbjct: 174 MASGINIVYPQENTHLYKTIIDKGGLIITEFPF 206 >gi|299135144|ref|ZP_07028335.1| DNA protecting protein DprA [Afipia sp. 1NLS2] gi|298590121|gb|EFI50325.1| DNA protecting protein DprA [Afipia sp. 1NLS2] Length = 373 Score = 57.3 bits (139), Expect = 8e-07, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 24/34 (70%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YPPE+ LL I D GG AISE+P G Sbjct: 176 LAGGHDRIYPPEHEGLLAAIIDAGGGAISEMPLG 209 >gi|187734950|ref|YP_001877062.1| DNA protecting protein DprA [Akkermansia muciniphila ATCC BAA-835] gi|187425002|gb|ACD04281.1| DNA protecting protein DprA [Akkermansia muciniphila ATCC BAA-835] Length = 375 Score = 56.9 bits (138), Expect = 8e-07, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ENRNL + I D G +SE P Sbjct: 173 IGAGLNKLYPRENRNLAQRIADGHGAVVSEFPM 205 >gi|218513189|ref|ZP_03510029.1| DNA processing chain A protein [Rhizobium etli 8C-3] Length = 352 Score = 56.9 bits (138), Expect = 8e-07, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 165 LAGGLDRPYPPENLGLIEEIAGGNGLAVSEMPFG 198 >gi|27380215|ref|NP_771744.1| DNA processing protein [Bradyrhizobium japonicum USDA 110] gi|27353369|dbj|BAC50369.1| DNA processing protein [Bradyrhizobium japonicum USDA 110] Length = 380 Score = 56.9 bits (138), Expect = 8e-07, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG DC+YPPE+ +LL I D+ G AISE+P G Sbjct: 183 LAGGHDCIYPPEHGDLLTSILDHAGAAISEMPLG 216 >gi|222148310|ref|YP_002549267.1| DNA protecting protein DprA [Agrobacterium vitis S4] gi|221735298|gb|ACM36261.1| DNA protecting protein DprA [Agrobacterium vitis S4] Length = 383 Score = 56.9 bits (138), Expect = 8e-07, Method: Composition-based stats. Identities = 23/34 (67%), Positives = 29/34 (85%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN +LL++IWD G+AISE+PFG Sbjct: 178 LAGGLDRPYPPENVDLLKDIWDGKGVAISEMPFG 211 >gi|317049805|ref|YP_004117453.1| DNA protecting protein DprA [Pantoea sp. At-9b] gi|316951422|gb|ADU70897.1| DNA protecting protein DprA [Pantoea sp. At-9b] Length = 374 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP ++ L +EI N G +SE P Sbjct: 167 LGSGLKHLYPKIHQKLAQEIISNDGALVSEFPL 199 >gi|24371634|ref|NP_715676.1| DNA processing protein DprA, putative [Shewanella oneidensis MR-1] gi|24345393|gb|AAN53121.1|AE015455_2 DNA processing protein DprA, putative [Shewanella oneidensis MR-1] Length = 338 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP ++ L E+I G ISE Sbjct: 142 LGTGIDIIYPRRHKQLYEDI-QRQGCIISEF 171 >gi|319778669|ref|YP_004129582.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Taylorella equigenitalis MCE9] gi|317108693|gb|ADU91439.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Taylorella equigenitalis MCE9] Length = 375 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN L E+ + G+ ISE G Sbjct: 184 LGSGLDIIYPKENVELAEQ-VKSNGLLISEFGLG 216 >gi|312897996|ref|ZP_07757405.1| DNA protecting protein DprA [Megasphaera micronuciformis F0359] gi|310620921|gb|EFQ04472.1| DNA protecting protein DprA [Megasphaera micronuciformis F0359] Length = 367 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 18/33 (54%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YPPEN L I GG+ SE PFG Sbjct: 177 GAGLDKTYPPENAALFRRIIGAGGVVCSEFPFG 209 >gi|210610054|ref|ZP_03288233.1| hypothetical protein CLONEX_00419 [Clostridium nexile DSM 1787] gi|210152665|gb|EEA83671.1| hypothetical protein CLONEX_00419 [Clostridium nexile DSM 1787] Length = 358 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP E+ L E + G +SE P G Sbjct: 168 LGCGVDVCYPREHIELYTE-LERKGGILSEQPIG 200 >gi|92117808|ref|YP_577537.1| DNA processing protein DprA, putative [Nitrobacter hamburgensis X14] gi|91800702|gb|ABE63077.1| DNA processing protein DprA, putative [Nitrobacter hamburgensis X14] Length = 372 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YPPE+ +LL I ++GG ISE+P G Sbjct: 175 LAGGHDRIYPPEHEDLLAAILEDGGA-ISEMPMG 207 >gi|300087797|ref|YP_003758319.1| DNA protecting protein DprA [Dehalogenimonas lykanthroporepellens BL-DC-9] gi|299527530|gb|ADJ25998.1| DNA protecting protein DprA [Dehalogenimonas lykanthroporepellens BL-DC-9] Length = 362 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+ +YP EN+ L +EI ++ G ISE P Sbjct: 174 LGSGIGEIYPRENKKLADEITEH-GAVISEFPL 205 >gi|297537403|ref|YP_003673172.1| DNA protecting protein DprA [Methylotenera sp. 301] gi|297256750|gb|ADI28595.1| DNA protecting protein DprA [Methylotenera sp. 301] Length = 371 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GLD +YP ++R+L +I ++ G+ ISE Sbjct: 184 GTGLDIVYPAKHRDLAHQIVEH-GLIISEFAL 214 >gi|257791160|ref|YP_003181766.1| DNA protecting protein DprA [Eggerthella lenta DSM 2243] gi|325832903|ref|ZP_08165576.1| DNA protecting protein DprA [Eggerthella sp. HGA1] gi|257475057|gb|ACV55377.1| DNA protecting protein DprA [Eggerthella lenta DSM 2243] gi|325485768|gb|EGC88232.1| DNA protecting protein DprA [Eggerthella sp. HGA1] Length = 305 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 18/30 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GG D LYP E+ L + I D GG +SE Sbjct: 102 LGGGCDRLYPAEHEGLFQRIVDEGGAVVSE 131 >gi|304391708|ref|ZP_07373650.1| DNA protecting protein DprA [Ahrensia sp. R2A130] gi|303295937|gb|EFL90295.1| DNA protecting protein DprA [Ahrensia sp. R2A130] Length = 378 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 21/33 (63%), Positives = 24/33 (72%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYPPEN LL+ I GG AISE+P G Sbjct: 178 AGGVDHLYPPENGPLLDAILATGGAAISEMPLG 210 >gi|302874646|ref|YP_003843279.1| DNA protecting protein DprA [Clostridium cellulovorans 743B] gi|307690742|ref|ZP_07633188.1| DNA protecting protein DprA [Clostridium cellulovorans 743B] gi|302577503|gb|ADL51515.1| DNA protecting protein DprA [Clostridium cellulovorans 743B] Length = 344 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D YP N+ L + I N G +SE P Sbjct: 148 IGSGIDVTYPYSNKELYKRII-NNGCILSEFPL 179 >gi|190891322|ref|YP_001977864.1| DNA processing chain A protein [Rhizobium etli CIAT 652] gi|190696601|gb|ACE90686.1| DNA processing chain A protein [Rhizobium etli CIAT 652] Length = 380 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 178 LAGGLDRPYPPENLGLIEEIAGGNGLAVSEMPFG 211 >gi|146313351|ref|YP_001178425.1| DNA protecting protein DprA [Enterobacter sp. 638] gi|145320227|gb|ABP62374.1| DNA protecting protein DprA [Enterobacter sp. 638] Length = 374 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + +L ++I + GG ISE P Sbjct: 167 LGNGLSGIYPKRHASLADKIIEAGGAVISEFPL 199 >gi|311696637|gb|ADP99510.1| DNA protecting protein DprA [marine bacterium HP15] Length = 380 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP ++R L E + G+ ISE P G Sbjct: 180 IGCGLDRVYPHQHRRLGERVVA-DGLMISEYPPG 212 >gi|86749541|ref|YP_486037.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris HaA2] gi|86572569|gb|ABD07126.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris HaA2] Length = 378 Score = 56.9 bits (138), Expect = 9e-07, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 24/34 (70%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP E+ +LL +I + G AISE+P G Sbjct: 181 LAGGHDKIYPAEHEDLLLDIIEARGAAISEMPLG 214 >gi|229524950|ref|ZP_04414355.1| hypothetical protein VCA_002559 [Vibrio cholerae bv. albensis VL426] gi|229338531|gb|EEO03548.1| hypothetical protein VCA_002559 [Vibrio cholerae bv. albensis VL426] Length = 371 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP +++ L E I G +SE Sbjct: 172 LGSGLEKIYPKQHQGLAERIIAQ-GALVSEFAP 203 >gi|295107976|emb|CBL21929.1| DNA protecting protein DprA [Ruminococcus obeum A2-162] Length = 295 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 16/34 (47%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP NR L + I GG ISE G Sbjct: 104 LGNGPDICYPAGNRGLYQRILRTGGGIISEQTPG 137 >gi|251793282|ref|YP_003008010.1| DNA-processing chain A [Aggregatibacter aphrophilus NJ8700] gi|247534677|gb|ACS97923.1| protein smf (DNA-processing chain A) [Aggregatibacter aphrophilus NJ8700] Length = 371 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP ++R L +EI N G +SE Sbjct: 170 LGSGLEEIYPTKHRKLAQEIIANNGALVSEFFP 202 >gi|254446574|ref|ZP_05060050.1| DNA protecting protein DprA, putative [Verrucomicrobiae bacterium DG1235] gi|198260882|gb|EDY85190.1| DNA protecting protein DprA, putative [Verrucomicrobiae bacterium DG1235] Length = 376 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPPEN +L + G +SE PFG Sbjct: 178 GCGIDIVYPPENVDLFRQ-AQVNGAVVSEFPFG 209 >gi|300783888|ref|YP_003764179.1| DNA processing protein [Amycolatopsis mediterranei U32] gi|299793402|gb|ADJ43777.1| DNA processing protein [Amycolatopsis mediterranei U32] Length = 332 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + +D YP + LL I +GG ISE P G Sbjct: 134 LGCAVDNGYPAGHIGLLNRIAGSGGAVISEYPPG 167 >gi|325129152|gb|EGC52000.1| putative DNA processing protein DprA [Neisseria meningitidis N1568] Length = 397 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI + G+ +SE P Sbjct: 178 GTGIDRIYPPSNKNLAYEIAER-GLIVSEFPL 208 >gi|284099271|ref|ZP_06385988.1| SMF protein [Candidatus Poribacteria sp. WGA-A3] gi|283830401|gb|EFC34611.1| SMF protein [Candidatus Poribacteria sp. WGA-A3] Length = 375 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YPPE+R L ++I + G +SE+P G Sbjct: 176 GCGVDRTYPPEHRQLRKDI-EVNGAVVSELPLG 207 >gi|170746908|ref|YP_001753168.1| DNA protecting protein DprA [Methylobacterium radiotolerans JCM 2831] gi|170653430|gb|ACB22485.1| DNA protecting protein DprA [Methylobacterium radiotolerans JCM 2831] Length = 403 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG D +YP + L+E I GG ++E+P G Sbjct: 165 MAGGQDRIYPASHAALVEAILAEGGAVLAEMPMG 198 >gi|270602100|ref|ZP_06221567.1| smf protein [Haemophilus influenzae HK1212] gi|270318248|gb|EFA29440.1| smf protein [Haemophilus influenzae HK1212] Length = 144 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 93 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 123 >gi|242237893|ref|YP_002986074.1| DNA protecting protein DprA [Dickeya dadantii Ech703] gi|242129950|gb|ACS84252.1| DNA protecting protein DprA [Dickeya dadantii Ech703] Length = 377 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP ++ L + I +NGG +SE Sbjct: 167 LGSGLRQIYPKKHAALADAIVENGGAIVSEF 197 >gi|121633994|ref|YP_974239.1| SMF-family protein [Neisseria meningitidis FAM18] gi|120865700|emb|CAM09427.1| SMF-family protein [Neisseria meningitidis FAM18] Length = 397 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI + G+ +SE P Sbjct: 178 GTGIDRIYPPSNKNLAYEIAER-GLIVSEFPL 208 >gi|300115534|ref|YP_003762109.1| DNA protecting protein DprA [Nitrosococcus watsonii C-113] gi|299541471|gb|ADJ29788.1| DNA protecting protein DprA [Nitrosococcus watsonii C-113] Length = 368 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L I ++ G +SE P G Sbjct: 168 GTGLDRVYPARHHALAHAIAES-GALVSEFPIG 199 >gi|46200754|ref|ZP_00056433.2| COG0758: Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Magnetospirillum magnetotacticum MS-1] Length = 383 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPPEN +L EI G +SE+P G Sbjct: 181 LAGGVDVVYPPENTDLWREICAA-GTVVSEMPVG 213 >gi|332289297|ref|YP_004420149.1| DNA protecting protein DprA [Gallibacterium anatis UMN179] gi|330432193|gb|AEC17252.1| DNA protecting protein DprA [Gallibacterium anatis UMN179] Length = 398 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE-IP 32 + GL+ LYP ++ L ++I +N G +SE P Sbjct: 169 LGSGLNELYPARHKKLAQQILENNGALLSELFP 201 >gi|262037924|ref|ZP_06011349.1| Smf protein [Leptotrichia goodfellowii F0264] gi|261748067|gb|EEY35481.1| Smf protein [Leptotrichia goodfellowii F0264] Length = 351 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN+ L E+I D G+ ISE P G Sbjct: 164 GTGLDVVYPYENKMLWEKISDT-GMIISEYPLG 195 >gi|121533773|ref|ZP_01665600.1| DNA protecting protein DprA [Thermosinus carboxydivorans Nor1] gi|121307764|gb|EAX48679.1| DNA protecting protein DprA [Thermosinus carboxydivorans Nor1] Length = 282 Score = 56.9 bits (138), Expect = 1e-06, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YPPEN +L EI + GG ISE G Sbjct: 91 LGCGVDVCYPPENAKILAEIAETGG-IISEYAPG 123 >gi|253682393|ref|ZP_04863190.1| DNA protecting protein DprA [Clostridium botulinum D str. 1873] gi|253562105|gb|EES91557.1| DNA protecting protein DprA [Clostridium botulinum D str. 1873] Length = 359 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN+ L EI N G IS+ G Sbjct: 169 LGSGIDVIYPKENKYLYSEIIKN-GCVISQFLPG 201 >gi|77166459|ref|YP_344984.1| SMF protein [Nitrosococcus oceani ATCC 19707] gi|254435425|ref|ZP_05048932.1| DNA protecting protein DprA, putative [Nitrosococcus oceani AFC27] gi|76884773|gb|ABA59454.1| DNA protecting protein DprA [Nitrosococcus oceani ATCC 19707] gi|207088536|gb|EDZ65808.1| DNA protecting protein DprA, putative [Nitrosococcus oceani AFC27] Length = 368 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L I ++ G +SE P G Sbjct: 168 GTGLDRVYPARHHALAHAIAES-GALVSEFPIG 199 >gi|300692921|ref|YP_003753916.1| smf, DNA processing chain A (drpA) [Ralstonia solanacearum PSI07] gi|299079981|emb|CBJ52658.1| putative smf, DNA processing chain A (drpA) [Ralstonia solanacearum PSI07] Length = 401 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR L I + G+ +SE P G Sbjct: 198 GTGLDMVYPARNRALAHRIAEA-GLMLSEYPLG 229 >gi|327478636|gb|AEA81946.1| DNA processing protein DprA, putative [Pseudomonas stutzeri DSM 4166] Length = 365 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ LYP + +L +EI ++GG +SE+P Sbjct: 176 LGTGIERLYPQRHLSLAKEIVEHGGALVSELPL 208 >gi|308176205|ref|YP_003915611.1| smf family protein [Arthrobacter arilaitensis Re117] gi|307743668|emb|CBT74640.1| putative smf family protein [Arthrobacter arilaitensis Re117] Length = 333 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + LL I D G+ +SE+P G Sbjct: 186 LAGGVDRPYPAGHSELLGRIADT-GLVVSEMPPG 218 >gi|292489812|ref|YP_003532702.1| protein Smf [Erwinia amylovora CFBP1430] gi|292900854|ref|YP_003540223.1| hypothetical protein EAM_3161 [Erwinia amylovora ATCC 49946] gi|291200702|emb|CBJ47835.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946] gi|291555249|emb|CBA23520.1| Protein smf [Erwinia amylovora CFBP1430] gi|312173995|emb|CBX82248.1| Protein smf [Erwinia amylovora ATCC BAA-2158] Length = 374 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 22/33 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP +++ L ++I ++GG +SE P Sbjct: 167 LGSGLEAIYPRQHQLLAQQIVNSGGTLVSEFPL 199 >gi|192291901|ref|YP_001992506.1| DNA protecting protein DprA [Rhodopseudomonas palustris TIE-1] gi|192285650|gb|ACF02031.1| DNA protecting protein DprA [Rhodopseudomonas palustris TIE-1] Length = 378 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP E+ +LL +I G AISE+P G Sbjct: 181 LAGGHDKIYPAEHEDLLLDIIQTRGAAISEMPLG 214 >gi|146280420|ref|YP_001170573.1| DNA processing protein DprA, putative [Pseudomonas stutzeri A1501] gi|145568625|gb|ABP77731.1| DNA processing protein DprA, putative [Pseudomonas stutzeri A1501] Length = 365 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ LYP + +L +EI ++GG +SE+P Sbjct: 176 LGTGIERLYPQRHLSLAKEIVEHGGALVSELPL 208 >gi|170758557|ref|YP_001787750.1| DNA protecting protein DprA [Clostridium botulinum A3 str. Loch Maree] gi|169405546|gb|ACA53957.1| DNA protecting protein DprA [Clostridium botulinum A3 str. Loch Maree] Length = 361 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +N+ + +I G ISE G Sbjct: 172 LGSGIDVVYPKQNKKIY-DIISEDGCIISEFLPG 204 >gi|170756418|ref|YP_001781981.1| DNA protecting protein DprA [Clostridium botulinum B1 str. Okra] gi|169121630|gb|ACA45466.1| DNA protecting protein DprA [Clostridium botulinum B1 str. Okra] Length = 361 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +N+ + +I G ISE G Sbjct: 172 LGSGIDVVYPKQNKKIY-DIISEDGCIISEFLPG 204 >gi|168184644|ref|ZP_02619308.1| DNA protecting protein DprA [Clostridium botulinum Bf] gi|237795874|ref|YP_002863426.1| DNA protecting protein DprA [Clostridium botulinum Ba4 str. 657] gi|182672290|gb|EDT84251.1| DNA protecting protein DprA [Clostridium botulinum Bf] gi|229263394|gb|ACQ54427.1| DNA protecting protein DprA [Clostridium botulinum Ba4 str. 657] Length = 361 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +N+ + +I G ISE G Sbjct: 172 LGSGIDVVYPKQNKKIY-DIISEDGCIISEFLPG 204 >gi|153940771|ref|YP_001391736.1| DNA protecting protein DprA [Clostridium botulinum F str. Langeland] gi|152936667|gb|ABS42165.1| DNA protecting protein DprA [Clostridium botulinum F str. Langeland] gi|295319762|gb|ADG00140.1| DNA protecting protein DprA [Clostridium botulinum F str. 230613] Length = 361 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +N+ + +I G ISE G Sbjct: 172 LGSGIDVVYPKQNKKIY-DIISEDGCIISEFLPG 204 >gi|153931310|ref|YP_001384613.1| DNA protecting protein DprA [Clostridium botulinum A str. ATCC 19397] gi|153936174|ref|YP_001388130.1| DNA protecting protein DprA [Clostridium botulinum A str. Hall] gi|168180681|ref|ZP_02615345.1| DNA protecting protein DprA [Clostridium botulinum NCTC 2916] gi|226949791|ref|YP_002804882.1| DNA protecting protein DprA [Clostridium botulinum A2 str. Kyoto] gi|152927354|gb|ABS32854.1| DNA protecting protein DprA [Clostridium botulinum A str. ATCC 19397] gi|152932088|gb|ABS37587.1| DNA protecting protein DprA [Clostridium botulinum A str. Hall] gi|182668507|gb|EDT80486.1| DNA protecting protein DprA [Clostridium botulinum NCTC 2916] gi|226843761|gb|ACO86427.1| DNA protecting protein DprA [Clostridium botulinum A2 str. Kyoto] gi|322806704|emb|CBZ04273.1| crossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Clostridium botulinum H04402 065] Length = 361 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +N+ + +I G ISE G Sbjct: 172 LGSGIDVVYPKQNKKIY-DIISEDGCIISEFLPG 204 >gi|148380396|ref|YP_001254937.1| DNA protecting protein DprA [Clostridium botulinum A str. ATCC 3502] gi|148289880|emb|CAL83988.1| SMF family protein [Clostridium botulinum A str. ATCC 3502] Length = 361 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +N+ + +I G ISE G Sbjct: 172 LGSGIDVVYPKQNKKIY-DIISEDGCIISEFLPG 204 >gi|39936183|ref|NP_948459.1| DNA processing protein DprA [Rhodopseudomonas palustris CGA009] gi|39650038|emb|CAE28561.1| DNA processing chain A [Rhodopseudomonas palustris CGA009] Length = 380 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP E+ +LL +I G AISE+P G Sbjct: 183 LAGGHDKIYPAEHEDLLLDIIQTRGAAISEMPLG 216 >gi|86147127|ref|ZP_01065443.1| Smf protein [Vibrio sp. MED222] gi|85835011|gb|EAQ53153.1| Smf protein [Vibrio sp. MED222] Length = 370 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP +RNL + I +N G ISE Sbjct: 172 LGSGLDSIYPARHRNLADRICEN-GALISEF 201 >gi|94312498|ref|YP_585708.1| DNA processing protein DprA, putative [Cupriavidus metallidurans CH34] gi|93356350|gb|ABF10439.1| DNA processing protein (DprA/Smf type) [Cupriavidus metallidurans CH34] gi|222838659|gb|EEE77024.1| predicted protein [Populus trichocarpa] Length = 371 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L I D GG +SE G Sbjct: 180 IGTGADIVYPGRHHALAHRIVDAGGAIVSEFALG 213 >gi|283788079|ref|YP_003367944.1| hypothetical protein ROD_45361 [Citrobacter rodentium ICC168] gi|282951533|emb|CBG91232.1| conserved hypothetical protein [Citrobacter rodentium ICC168] Length = 374 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 15/31 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L + GG +SE Sbjct: 167 LGSGLEVIYPRRHGELAARMLATGGALVSEF 197 >gi|257463631|ref|ZP_05628022.1| Smf protein [Fusobacterium sp. D12] gi|317061183|ref|ZP_07925668.1| SMF family protein [Fusobacterium sp. D12] gi|313686859|gb|EFS23694.1| SMF family protein [Fusobacterium sp. D12] Length = 283 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +N NL + G+ +SE P G Sbjct: 98 GSGLDEIYPKQNTNLWKR-VAKEGLLVSEYPLG 129 >gi|125972980|ref|YP_001036890.1| DNA protecting protein DprA [Clostridium thermocellum ATCC 27405] gi|256004777|ref|ZP_05429752.1| DNA protecting protein DprA [Clostridium thermocellum DSM 2360] gi|281417191|ref|ZP_06248211.1| DNA protecting protein DprA [Clostridium thermocellum JW20] gi|125713205|gb|ABN51697.1| DNA protecting protein DprA [Clostridium thermocellum ATCC 27405] gi|255991227|gb|EEU01334.1| DNA protecting protein DprA [Clostridium thermocellum DSM 2360] gi|281408593|gb|EFB38851.1| DNA protecting protein DprA [Clostridium thermocellum JW20] gi|316940784|gb|ADU74818.1| DNA protecting protein DprA [Clostridium thermocellum DSM 1313] Length = 370 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN+ L+E I ++ G +SE G Sbjct: 172 LGCGLDIVYPYENKKLMENIIES-GACLSEYLPG 204 >gi|209548899|ref|YP_002280816.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209534655|gb|ACI54590.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 380 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 22/34 (64%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN LLEEI G+A+SE+PFG Sbjct: 178 LAGGLDQPYPPENIGLLEEITSGNGLAVSEMPFG 211 >gi|239818073|ref|YP_002946983.1| DNA protecting protein DprA [Variovorax paradoxus S110] gi|239804650|gb|ACS21717.1| DNA protecting protein DprA [Variovorax paradoxus S110] Length = 382 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R+L I G+ +SE+P G Sbjct: 188 GTGLDRVYPARHRDLAHRITLQ-GLIVSELPLG 219 >gi|160872061|ref|ZP_02062193.1| protein smf (DNA-processing chain A) [Rickettsiella grylli] gi|159120860|gb|EDP46198.1| protein smf (DNA-processing chain A) [Rickettsiella grylli] Length = 384 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++C+YP +R L EI + GG+ ISE Sbjct: 174 LGSGIECIYPSCHRALANEIVEKGGLLISEFFP 206 >gi|331269644|ref|YP_004396136.1| DNA uptake protein [Clostridium botulinum BKT015925] gi|329126194|gb|AEB76139.1| DNA uptake protein [Clostridium botulinum BKT015925] Length = 359 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN+ L +I N G IS+ G Sbjct: 169 LGSGIDVIYPKENKYLYNDIIKN-GCVISQFLPG 201 >gi|227833389|ref|YP_002835096.1| putative DNA processing protein [Corynebacterium aurimucosum ATCC 700975] gi|262184377|ref|ZP_06043798.1| putative DNA processing protein [Corynebacterium aurimucosum ATCC 700975] gi|227454405|gb|ACP33158.1| putative DNA processing protein [Corynebacterium aurimucosum ATCC 700975] Length = 392 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G+D YP N L + I + G +SE G Sbjct: 194 ACGIDISYPARNAKLFDRITE-KGCIVSEFAPG 225 >gi|160884358|ref|ZP_02065361.1| hypothetical protein BACOVA_02336 [Bacteroides ovatus ATCC 8483] gi|255691673|ref|ZP_05415348.1| putative DNA protecting protein DprA [Bacteroides finegoldii DSM 17565] gi|156110097|gb|EDO11842.1| hypothetical protein BACOVA_02336 [Bacteroides ovatus ATCC 8483] gi|260622745|gb|EEX45616.1| putative DNA protecting protein DprA [Bacteroides finegoldii DSM 17565] Length = 320 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Query: 1 MAGGLDC--LYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP EN +L +EI G+ +SE P G Sbjct: 179 LANGLDWDSIYPKENLDLAKEIVVKRGLLLSEYPVG 214 >gi|316933647|ref|YP_004108629.1| DNA protecting protein DprA [Rhodopseudomonas palustris DX-1] gi|315601361|gb|ADU43896.1| DNA protecting protein DprA [Rhodopseudomonas palustris DX-1] Length = 378 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 24/34 (70%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP E+ +LL +I + G AISE+P G Sbjct: 181 LAGGHDKIYPAEHEDLLLDIVQSRGAAISEMPLG 214 >gi|288573047|ref|ZP_06391404.1| DNA protecting protein DprA [Dethiosulfovibrio peptidovorans DSM 11002] gi|288568788|gb|EFC90345.1| DNA protecting protein DprA [Dethiosulfovibrio peptidovorans DSM 11002] Length = 358 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 16/34 (47%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP + L I + G +S P G Sbjct: 170 LGTGVDVVYPRGHEQLFSSISEKRGALMSRFPMG 203 >gi|82701529|ref|YP_411095.1| DNA processing protein DprA, putative [Nitrosospira multiformis ATCC 25196] gi|82409594|gb|ABB73703.1| DNA protecting protein DprA [Nitrosospira multiformis ATCC 25196] Length = 372 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L E+ + G +SE P G Sbjct: 185 GTGLDLVYPASHRKLAHELAER-GALVSEFPLG 216 >gi|145300984|ref|YP_001143825.1| DNA processing chain A [Aeromonas salmonicida subsp. salmonicida A449] gi|142853756|gb|ABO92077.1| DNA processing chain A [Aeromonas salmonicida subsp. salmonicida A449] Length = 371 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 22/33 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLDCLYP ++ L +I ++GG+ ISE+ Sbjct: 174 LGSGLDCLYPKRHQGLAGQILESGGLLISELAP 206 >gi|218710996|ref|YP_002418617.1| Smf protein [Vibrio splendidus LGP32] gi|218324015|emb|CAV20377.1| Smf protein [Vibrio splendidus LGP32] Length = 370 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP +RNL + I +N G ISE Sbjct: 172 LGSGLDSIYPARHRNLADRICEN-GALISEF 201 >gi|28199636|ref|NP_779950.1| DNA processing chain A [Xylella fastidiosa Temecula1] gi|182682381|ref|YP_001830541.1| DNA protecting protein DprA [Xylella fastidiosa M23] gi|28057751|gb|AAO29599.1| DNA processing chain A [Xylella fastidiosa Temecula1] gi|182632491|gb|ACB93267.1| DNA protecting protein DprA [Xylella fastidiosa M23] gi|307578663|gb|ADN62632.1| DNA protecting protein DprA [Xylella fastidiosa subsp. fastidiosa GB514] Length = 381 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP ++ L I G ISE P G Sbjct: 178 LGTGPDVPYPARHKKLHARIT-TDGAVISEYPPG 210 >gi|323484746|ref|ZP_08090105.1| DNA processing protein DprA [Clostridium symbiosum WAL-14163] gi|323691814|ref|ZP_08106071.1| smf family protein [Clostridium symbiosum WAL-14673] gi|323401983|gb|EGA94322.1| DNA processing protein DprA [Clostridium symbiosum WAL-14163] gi|323504180|gb|EGB19985.1| smf family protein [Clostridium symbiosum WAL-14673] Length = 390 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN +L I + GG ISE G Sbjct: 199 LGSGVDNCYPRENLSLYNAILETGG-VISEYGPG 231 >gi|109896357|ref|YP_659612.1| DNA protecting protein DprA [Pseudoalteromonas atlantica T6c] gi|109698638|gb|ABG38558.1| DNA protecting protein DprA [Pseudoalteromonas atlantica T6c] Length = 379 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + + + I + GG +SE Sbjct: 184 LGTGLNNIYPKRHVKMADSILEQGGALVSEF 214 >gi|145638193|ref|ZP_01793803.1| 2-isopropylmalate synthase [Haemophilus influenzae PittII] gi|145272522|gb|EDK12429.1| 2-isopropylmalate synthase [Haemophilus influenzae PittII] gi|309751349|gb|ADO81333.1| DNA processing chain A [Haemophilus influenzae R2866] Length = 373 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|304440375|ref|ZP_07400264.1| DNA processing protein DprA [Peptoniphilus duerdenii ATCC BAA-1640] gi|304371127|gb|EFM24744.1| DNA processing protein DprA [Peptoniphilus duerdenii ATCC BAA-1640] Length = 362 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D YP +NR + EE+ + G+ +SE P Sbjct: 172 LGTGVDICYPSKNRKIYEEVRE-KGLIVSEFPP 203 >gi|253573510|ref|ZP_04850853.1| DNA protecting protein DprA [Paenibacillus sp. oral taxon 786 str. D14] gi|251847038|gb|EES75043.1| DNA protecting protein DprA [Paenibacillus sp. oral taxon 786 str. D14] Length = 373 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + +D YPPE+ ++ I + G+ ISE P G Sbjct: 182 LGTAIDVAYPPEHVSMYRRIAEQ-GLVISEYPIG 214 >gi|71905661|ref|YP_283248.1| SMF protein [Dechloromonas aromatica RCB] gi|71845282|gb|AAZ44778.1| DNA protecting protein DprA [Dechloromonas aromatica RCB] Length = 358 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP N+ L I ++ G +SE P G Sbjct: 172 IGTGPDRIYPARNKELALAIVES-GAIVSEFPLG 204 >gi|84393443|ref|ZP_00992200.1| Smf protein [Vibrio splendidus 12B01] gi|84375959|gb|EAP92849.1| Smf protein [Vibrio splendidus 12B01] Length = 370 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP +RNL + I +N G ISE Sbjct: 172 LGSGLDSIYPARHRNLADRICEN-GALISEF 201 >gi|302380488|ref|ZP_07268953.1| DNA protecting protein DprA [Finegoldia magna ACS-171-V-Col3] gi|302311431|gb|EFK93447.1| DNA protecting protein DprA [Finegoldia magna ACS-171-V-Col3] Length = 290 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIW-DNGGIAISEIPFG 34 + G+D +YP N + +E+ + G+ +SE PFG Sbjct: 101 LGCGIDQVYPQSNYRVFQEMISSHNGVIMSEYPFG 135 >gi|169824494|ref|YP_001692105.1| putative Smf protein DNA processing subunit A [Finegoldia magna ATCC 29328] gi|303233675|ref|ZP_07320329.1| DNA protecting protein DprA [Finegoldia magna BVS033A4] gi|167831299|dbj|BAG08215.1| putative Smf protein DNA processing subunit A [Finegoldia magna ATCC 29328] gi|302495109|gb|EFL54861.1| DNA protecting protein DprA [Finegoldia magna BVS033A4] Length = 356 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIW-DNGGIAISEIPFG 34 + G+D +YP N + +E+ + G+ +SE PFG Sbjct: 167 LGCGIDQVYPQSNYRVFQEMISSHNGVIMSEYPFG 201 >gi|145630078|ref|ZP_01785860.1| hypothetical protein CGSHi22421_08503 [Haemophilus influenzae R3021] gi|260581936|ref|ZP_05849732.1| smf protein [Haemophilus influenzae NT127] gi|144984359|gb|EDJ91782.1| hypothetical protein CGSHi22421_08503 [Haemophilus influenzae R3021] gi|260095129|gb|EEW79021.1| smf protein [Haemophilus influenzae NT127] Length = 373 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|90423747|ref|YP_532117.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisB18] gi|90105761|gb|ABD87798.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisB18] Length = 372 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YPPE+ LL I GG AISE+P G Sbjct: 175 LAGGHDKIYPPEHDELLAAILGEGGAAISEMPLG 208 >gi|226313080|ref|YP_002772974.1| smf protein [Brevibacillus brevis NBRC 100599] gi|226096028|dbj|BAH44470.1| putative smf protein [Brevibacillus brevis NBRC 100599] Length = 356 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+ +YP +R L +I ++ G+ +SE P Sbjct: 160 LGCGMKHVYPSRHRELYRQI-ESFGLLLSEYPP 191 >gi|330831508|ref|YP_004394460.1| DNA processing chain A [Aeromonas veronii B565] gi|328806644|gb|AEB51843.1| DNA processing chain A [Aeromonas veronii B565] Length = 371 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLDCLYP ++ L +I + GG+ ISE+ Sbjct: 174 LGSGLDCLYPKRHQGLAGQILEKGGLLISELAP 206 >gi|254507278|ref|ZP_05119414.1| Smf protein [Vibrio parahaemolyticus 16] gi|219549738|gb|EED26727.1| Smf protein [Vibrio parahaemolyticus 16] Length = 373 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP +R L E I G ISE Sbjct: 172 LGSGLDSVYPARHRQLAERIC-QSGALISEF 201 >gi|153954039|ref|YP_001394804.1| Smf protein [Clostridium kluyveri DSM 555] gi|219854652|ref|YP_002471774.1| hypothetical protein CKR_1309 [Clostridium kluyveri NBRC 12016] gi|146346920|gb|EDK33456.1| Predicted Smf protein [Clostridium kluyveri DSM 555] gi|219568376|dbj|BAH06360.1| hypothetical protein [Clostridium kluyveri NBRC 12016] Length = 366 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP +N+ L E+I G +SE Sbjct: 172 LGSGVDVIYPSKNKKLYEDIL-QKGCVLSEF 201 >gi|148826367|ref|YP_001291120.1| 2-isopropylmalate synthase [Haemophilus influenzae PittEE] gi|229846043|ref|ZP_04466155.1| 2-isopropylmalate synthase [Haemophilus influenzae 7P49H1] gi|148716527|gb|ABQ98737.1| 2-isopropylmalate synthase [Haemophilus influenzae PittEE] gi|229811047|gb|EEP46764.1| 2-isopropylmalate synthase [Haemophilus influenzae 7P49H1] Length = 373 Score = 56.5 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|16272923|ref|NP_439148.1| DNA processing chain A [Haemophilus influenzae Rd KW20] gi|260580076|ref|ZP_05847906.1| smf protein [Haemophilus influenzae RdAW] gi|1169419|sp|P43862|SMF_HAEIN RecName: Full=Protein smf; AltName: Full=DNA-processing chain A gi|609332|gb|AAA70111.1| DprA [Haemophilus influenzae] gi|1574014|gb|AAC22646.1| DNA processing chain A (dprA) [Haemophilus influenzae Rd KW20] gi|260093360|gb|EEW77293.1| smf protein [Haemophilus influenzae RdAW] Length = 373 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|160902764|ref|YP_001568345.1| DNA protecting protein DprA [Petrotoga mobilis SJ95] gi|160360408|gb|ABX32022.1| DNA protecting protein DprA [Petrotoga mobilis SJ95] Length = 330 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N +L +I + G+ ISE G Sbjct: 143 LGNGIDIIYPKSNESLYNKIKEE-GLIISEYFPG 175 >gi|319775081|ref|YP_004137569.1| Protein Smf [Haemophilus influenzae F3047] gi|317449672|emb|CBY85878.1| Protein Smf [Haemophilus influenzae F3047] Length = 373 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|116251502|ref|YP_767340.1| smf protein [Rhizobium leguminosarum bv. viciae 3841] gi|115256150|emb|CAK07231.1| putative smf protein [Rhizobium leguminosarum bv. viciae 3841] Length = 380 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 22/34 (64%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN LLEEI G+A+SE+PFG Sbjct: 178 LAGGLDQPYPPENIGLLEEITGGNGLAVSEMPFG 211 >gi|329913549|ref|ZP_08275974.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Oxalobacteraceae bacterium IMCC9480] gi|327545313|gb|EGF30555.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Oxalobacteraceae bacterium IMCC9480] Length = 339 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP NR L I G +SE G Sbjct: 150 IGTGIDIVYPARNRALAARI-AKDGCVVSEYALG 182 >gi|229520219|ref|ZP_04409646.1| hypothetical protein VIF_000734 [Vibrio cholerae TM 11079-80] gi|229342813|gb|EEO07804.1| hypothetical protein VIF_000734 [Vibrio cholerae TM 11079-80] Length = 319 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLAQVYPKQHQGLAERIIAQ-GALVSEFAP 203 >gi|71276451|ref|ZP_00652727.1| SMF protein [Xylella fastidiosa Dixon] gi|71901276|ref|ZP_00683375.1| SMF protein [Xylella fastidiosa Ann-1] gi|170731002|ref|YP_001776435.1| DNA processing chain A [Xylella fastidiosa M12] gi|71162767|gb|EAO12493.1| SMF protein [Xylella fastidiosa Dixon] gi|71728967|gb|EAO31099.1| SMF protein [Xylella fastidiosa Ann-1] gi|167965795|gb|ACA12805.1| DNA processing chain A [Xylella fastidiosa M12] Length = 381 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP ++ L I G ISE P G Sbjct: 178 LGTGPDVPYPARHKKLHARIT-TDGAVISEYPPG 210 >gi|71898891|ref|ZP_00681058.1| SMF protein [Xylella fastidiosa Ann-1] gi|71731303|gb|EAO33367.1| SMF protein [Xylella fastidiosa Ann-1] Length = 381 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP ++ L I G ISE P G Sbjct: 178 LGTGPDVPYPARHKKLHARIT-TDGAVISEYPPG 210 >gi|186474805|ref|YP_001856275.1| DNA protecting protein DprA [Burkholderia phymatum STM815] gi|184191264|gb|ACC69229.1| DNA protecting protein DprA [Burkholderia phymatum STM815] Length = 389 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L +I N G +SE P G Sbjct: 180 IGTGADIVYPASHHALAHQI-ANHGAILSEWPLG 212 >gi|145632370|ref|ZP_01788105.1| hypothetical protein CGSHi3655_07944 [Haemophilus influenzae 3655] gi|144987277|gb|EDJ93807.1| hypothetical protein CGSHi3655_07944 [Haemophilus influenzae 3655] Length = 373 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|72161075|ref|YP_288732.1| SMF protein [Thermobifida fusca YX] gi|71914807|gb|AAZ54709.1| SMF protein [Thermobifida fusca YX] Length = 394 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L E+ N G+ +SE P G Sbjct: 192 LACGVDLAYPKGHEQLFAEVV-NHGVVVSEYPPG 224 >gi|330500989|ref|YP_004377858.1| DNA protecting protein DprA [Pseudomonas mendocina NK-01] gi|328915275|gb|AEB56106.1| DNA protecting protein DprA [Pseudomonas mendocina NK-01] Length = 372 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL CLYP + L I + GG +SE+P Sbjct: 183 LGTGLQCLYPRRHVGLAARIIEQGGALVSELPL 215 >gi|301169710|emb|CBW29311.1| conserved protein [Haemophilus influenzae 10810] Length = 373 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|298370610|ref|ZP_06981925.1| smf protein [Neisseria sp. oral taxon 014 str. F0314] gi|298281220|gb|EFI22710.1| smf protein [Neisseria sp. oral taxon 014 str. F0314] Length = 393 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N++L EI + G+ +SE P Sbjct: 178 GTGIDRIYPPSNKSLAYEIAE-KGLIVSEFPL 208 >gi|240170585|ref|ZP_04749244.1| hypothetical protein MkanA1_14825 [Mycobacterium kansasii ATCC 12478] Length = 388 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + +LL I ++ G+ I+E P G Sbjct: 183 LAGGIDVPYPAGHSSLLHRIGEH-GLLITEYPPG 215 >gi|148828160|ref|YP_001292913.1| hypothetical protein CGSHiGG_08500 [Haemophilus influenzae PittGG] gi|148719402|gb|ABR00530.1| hypothetical protein CGSHiGG_08500 [Haemophilus influenzae PittGG] Length = 373 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|309973515|gb|ADO96716.1| DNA processing chain A [Haemophilus influenzae R2846] Length = 373 Score = 56.1 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|170724410|ref|YP_001758436.1| DNA protecting protein DprA [Shewanella woodyi ATCC 51908] gi|169809757|gb|ACA84341.1| DNA protecting protein DprA [Shewanella woodyi ATCC 51908] Length = 331 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +R + E+I + G +SE G Sbjct: 135 LGTGVDVIYPKRHRKIYEDIQAH-GAIVSEFWPG 167 >gi|158522455|ref|YP_001530325.1| DNA protecting protein DprA [Desulfococcus oleovorans Hxd3] gi|158511281|gb|ABW68248.1| DNA protecting protein DprA [Desulfococcus oleovorans Hxd3] Length = 389 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YPPEN L I G ISE P Sbjct: 171 LGSGLCRIYPPENMELARRIAGQ-GAVISEFPL 202 >gi|114799220|ref|YP_760845.1| DNA protecting protein DprA [Hyphomonas neptunium ATCC 15444] gi|114739394|gb|ABI77519.1| DNA protecting protein DprA [Hyphomonas neptunium ATCC 15444] Length = 371 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG+D +YPP++ L E G+ +SE+PFG Sbjct: 172 LGGGIDHVYPPKHDRLYAE-VAQQGLIVSEMPFG 204 >gi|323496962|ref|ZP_08101990.1| Smf protein [Vibrio sinaloensis DSM 21326] gi|323318036|gb|EGA71019.1| Smf protein [Vibrio sinaloensis DSM 21326] Length = 373 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +R L E I + G +SE Sbjct: 172 LGSGLNSIYPARHRQLAERIIAS-GALVSEF 201 >gi|323516244|gb|ADX90625.1| Rossmann fold nucleotide-binding protein [Acinetobacter baumannii TCDC-AB0715] Length = 383 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 187 GTGLDTTYPAQNKKLAEHILAKNGAIITEFLPG 219 >gi|229843956|ref|ZP_04464097.1| hypothetical protein CGSHi6P18H1_05941 [Haemophilus influenzae 6P18H1] gi|229812950|gb|EEP48638.1| hypothetical protein CGSHi6P18H1_05941 [Haemophilus influenzae 6P18H1] Length = 373 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|260589066|ref|ZP_05854979.1| DNA protecting protein DprA [Blautia hansenii DSM 20583] gi|260540486|gb|EEX21055.1| DNA protecting protein DprA [Blautia hansenii DSM 20583] Length = 291 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D YP +N+ L EEI GG +SE Sbjct: 100 LGCGVDICYPKQNQRLYEEIIKKGG-VLSEF 129 >gi|241204123|ref|YP_002975219.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240858013|gb|ACS55680.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 380 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 22/34 (64%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN LLEEI G+A+SE+PFG Sbjct: 178 LAGGLDQPYPPENIGLLEEITGGNGLAVSEMPFG 211 >gi|331082496|ref|ZP_08331621.1| hypothetical protein HMPREF0992_00545 [Lachnospiraceae bacterium 6_1_63FAA] gi|330400474|gb|EGG80104.1| hypothetical protein HMPREF0992_00545 [Lachnospiraceae bacterium 6_1_63FAA] Length = 291 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D YP +N+ L EEI GG +SE Sbjct: 100 LGCGVDICYPKQNQRLYEEIIKKGG-VLSEF 129 >gi|319897503|ref|YP_004135700.1| DNA processing chain a (dpra) [Haemophilus influenzae F3031] gi|329123008|ref|ZP_08251579.1| DNA-processing protein Smf [Haemophilus aegyptius ATCC 11116] gi|317433009|emb|CBY81380.1| DNA processing chain A (dprA) [Haemophilus influenzae F3031] gi|327471939|gb|EGF17379.1| DNA-processing protein Smf [Haemophilus aegyptius ATCC 11116] Length = 373 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|302036384|ref|YP_003796706.1| protein SMF, putative DNA protecting protein DprA [Candidatus Nitrospira defluvii] gi|300604448|emb|CBK40780.1| Protein SMF, putative DNA protecting protein DprA [Candidatus Nitrospira defluvii] Length = 378 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD YP ++R L E I + G +SE+P G Sbjct: 176 MGCGLDRTYPADHRQLRETI-EQHGAVLSELPLG 208 >gi|212703031|ref|ZP_03311159.1| hypothetical protein DESPIG_01069 [Desulfovibrio piger ATCC 29098] gi|212673619|gb|EEB34102.1| hypothetical protein DESPIG_01069 [Desulfovibrio piger ATCC 29098] Length = 432 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP N L + + G+ +SE G Sbjct: 189 LGTGIDVPYPRANIRLYDRMAA-KGLLVSEFAPG 221 >gi|119509167|ref|ZP_01628318.1| SMF protein [Nodularia spumigena CCY9414] gi|119466333|gb|EAW47219.1| SMF protein [Nodularia spumigena CCY9414] Length = 372 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YPP+NR+L ++I G+ +SE Sbjct: 177 LGTGVDVIYPPKNRDLYKQIL-TQGLVVSEY 206 >gi|167771636|ref|ZP_02443689.1| hypothetical protein ANACOL_03008 [Anaerotruncus colihominis DSM 17241] gi|167666276|gb|EDS10406.1| hypothetical protein ANACOL_03008 [Anaerotruncus colihominis DSM 17241] Length = 415 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD YP + L I D GG ++E PFG Sbjct: 172 LACGLDVDYPSASGELKRRILDAGGALVTEFPFG 205 >gi|117926935|ref|YP_867552.1| DNA protecting protein DprA [Magnetococcus sp. MC-1] gi|117610691|gb|ABK46146.1| DNA protecting protein DprA [Magnetococcus sp. MC-1] Length = 365 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N L +I G +SE P G Sbjct: 163 LGCGLDVSYPKPNMQLKAQII-RQGCLVSEYPPG 195 >gi|145634161|ref|ZP_01789872.1| hypothetical protein CGSHiAA_08955 [Haemophilus influenzae PittAA] gi|145268605|gb|EDK08598.1| hypothetical protein CGSHiAA_08955 [Haemophilus influenzae PittAA] Length = 373 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|145640655|ref|ZP_01796238.1| DNA processing chain A [Haemophilus influenzae R3021] gi|145274581|gb|EDK14444.1| DNA processing chain A [Haemophilus influenzae 22.4-21] Length = 285 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 82 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 112 >gi|68249570|ref|YP_248682.1| hypothetical protein NTHI1157 [Haemophilus influenzae 86-028NP] gi|68057769|gb|AAX88022.1| Smf [Haemophilus influenzae 86-028NP] Length = 373 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 200 >gi|260459178|ref|ZP_05807433.1| DNA protecting protein DprA [Mesorhizobium opportunistum WSM2075] gi|259034732|gb|EEW35988.1| DNA protecting protein DprA [Mesorhizobium opportunistum WSM2075] Length = 383 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L +EI + G ISE+PFG Sbjct: 182 LAGGLDLPYPPENAGLCDEIAER-GAVISEMPFG 214 >gi|145637289|ref|ZP_01792950.1| DNA processing chain A [Haemophilus influenzae PittHH] gi|145269541|gb|EDK09483.1| DNA processing chain A [Haemophilus influenzae PittHH] Length = 286 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 83 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 113 >gi|281355863|ref|ZP_06242357.1| DNA protecting protein DprA [Victivallis vadensis ATCC BAA-548] gi|281318743|gb|EFB02763.1| DNA protecting protein DprA [Victivallis vadensis ATCC BAA-548] Length = 380 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GGL ++P EN L I + GG ISE P Sbjct: 172 LGGGLMRIHPQENVPLARRIVETGGAVISEFPM 204 >gi|160896284|ref|YP_001561866.1| DNA protecting protein DprA [Delftia acidovorans SPH-1] gi|160361868|gb|ABX33481.1| DNA protecting protein DprA [Delftia acidovorans SPH-1] Length = 405 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L E + G+ +SE P G Sbjct: 205 GTGLDQVYPRRHIGLARE-VASHGLIVSEYPLG 236 >gi|209524259|ref|ZP_03272809.1| DNA protecting protein DprA [Arthrospira maxima CS-328] gi|209495350|gb|EDZ95655.1| DNA protecting protein DprA [Arthrospira maxima CS-328] Length = 376 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP ENR L E++ G+ ISE P G Sbjct: 177 LGTGVDIAYPKENRPLCEQVL-QQGLLISEFPSG 209 >gi|206558866|ref|YP_002229626.1| SMF family protein [Burkholderia cenocepacia J2315] gi|198034903|emb|CAR50775.1| SMF family protein [Burkholderia cenocepacia J2315] Length = 437 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP +R L EI + G +SE P G Sbjct: 195 IATGADLVYPARHRALAHEIAAH-GAIVSEWPLG 227 >gi|184156508|ref|YP_001844847.1| Rossmann fold nucleotide-binding protein [Acinetobacter baumannii ACICU] gi|183208102|gb|ACC55500.1| predicted Rossmann fold nucleotide-binding protein [Acinetobacter baumannii ACICU] Length = 376 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 180 GTGLDTTYPAQNKKLAEHILAKNGAIITEFLPG 212 >gi|78067948|ref|YP_370717.1| SMF protein [Burkholderia sp. 383] gi|77968693|gb|ABB10073.1| DNA protecting protein DprA [Burkholderia sp. 383] Length = 448 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP +R L EI + G +SE P G Sbjct: 195 IATGADLVYPARHRALAHEIAAH-GAIVSEWPLG 227 >gi|323705454|ref|ZP_08117029.1| DNA protecting protein DprA [Thermoanaerobacterium xylanolyticum LX-11] gi|323535356|gb|EGB25132.1| DNA protecting protein DprA [Thermoanaerobacterium xylanolyticum LX-11] Length = 362 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ YP EN+ L+EEI + G +SE P Sbjct: 171 LGCGVNIAYPEENKKLMEEII-SKGAVVSEYPL 202 >gi|218674768|ref|ZP_03524437.1| DNA processing chain A protein [Rhizobium etli GR56] Length = 380 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 178 LAGGLDKPYPPENHGLIEEIAGGNGLAVSEMPFG 211 >gi|88657722|ref|YP_507678.1| putative DNA processing protein DprA [Ehrlichia chaffeensis str. Arkansas] gi|88599179|gb|ABD44648.1| putative DNA processing protein DprA [Ehrlichia chaffeensis str. Arkansas] Length = 375 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 22/33 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MA G++ +YP EN +L I D GG+ I+E PF Sbjct: 174 MASGVNIVYPQENIHLYNTIVDKGGLIITEFPF 206 >gi|326793338|ref|YP_004311158.1| DNA protecting protein DprA [Marinomonas mediterranea MMB-1] gi|326544102|gb|ADZ89322.1| DNA protecting protein DprA [Marinomonas mediterranea MMB-1] Length = 442 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M GL LYP +N L +I + GG+ +SE P Sbjct: 206 MGTGLLNLYPKQNIGLFTKIVEQGGVLVSEYPL 238 >gi|218133650|ref|ZP_03462454.1| hypothetical protein BACPEC_01519 [Bacteroides pectinophilus ATCC 43243] gi|217991025|gb|EEC57031.1| hypothetical protein BACPEC_01519 [Bacteroides pectinophilus ATCC 43243] Length = 303 Score = 56.1 bits (136), Expect = 2e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP N L + +GG +SE P G Sbjct: 177 LGSGVDVCYPRSNIGLYADTMIHGG-ILSEYPPG 209 >gi|325281443|ref|YP_004253985.1| DNA protecting protein DprA [Odoribacter splanchnicus DSM 20712] gi|324313252|gb|ADY33805.1| DNA protecting protein DprA [Odoribacter splanchnicus DSM 20712] Length = 383 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + GL +YP ++++ +I + GG ISE P Sbjct: 190 LGHGLHMIYPATHKSMARQILETGGAWISEFP 221 >gi|319424443|gb|ADV52517.1| DNA protecting protein DprA [Shewanella putrefaciens 200] Length = 362 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP +R L E I G +SE Sbjct: 166 LGTGIDIVYPRRHRQLYENI-QQQGCILSEF 195 >gi|254501021|ref|ZP_05113172.1| DNA protecting protein DprA, putative [Labrenzia alexandrii DFL-11] gi|222437092|gb|EEE43771.1| DNA protecting protein DprA, putative [Labrenzia alexandrii DFL-11] Length = 378 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 18/33 (54%), Positives = 22/33 (66%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYP ++ LL I GG ISE+PFG Sbjct: 177 AGGIDVLYPSDHDRLLAAILQTGGAVISEMPFG 209 >gi|199599535|ref|ZP_03212923.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus rhamnosus HN001] gi|258508405|ref|YP_003171156.1| DNA processing SMF protein [Lactobacillus rhamnosus GG] gi|199589576|gb|EDY97694.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus rhamnosus HN001] gi|257148332|emb|CAR87305.1| DNA processing SMF protein [Lactobacillus rhamnosus GG] gi|259649720|dbj|BAI41882.1| putative DNA processing protein [Lactobacillus rhamnosus GG] Length = 271 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +YP +NR+L +I G+ +SE P G Sbjct: 152 IANGIDQVYPAKNRSLQRQI-SRVGLVVSEYPPG 184 >gi|170017088|ref|YP_001728007.1| Rossmann fold nucleotide-binding protein involved in DNA uptake [Leuconostoc citreum KM20] gi|169803945|gb|ACA82563.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Leuconostoc citreum KM20] Length = 289 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP + L ++I N G+ ISE P G Sbjct: 168 IGTGLDVVYPNRHAALQKQI-ANSGLLISEYPAG 200 >gi|312115161|ref|YP_004012757.1| DNA protecting protein DprA [Rhodomicrobium vannielii ATCC 17100] gi|311220290|gb|ADP71658.1| DNA protecting protein DprA [Rhodomicrobium vannielii ATCC 17100] Length = 487 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GGLD +YPPE+ L +I G+ I E P G Sbjct: 269 LPGGLDRIYPPEHLGLAADI-AQNGLLIGECPPG 301 >gi|7466919|pir||A65121 smf protein - Escherichia coli (strain K-12) gi|606220|gb|AAA58083.1| different end due to fs difference [Escherichia coli str. K-12 substr. MG1655] Length = 253 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|15640080|ref|NP_229707.1| smf protein [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121587264|ref|ZP_01677037.1| Smf/DprA family protein [Vibrio cholerae 2740-80] gi|121727882|ref|ZP_01680941.1| Smf/DprA family protein [Vibrio cholerae V52] gi|147675247|ref|YP_001218364.1| Smf/DprA family protein [Vibrio cholerae O395] gi|153817608|ref|ZP_01970275.1| Smf/DprA family protein [Vibrio cholerae NCTC 8457] gi|153821944|ref|ZP_01974611.1| Smf/DprA family protein [Vibrio cholerae B33] gi|229508333|ref|ZP_04397837.1| hypothetical protein VCF_003568 [Vibrio cholerae BX 330286] gi|229508828|ref|ZP_04398319.1| hypothetical protein VCE_000233 [Vibrio cholerae B33] gi|229517099|ref|ZP_04406545.1| hypothetical protein VCC_001120 [Vibrio cholerae RC9] gi|229606608|ref|YP_002877256.1| hypothetical protein VCD_001517 [Vibrio cholerae MJ-1236] gi|254851613|ref|ZP_05240963.1| smf/DprA family protein [Vibrio cholerae MO10] gi|255746770|ref|ZP_05420716.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio cholera CIRS 101] gi|262155851|ref|ZP_06028973.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio cholerae INDRE 91/1] gi|262166894|ref|ZP_06034615.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio cholerae RC27] gi|9654442|gb|AAF93226.1| smf protein [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121548510|gb|EAX58566.1| Smf/DprA family protein [Vibrio cholerae 2740-80] gi|121629826|gb|EAX62241.1| Smf/DprA family protein [Vibrio cholerae V52] gi|126511876|gb|EAZ74470.1| Smf/DprA family protein [Vibrio cholerae NCTC 8457] gi|126520564|gb|EAZ77787.1| Smf/DprA family protein [Vibrio cholerae B33] gi|146317130|gb|ABQ21669.1| Smf/DprA family protein [Vibrio cholerae O395] gi|227011949|gb|ACP08159.1| smf protein [Vibrio cholerae O395] gi|229346162|gb|EEO11134.1| hypothetical protein VCC_001120 [Vibrio cholerae RC9] gi|229354103|gb|EEO19035.1| hypothetical protein VCE_000233 [Vibrio cholerae B33] gi|229354606|gb|EEO19528.1| hypothetical protein VCF_003568 [Vibrio cholerae BX 330286] gi|229369263|gb|ACQ59686.1| hypothetical protein VCD_001517 [Vibrio cholerae MJ-1236] gi|254847318|gb|EET25732.1| smf/DprA family protein [Vibrio cholerae MO10] gi|255735527|gb|EET90926.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio cholera CIRS 101] gi|262024665|gb|EEY43345.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio cholerae RC27] gi|262030303|gb|EEY48945.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio cholerae INDRE 91/1] Length = 371 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLAQVYPKQHQGLAERIIAQ-GALVSEFAP 203 >gi|229552205|ref|ZP_04440930.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus rhamnosus LMS2-1] gi|229314427|gb|EEN80400.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus rhamnosus LMS2-1] Length = 271 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +YP +NR+L +I G+ +SE P G Sbjct: 152 IANGIDQVYPAKNRSLQRQI-SRVGLVVSEYPPG 184 >gi|225418683|ref|ZP_03761872.1| hypothetical protein CLOSTASPAR_05907 [Clostridium asparagiforme DSM 15981] gi|225041786|gb|EEG52032.1| hypothetical protein CLOSTASPAR_05907 [Clostridium asparagiforme DSM 15981] Length = 371 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G++ YP +N L E + G ISE P G Sbjct: 178 LGCGVNICYPKQNYPLFRE-LEKQGGLISEYPPG 210 >gi|289423506|ref|ZP_06425307.1| DNA protecting protein DprA [Peptostreptococcus anaerobius 653-L] gi|289156008|gb|EFD04672.1| DNA protecting protein DprA [Peptostreptococcus anaerobius 653-L] Length = 423 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 20/31 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + +D +YP +NR L +EI + GG+ +SE Sbjct: 190 LGTPIDQVYPKKNRKLRDEILEKGGLILSEY 220 >gi|260775016|ref|ZP_05883916.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio coralliilyticus ATCC BAA-450] gi|260609106|gb|EEX35265.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio coralliilyticus ATCC BAA-450] Length = 371 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP ++ L + I G +SE Sbjct: 172 LGCGLNSVYPARHKKLAQRIV-QQGALVSEF 201 >gi|145628078|ref|ZP_01783879.1| 2-isopropylmalate synthase [Haemophilus influenzae 22.1-21] gi|144979853|gb|EDJ89512.1| 2-isopropylmalate synthase [Haemophilus influenzae 22.1-21] Length = 259 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++ L +I +N G +SE Sbjct: 56 LGSGLEQIYPSKHQRLSAQIIENNGALVSEF 86 >gi|317488107|ref|ZP_07946684.1| DNA protecting protein DprA [Eggerthella sp. 1_3_56FAA] gi|316912815|gb|EFV34347.1| DNA protecting protein DprA [Eggerthella sp. 1_3_56FAA] Length = 227 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 18/30 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GG D LYP E+ L + I D GG +SE Sbjct: 24 LGGGCDRLYPAEHEGLFQRIVDGGGAVVSE 53 >gi|300865695|ref|ZP_07110461.1| DNA processing protein [Oscillatoria sp. PCC 6506] gi|300336291|emb|CBN55611.1| DNA processing protein [Oscillatoria sp. PCC 6506] Length = 369 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N+ L E + + G+AISE P G Sbjct: 159 GTGVDIVYPAANKKLAERVLEQ-GLAISEYPAG 190 >gi|258539619|ref|YP_003174118.1| DNA processing SMF protein [Lactobacillus rhamnosus Lc 705] gi|257151295|emb|CAR90267.1| DNA processing SMF protein [Lactobacillus rhamnosus Lc 705] Length = 271 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +YP +NR+L +I G+ +SE P G Sbjct: 152 IANGIDQVYPAKNRSLQRQI-SRVGLVVSEYPPG 184 >gi|119896389|ref|YP_931602.1| putative DNA processing protein DrpA [Azoarcus sp. BH72] gi|119668802|emb|CAL92715.1| putative DNA processing protein DrpA [Azoarcus sp. BH72] Length = 372 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP N L +I G +SE P G Sbjct: 175 IGTGPDRIYPASNAELARQI-AQAGAILSEFPLG 207 >gi|120596859|ref|YP_961433.1| DNA protecting protein DprA [Shewanella sp. W3-18-1] gi|146291137|ref|YP_001181561.1| DNA protecting protein DprA [Shewanella putrefaciens CN-32] gi|120556952|gb|ABM22879.1| DNA protecting protein DprA [Shewanella sp. W3-18-1] gi|145562827|gb|ABP73762.1| DNA protecting protein DprA [Shewanella putrefaciens CN-32] Length = 340 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP +R L E I G +SE Sbjct: 144 LGTGIDIVYPRRHRQLYENI-QQQGCILSEF 173 >gi|302392405|ref|YP_003828225.1| DNA protecting protein DprA [Acetohalobium arabaticum DSM 5501] gi|302204482|gb|ADL13160.1| DNA protecting protein DprA [Acetohalobium arabaticum DSM 5501] Length = 367 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPEN L+ EI + G IS P G Sbjct: 171 LGSGIDVIYPPENDELVTEI-EESGAVISSFPLG 203 >gi|294671201|ref|ZP_06736055.1| hypothetical protein NEIELOOT_02909 [Neisseria elongata subsp. glycolytica ATCC 29315] gi|291307139|gb|EFE48382.1| hypothetical protein NEIELOOT_02909 [Neisseria elongata subsp. glycolytica ATCC 29315] Length = 405 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L E G +SE P G Sbjct: 177 GTGIDRIYPSSNRELAYE-LGEKGAIVSEFPLG 208 >gi|238754206|ref|ZP_04615564.1| hypothetical protein yruck0001_28090 [Yersinia ruckeri ATCC 29473] gi|238707702|gb|EEQ00062.1| hypothetical protein yruck0001_28090 [Yersinia ruckeri ATCC 29473] Length = 373 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 16/31 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP + L +EI GG +SE Sbjct: 167 LGSGLANIYPKRHGRLAQEIVAEGGALVSEF 197 >gi|227080285|ref|YP_002808836.1| smf protein [Vibrio cholerae M66-2] gi|298501231|ref|ZP_07011030.1| smf/DprA family protein [Vibrio cholerae MAK 757] gi|227008173|gb|ACP04385.1| smf protein [Vibrio cholerae M66-2] gi|297540103|gb|EFH76165.1| smf/DprA family protein [Vibrio cholerae MAK 757] Length = 371 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLAQVYPKQHQGLAERIIAQ-GALVSEFAP 203 >gi|156740191|ref|YP_001430320.1| DNA protecting protein DprA [Roseiflexus castenholzii DSM 13941] gi|156231519|gb|ABU56302.1| DNA protecting protein DprA [Roseiflexus castenholzii DSM 13941] Length = 360 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L I N G ISE P G Sbjct: 171 LPCGADMVYPERHAALARRIAGN-GALISEFPLG 203 >gi|153810947|ref|ZP_01963615.1| hypothetical protein RUMOBE_01337 [Ruminococcus obeum ATCC 29174] gi|149832835|gb|EDM87918.1| hypothetical protein RUMOBE_01337 [Ruminococcus obeum ATCC 29174] Length = 302 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP NR L + I +SE P G Sbjct: 111 LGNGVDICYPSGNRALYQRILREKCGILSEQPTG 144 >gi|300933910|ref|ZP_07149166.1| putative DNA processing protein [Corynebacterium resistens DSM 45100] Length = 400 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD YP +N L ++I + G+ +SE G Sbjct: 200 LACGLDVNYPIKNAQLFQQIT-HNGVLVSEYAPG 232 >gi|153212925|ref|ZP_01948519.1| Smf/DprA family protein [Vibrio cholerae 1587] gi|124116151|gb|EAY34971.1| Smf/DprA family protein [Vibrio cholerae 1587] Length = 371 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLAQVYPKQHQGLAERIIAQ-GALVSEFAP 203 >gi|297581918|ref|ZP_06943838.1| smf/DprA family protein [Vibrio cholerae RC385] gi|297533785|gb|EFH72626.1| smf/DprA family protein [Vibrio cholerae RC385] Length = 371 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLAQVYPKQHQGLAERIIAQ-GALVSEFAP 203 >gi|317131315|ref|YP_004090629.1| DNA protecting protein DprA [Ethanoligenens harbinense YUAN-3] gi|315469294|gb|ADU25898.1| DNA protecting protein DprA [Ethanoligenens harbinense YUAN-3] Length = 387 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP NR L + G +SE P Sbjct: 171 LGCGLDTVYPASNRELY-RLVAKTGAVLSEFPP 202 >gi|323179178|gb|EFZ64752.1| DNA protecting protein DprA [Escherichia coli 1180] Length = 229 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 165 LGNGLNTIHPRRHARLAASLLEHGGALVSEFPL 197 >gi|221633577|ref|YP_002522803.1| putative smf protein [Thermomicrobium roseum DSM 5159] gi|221155496|gb|ACM04623.1| probable smf protein [Thermomicrobium roseum DSM 5159] Length = 367 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YPPE+R L + I + G ++E Sbjct: 171 LGTGIDVVYPPEHRALAQRIAEQ-GALVTEF 200 >gi|310816234|ref|YP_003964198.1| DNA processing protein DprA, putative [Ketogulonicigenium vulgare Y25] gi|308754969|gb|ADO42898.1| DNA processing protein DprA, putative [Ketogulonicigenium vulgare Y25] Length = 358 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN L EI G+ +SE+P G Sbjct: 164 LGTGIDRSYPNENTALAREIAAQ-GLLLSELPPG 196 >gi|116621518|ref|YP_823674.1| DNA protecting protein DprA [Candidatus Solibacter usitatus Ellin6076] gi|116224680|gb|ABJ83389.1| DNA protecting protein DprA [Candidatus Solibacter usitatus Ellin6076] Length = 391 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP ENR L + G+ ++E P G Sbjct: 178 LGCGVDVVYPMENRKLAAD-LAVKGLIVAEFPMG 210 >gi|116691146|ref|YP_836769.1| DNA protecting protein DprA [Burkholderia cenocepacia HI2424] gi|116649235|gb|ABK09876.1| DNA protecting protein DprA [Burkholderia cenocepacia HI2424] Length = 475 Score = 55.7 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP +R L EI + G +SE P G Sbjct: 233 IATGADLVYPARHRALAHEIAAH-GAIVSEWPLG 265 >gi|153826433|ref|ZP_01979100.1| Smf/DprA family protein [Vibrio cholerae MZO-2] gi|149739819|gb|EDM54014.1| Smf/DprA family protein [Vibrio cholerae MZO-2] Length = 371 Score = 55.3 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLAQVYPKQHQGLAERIIAQ-GALVSEFAP 203 >gi|312879572|ref|ZP_07739372.1| DNA protecting protein DprA [Aminomonas paucivorans DSM 12260] gi|310782863|gb|EFQ23261.1| DNA protecting protein DprA [Aminomonas paucivorans DSM 12260] Length = 378 Score = 55.3 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D ++P +R L E I G +SE P G Sbjct: 175 LGTGVDRVFPSGHRELFERIRGR-GCLVSEYPLG 207 >gi|229515913|ref|ZP_04405370.1| hypothetical protein VCB_003571 [Vibrio cholerae TMA 21] gi|229347013|gb|EEO11975.1| hypothetical protein VCB_003571 [Vibrio cholerae TMA 21] Length = 371 Score = 55.3 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLAQVYPKQHQGLAERIIAQ-GALVSEFAP 203 >gi|114462408|gb|ABI75144.1| SMF protein [Anabaena circinalis AWQC131C] Length = 310 Score = 55.3 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 M G+D +YP +NR+L ++I + GI ISE P Sbjct: 115 MGTGVDVIYPHKNRDLYQQILKS-GIVISEYP 145 >gi|153802768|ref|ZP_01957354.1| Smf/DprA family protein [Vibrio cholerae MZO-3] gi|124121681|gb|EAY40424.1| Smf/DprA family protein [Vibrio cholerae MZO-3] Length = 371 Score = 55.3 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLAQVYPKQHQGLAERIIAQ-GALVSEFAP 203 >gi|119503588|ref|ZP_01625671.1| SMF protein [marine gamma proteobacterium HTCC2080] gi|119460650|gb|EAW41742.1| SMF protein [marine gamma proteobacterium HTCC2080] Length = 380 Score = 55.3 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MA G+D +YP E+ L EE+ G +SE G Sbjct: 177 MATGMDRIYPSEHYRLAEEVAAQ-GALLSEFCPG 209 >gi|89071023|ref|ZP_01158240.1| DNA processing protein DprA, putative [Oceanicola granulosus HTCC2516] gi|89043411|gb|EAR49628.1| DNA processing protein DprA, putative [Oceanicola granulosus HTCC2516] Length = 356 Score = 55.3 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPPEN L +I G+ +SE G Sbjct: 153 LAGGIDVIYPPENAGLARDIAAQ-GVLLSEQRPG 185 >gi|240140065|ref|YP_002964542.1| DNA protecting protein DprA [Methylobacterium extorquens AM1] gi|240010039|gb|ACS41265.1| DNA protecting protein DprA [Methylobacterium extorquens AM1] Length = 397 Score = 55.3 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP + L+EEI GG ++E+P G Sbjct: 166 LAGGQDRIYPENHAGLVEEIVGAGGAVVAEMPMG 199 >gi|114321777|ref|YP_743460.1| DNA protecting protein DprA [Alkalilimnicola ehrlichii MLHE-1] gi|114228171|gb|ABI57970.1| DNA protecting protein DprA [Alkalilimnicola ehrlichii MLHE-1] Length = 379 Score = 55.3 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G D +YP NR L + G ++E+P G Sbjct: 175 MGTGPDRIYPARNRALAHRVAAE-GALVTELPPG 207 >gi|114763467|ref|ZP_01442874.1| DNA processing protein DprA, putative [Pelagibaca bermudensis HTCC2601] gi|114544005|gb|EAU47016.1| DNA processing protein DprA, putative [Roseovarius sp. HTCC2601] Length = 375 Score = 55.3 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D LYP EN L EEI GG +SE G Sbjct: 153 MAGGVDILYPSENTRLGEEIRARGGALVSEHAMG 186 >gi|326799926|ref|YP_004317745.1| DNA protecting protein DprA [Sphingobacterium sp. 21] gi|326550690|gb|ADZ79075.1| DNA protecting protein DprA [Sphingobacterium sp. 21] Length = 364 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP NR L ++ NGG+ +E P G Sbjct: 171 LGHGLDRIYPAINRTLATDMLKNGGLL-TEYPSG 203 >gi|150388066|ref|YP_001318115.1| DNA protecting protein DprA [Alkaliphilus metalliredigens QYMF] gi|149947928|gb|ABR46456.1| DNA protecting protein DprA [Alkaliphilus metalliredigens QYMF] Length = 378 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D YP E+ L+ I ++ G +S+ P Sbjct: 167 LGSGVDICYPKEHDELMARIMES-GAVLSQYPP 198 >gi|222085614|ref|YP_002544144.1| DNA protecting protein DprA [Agrobacterium radiobacter K84] gi|221723062|gb|ACM26218.1| DNA protecting protein DprA [Agrobacterium radiobacter K84] Length = 383 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 24/34 (70%), Positives = 27/34 (79%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGGLD YPPEN LL EIWD G+A+SE+PFG Sbjct: 178 MAGGLDQPYPPENVGLLNEIWDGNGLAVSEMPFG 211 >gi|262191291|ref|ZP_06049485.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio cholerae CT 5369-93] gi|262032829|gb|EEY51373.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio cholerae CT 5369-93] Length = 371 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLAQVYPKQHQGLAERIIAQ-GALVSEFAP 203 >gi|50083491|ref|YP_045001.1| putative Rossmann-fold nucleotide-binding protein [Acinetobacter sp. ADP1] gi|49529467|emb|CAG67179.1| putative Rossmann-fold nucleotide-binding protein involved in DNA uptake (Smf) [Acinetobacter sp. ADP1] Length = 383 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 17/33 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP N+ L + I D GG +SE G Sbjct: 180 GTGLDLCYPSGNKALKQHIRDQGGAIVSEFLPG 212 >gi|226324651|ref|ZP_03800169.1| hypothetical protein COPCOM_02436 [Coprococcus comes ATCC 27758] gi|225207099|gb|EEG89453.1| hypothetical protein COPCOM_02436 [Coprococcus comes ATCC 27758] Length = 365 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG D YP ++ L +++ GG +SE P G Sbjct: 171 LGGGADVCYPAAHKGLYKDLIKRGG-ILSEQPPG 203 >gi|254246862|ref|ZP_04940183.1| SMF protein [Burkholderia cenocepacia PC184] gi|124871638|gb|EAY63354.1| SMF protein [Burkholderia cenocepacia PC184] Length = 475 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP +R L EI + G +SE P G Sbjct: 233 IATGADLVYPARHRALAHEIAAH-GAIVSEWPLG 265 >gi|118590183|ref|ZP_01547586.1| hypothetical protein SIAM614_11733 [Stappia aggregata IAM 12614] gi|118437155|gb|EAV43793.1| hypothetical protein SIAM614_11733 [Stappia aggregata IAM 12614] Length = 378 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 23/33 (69%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG++ LYPPE+ LL + + GG ISE+P G Sbjct: 177 AGGINVLYPPEHDRLLAAVLETGGAVISEMPLG 209 >gi|114707187|ref|ZP_01440085.1| DNA processing chain A [Fulvimarina pelagi HTCC2506] gi|114537383|gb|EAU40509.1| DNA processing chain A [Fulvimarina pelagi HTCC2506] Length = 377 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 21/33 (63%), Positives = 23/33 (69%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGLD YPPENR+L+ I D GG IS PFG Sbjct: 177 AGGLDMPYPPENRSLMRRIVDEGGCLISARPFG 209 >gi|328462260|gb|EGF34367.1| DNA processing SMF protein [Lactobacillus rhamnosus MTCC 5462] Length = 190 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +YP +NR+L +I G+ +SE P G Sbjct: 148 IANGIDQVYPAKNRSLQRQI-SRVGLVVSEYPPG 180 >gi|254511723|ref|ZP_05123790.1| DNA protecting protein DprA [Rhodobacteraceae bacterium KLH11] gi|221535434|gb|EEE38422.1| DNA protecting protein DprA [Rhodobacteraceae bacterium KLH11] Length = 351 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YP EN +L +I + G+ +SE P G Sbjct: 153 MAGGVDVIYPAENTDLARDIAKS-GLRLSEQPMG 185 >gi|254415891|ref|ZP_05029648.1| DNA protecting protein DprA, putative [Microcoleus chthonoplastes PCC 7420] gi|196177318|gb|EDX72325.1| DNA protecting protein DprA, putative [Microcoleus chthonoplastes PCC 7420] Length = 374 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+ L E I D G+ +SE P G Sbjct: 178 GTGIDVIYPPRNKLLYETILDR-GLVLSEYPAG 209 >gi|187778969|ref|ZP_02995442.1| hypothetical protein CLOSPO_02564 [Clostridium sporogenes ATCC 15579] gi|187772594|gb|EDU36396.1| hypothetical protein CLOSPO_02564 [Clostridium sporogenes ATCC 15579] Length = 361 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +N+ + +I + G ISE G Sbjct: 172 LGSGIDVVYPKQNKKIY-DIISDDGCVISEFLPG 204 >gi|153830116|ref|ZP_01982783.1| Smf/DprA family protein [Vibrio cholerae 623-39] gi|229530166|ref|ZP_04419555.1| hypothetical protein VCG_003277 [Vibrio cholerae 12129(1)] gi|254225572|ref|ZP_04919181.1| Smf/DprA family protein [Vibrio cholerae V51] gi|254291091|ref|ZP_04961888.1| Smf/DprA family protein [Vibrio cholerae AM-19226] gi|125621892|gb|EAZ50217.1| Smf/DprA family protein [Vibrio cholerae V51] gi|148874380|gb|EDL72515.1| Smf/DprA family protein [Vibrio cholerae 623-39] gi|150422936|gb|EDN14886.1| Smf/DprA family protein [Vibrio cholerae AM-19226] gi|229332299|gb|EEN97786.1| hypothetical protein VCG_003277 [Vibrio cholerae 12129(1)] gi|327482959|gb|AEA77366.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio cholerae LMA3894-4] Length = 371 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLAQVYPKQHQGLAERIMAQ-GALVSEFAP 203 >gi|296104993|ref|YP_003615139.1| DNA protecting protein DprA [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|295059452|gb|ADF64190.1| DNA protecting protein DprA [Enterobacter cloacae subsp. cloacae ATCC 13047] Length = 379 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ++ L + ++ G +SE P Sbjct: 172 LGNGLFSIYPRRHQALAARLIESEGAIVSEFPL 204 >gi|184200719|ref|YP_001854926.1| putative DNA processing protein [Kocuria rhizophila DC2201] gi|183580949|dbj|BAG29420.1| putative DNA processing protein [Kocuria rhizophila DC2201] Length = 442 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP N LLE I G+ +SE+P G Sbjct: 232 LACGVDRAYPAANAELLERI-RQRGLVLSEVPLG 264 >gi|291454421|ref|ZP_06593811.1| DNA processing Smf-family protein [Streptomyces albus J1074] gi|291357370|gb|EFE84272.1| DNA processing Smf-family protein [Streptomyces albus J1074] Length = 402 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+ I + G+ +SE+P G Sbjct: 185 LACGVDSPYPRGHAQLITRIAEQ-GLVVSELPPG 217 >gi|13470875|ref|NP_102444.1| DNA processing chain A [Mesorhizobium loti MAFF303099] gi|14021618|dbj|BAB48230.1| DNA processing chain A [Mesorhizobium loti MAFF303099] Length = 377 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L EI + G ISE+PFG Sbjct: 175 LAGGLDLPYPPENAGLCAEIAER-GAVISEMPFG 207 >gi|302389647|ref|YP_003825468.1| DNA protecting protein DprA [Thermosediminibacter oceani DSM 16646] gi|302200275|gb|ADL07845.1| DNA protecting protein DprA [Thermosediminibacter oceani DSM 16646] Length = 359 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPEN NL+ EI G IS P G Sbjct: 172 LGCGIDIVYPPENYNLMAEIIKA-GCVISSFPMG 204 >gi|93007287|ref|YP_581724.1| DNA processing protein DprA, putative [Psychrobacter cryohalolentis K5] gi|92394965|gb|ABE76240.1| DNA processing protein DprA, putative [Psychrobacter cryohalolentis K5] Length = 407 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 M G+D YP + L +I + GG ISE+ Sbjct: 186 MGTGIDVNYPNHHDRLFSQIIEQGGCIISEL 216 >gi|163852730|ref|YP_001640773.1| DNA protecting protein DprA [Methylobacterium extorquens PA1] gi|163664335|gb|ABY31702.1| DNA protecting protein DprA [Methylobacterium extorquens PA1] Length = 397 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP + L+EEI GG ++E+P G Sbjct: 166 LAGGQDRIYPENHAGLVEEIVGAGGAVVAEMPMG 199 >gi|116333444|ref|YP_794971.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus brevis ATCC 367] gi|116098791|gb|ABJ63940.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus brevis ATCC 367] Length = 296 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP NR+L+ E + + ISE P+G Sbjct: 175 IGTGLDHCYPAGNRDLMTE-LAHHHLVISEYPWG 207 >gi|323131763|gb|ADX19193.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] Length = 391 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 184 LGNGLAKIYPRRHAMLAENLIATGGAVVSEFPL 216 >gi|171319439|ref|ZP_02908544.1| DNA protecting protein DprA [Burkholderia ambifaria MEX-5] gi|171095331|gb|EDT40312.1| DNA protecting protein DprA [Burkholderia ambifaria MEX-5] Length = 425 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP +R L EI G +SE P G Sbjct: 180 IATGADLVYPARHRTLAHEIAAR-GAIVSEWPLG 212 >gi|256828287|ref|YP_003157015.1| DNA protecting protein DprA [Desulfomicrobium baculatum DSM 4028] gi|256577463|gb|ACU88599.1| DNA protecting protein DprA [Desulfomicrobium baculatum DSM 4028] Length = 367 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP N +L +++ + G+ +SE G Sbjct: 171 LGTGLDLVYPASNTDLWKQVAAH-GLIVSEFAPG 203 >gi|167585075|ref|ZP_02377463.1| DNA protecting protein DprA [Burkholderia ubonensis Bu] Length = 327 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP +R L EI + G +SE P G Sbjct: 121 IGTGADLVYPARHRALAHEIAAH-GAIVSEWPLG 153 >gi|333024159|ref|ZP_08452223.1| putative DNA processing Smf-family protein [Streptomyces sp. Tu6071] gi|332744011|gb|EGJ74452.1| putative DNA processing Smf-family protein [Streptomyces sp. Tu6071] Length = 371 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YPP + LL I + G+ + E+P G Sbjct: 163 LACGIDRAYPPGHARLLARIAEQ-GLLLGELPPG 195 >gi|282856249|ref|ZP_06265532.1| DNA protecting protein DprA [Pyramidobacter piscolens W5455] gi|282586008|gb|EFB91293.1| DNA protecting protein DprA [Pyramidobacter piscolens W5455] Length = 355 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D ++PPE+ L + I G +SE P G Sbjct: 167 LGTGVDVVWPPEHDELFDNIL-RRGALLSEYPLG 199 >gi|239982579|ref|ZP_04705103.1| DNA processing Smf-family protein [Streptomyces albus J1074] Length = 417 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+ I + G+ +SE+P G Sbjct: 200 LACGVDSPYPRGHAQLITRIAEQ-GLVVSELPPG 232 >gi|170734477|ref|YP_001766424.1| DNA protecting protein DprA [Burkholderia cenocepacia MC0-3] gi|169817719|gb|ACA92302.1| DNA protecting protein DprA [Burkholderia cenocepacia MC0-3] Length = 422 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP +R L EI + G +SE P G Sbjct: 180 IATGADLVYPARHRALAHEIAAH-GAIVSEWPLG 212 >gi|218531570|ref|YP_002422386.1| DNA protecting protein DprA [Methylobacterium chloromethanicum CM4] gi|218523873|gb|ACK84458.1| DNA protecting protein DprA [Methylobacterium chloromethanicum CM4] Length = 397 Score = 55.3 bits (134), Expect = 3e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP + L+EEI GG ++E+P G Sbjct: 166 LAGGQDRIYPENHAGLVEEIVGAGGAVVAEMPMG 199 >gi|318075686|ref|ZP_07983018.1| DNA mediated transformation protein [Streptomyces sp. SA3_actF] Length = 212 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YPP + LL I + G+ + E+P G Sbjct: 4 LACGIDRAYPPGHARLLARIAEQ-GLLLGELPPG 36 >gi|318056577|ref|ZP_07975300.1| DNA processing Smf-family protein [Streptomyces sp. SA3_actG] Length = 395 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YPP + LL I + G+ + E+P G Sbjct: 187 LACGIDRAYPPGHARLLARIAEQ-GLLLGELPPG 219 >gi|302522170|ref|ZP_07274512.1| DNA processing Smf-family protein [Streptomyces sp. SPB78] gi|302431065|gb|EFL02881.1| DNA processing Smf-family protein [Streptomyces sp. SPB78] Length = 395 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YPP + LL I + G+ + E+P G Sbjct: 187 LACGIDRAYPPGHARLLARIAEQ-GLLLGELPPG 219 >gi|227486583|ref|ZP_03916899.1| SMF family DNA processing protein [Anaerococcus lactolyticus ATCC 51172] gi|227235401|gb|EEI85416.1| SMF family DNA processing protein [Anaerococcus lactolyticus ATCC 51172] Length = 363 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D +YP N+ L E+I + G+ +SE P Sbjct: 172 IGCGIDQVYPTANKFLYEKI-EEDGLILSEFPL 203 >gi|256025987|ref|ZP_05439852.1| DNA protecting protein DprA [Escherichia sp. 4_1_40B] gi|301643895|ref|ZP_07243925.1| DNA protecting protein DprA [Escherichia coli MS 146-1] gi|307139968|ref|ZP_07499324.1| DNA protecting protein DprA [Escherichia coli H736] gi|331643981|ref|ZP_08345110.1| protein smf [Escherichia coli H736] gi|301077738|gb|EFK92544.1| DNA protecting protein DprA [Escherichia coli MS 146-1] gi|315617088|gb|EFU97698.1| DNA protecting protein DprA [Escherichia coli 3431] gi|331036275|gb|EGI08501.1| protein smf [Escherichia coli H736] Length = 374 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|119716495|ref|YP_923460.1| DNA protecting protein DprA [Nocardioides sp. JS614] gi|119537156|gb|ABL81773.1| DNA protecting protein DprA [Nocardioides sp. JS614] Length = 349 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG+D YP + LLE I + G+ +SE P G Sbjct: 187 LPGGVDRPYPAAHAQLLEAIAER-GLVVSEAPPG 219 >gi|302382941|ref|YP_003818764.1| DNA protecting protein DprA [Brevundimonas subvibrioides ATCC 15264] gi|302193569|gb|ADL01141.1| DNA protecting protein DprA [Brevundimonas subvibrioides ATCC 15264] Length = 360 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG+D +YPP+N +L ++I G +SE P G Sbjct: 167 LGGGVDDVYPPDNASLYDQI-AQQGCIVSESPMG 199 >gi|255319593|ref|ZP_05360805.1| DNA protecting protein DprA [Acinetobacter radioresistens SK82] gi|262380779|ref|ZP_06073932.1| DNA protecting protein DprA [Acinetobacter radioresistens SH164] gi|255303348|gb|EET82553.1| DNA protecting protein DprA [Acinetobacter radioresistens SK82] gi|262297727|gb|EEY85643.1| DNA protecting protein DprA [Acinetobacter radioresistens SH164] Length = 376 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 18/33 (54%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR L E+I GG +SE G Sbjct: 180 GTGLDLVYPAHNRKLQEQILQYGGTIVSEFLPG 212 >gi|209364274|ref|YP_001425403.2| DNA processing protein [Coxiella burnetii Dugway 5J108-111] gi|207082207|gb|ABS77073.2| DNA processing protein [Coxiella burnetii Dugway 5J108-111] Length = 308 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E+I G +SE P Sbjct: 123 LGSGLTNIYPRRHHRLAEQI-SQKGALVSEFPL 154 >gi|300903534|ref|ZP_07121456.1| DNA protecting protein DprA [Escherichia coli MS 84-1] gi|301305495|ref|ZP_07211587.1| DNA protecting protein DprA [Escherichia coli MS 124-1] gi|300404407|gb|EFJ87945.1| DNA protecting protein DprA [Escherichia coli MS 84-1] gi|300839190|gb|EFK66950.1| DNA protecting protein DprA [Escherichia coli MS 124-1] gi|315255869|gb|EFU35837.1| DNA protecting protein DprA [Escherichia coli MS 85-1] Length = 374 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEHGGALVSEFPL 199 >gi|218888767|ref|YP_002437631.1| putative Rossmann fold nucleotide-binding protein [Pseudomonas aeruginosa LESB58] gi|218768990|emb|CAW24748.1| putative Rossmann fold nucleotide-binding protein [Pseudomonas aeruginosa LESB58] Length = 362 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L I + GG +SE+P Sbjct: 176 LGTGLRRLYPRRHEALARRIVEGGGALVSELPL 208 >gi|74313804|ref|YP_312223.1| DNA protecting protein DprA [Shigella sonnei Ss046] gi|73857281|gb|AAZ89988.1| Predicted Rossmann-fold nucleotide-binding protein [Shigella sonnei Ss046] gi|323164850|gb|EFZ50641.1| DNA protecting protein DprA [Shigella sonnei 53G] Length = 374 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEHGGALVSEFPL 199 >gi|471305|emb|CAA54827.1| orf374 [Escherichia coli] Length = 374 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|116053741|ref|YP_788176.1| putative Rossmann fold nucleotide-binding protein [Pseudomonas aeruginosa UCBPP-PA14] gi|115588962|gb|ABJ14977.1| putative Rossmann fold nucleotide-binding protein [Pseudomonas aeruginosa UCBPP-PA14] Length = 362 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L I + GG +SE+P Sbjct: 176 LGTGLRRLYPRRHEALARRIVEGGGALVSELPL 208 >gi|49176336|ref|YP_026211.1| conserved protein [Escherichia coli str. K-12 substr. MG1655] gi|89110725|ref|AP_004505.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110] gi|157162759|ref|YP_001460077.1| DNA protecting protein DprA [Escherichia coli HS] gi|170018479|ref|YP_001723433.1| DNA protecting protein DprA [Escherichia coli ATCC 8739] gi|170082806|ref|YP_001732126.1| hypothetical protein ECDH10B_3460 [Escherichia coli str. K-12 substr. DH10B] gi|194440009|ref|ZP_03072067.1| DNA protecting protein DprA [Escherichia coli 101-1] gi|238902376|ref|YP_002928172.1| hypothetical protein BWG_2976 [Escherichia coli BW2952] gi|253771891|ref|YP_003034722.1| DNA protecting protein DprA [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254038446|ref|ZP_04872502.1| DNA protecting protein DprA [Escherichia sp. 1_1_43] gi|254163213|ref|YP_003046321.1| DNA protecting protein DprA [Escherichia coli B str. REL606] gi|297517903|ref|ZP_06936289.1| DNA protecting protein DprA [Escherichia coli OP50] gi|300932178|ref|ZP_07147458.1| DNA protecting protein DprA [Escherichia coli MS 187-1] gi|300946507|ref|ZP_07160773.1| DNA protecting protein DprA [Escherichia coli MS 116-1] gi|300955323|ref|ZP_07167705.1| DNA protecting protein DprA [Escherichia coli MS 175-1] gi|301021205|ref|ZP_07185239.1| DNA protecting protein DprA [Escherichia coli MS 196-1] gi|312972453|ref|ZP_07786627.1| DNA protecting protein DprA [Escherichia coli 1827-70] gi|401096|sp|P30852|SMF_ECOLI RecName: Full=Protein smf gi|49087|emb|CAA46763.1| smf [Escherichia coli K-12] gi|443988|emb|CAA54366.1| smf [Escherichia coli K-12] gi|48994932|gb|AAT48176.1| conserved protein [Escherichia coli str. K-12 substr. MG1655] gi|85676756|dbj|BAE78006.1| conserved hypothetical protein [Escherichia coli str. K12 substr. W3110] gi|157068439|gb|ABV07694.1| DNA protecting protein DprA [Escherichia coli HS] gi|169753407|gb|ACA76106.1| DNA protecting protein DprA [Escherichia coli ATCC 8739] gi|169890641|gb|ACB04348.1| conserved protein [Escherichia coli str. K-12 substr. DH10B] gi|194421061|gb|EDX37090.1| DNA protecting protein DprA [Escherichia coli 101-1] gi|226838952|gb|EEH70975.1| DNA protecting protein DprA [Escherichia sp. 1_1_43] gi|238860422|gb|ACR62420.1| conserved protein [Escherichia coli BW2952] gi|242378812|emb|CAQ33604.1| conserved protein [Escherichia coli BL21(DE3)] gi|253322935|gb|ACT27537.1| DNA protecting protein DprA [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|253975114|gb|ACT40785.1| hypothetical protein ECB_03136 [Escherichia coli B str. REL606] gi|253979270|gb|ACT44940.1| hypothetical protein ECD_03136 [Escherichia coli BL21(DE3)] gi|260447696|gb|ACX38118.1| DNA protecting protein DprA [Escherichia coli DH1] gi|299881613|gb|EFI89824.1| DNA protecting protein DprA [Escherichia coli MS 196-1] gi|300317767|gb|EFJ67551.1| DNA protecting protein DprA [Escherichia coli MS 175-1] gi|300453813|gb|EFK17433.1| DNA protecting protein DprA [Escherichia coli MS 116-1] gi|300460062|gb|EFK23555.1| DNA protecting protein DprA [Escherichia coli MS 187-1] gi|310334830|gb|EFQ01035.1| DNA protecting protein DprA [Escherichia coli 1827-70] gi|315137861|dbj|BAJ45020.1| DNA protecting protein DprA [Escherichia coli DH1] gi|323934516|gb|EGB30924.1| DNA protecting protein DprA [Escherichia coli E1520] gi|323939293|gb|EGB35505.1| DNA protecting protein DprA [Escherichia coli E482] gi|323959564|gb|EGB55217.1| DNA protecting protein DprA [Escherichia coli H489] gi|323970089|gb|EGB65363.1| DNA protecting protein DprA [Escherichia coli TA007] gi|332345233|gb|AEE58567.1| DNA protecting protein DprA [Escherichia coli UMNK88] Length = 374 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|294631663|ref|ZP_06710223.1| smf family protein [Streptomyces sp. e14] gi|292834996|gb|EFF93345.1| smf family protein [Streptomyces sp. e14] Length = 376 Score = 55.0 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L++ I + G+ + E+P G Sbjct: 171 LACGVDRPYPRGHAALIDRIAEQ-GLVVGELPPG 203 >gi|124265474|ref|YP_001019478.1| putative SMF protein [Methylibium petroleiphilum PM1] gi|124258249|gb|ABM93243.1| putative SMF protein [Methylibium petroleiphilum PM1] Length = 365 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L I G+ +SE G Sbjct: 177 GTGLDRVYPKRHLKLAHRI-ARDGLMVSEYAPG 208 >gi|291520056|emb|CBK75277.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Butyrivibrio fibrisolvens 16/4] Length = 256 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP E+ L ++ G IS+ P G Sbjct: 175 GNGLDIYYPREHMELF-DMISQNGAVISQFPPG 206 >gi|148978495|ref|ZP_01814969.1| Smf protein [Vibrionales bacterium SWAT-3] gi|145962402|gb|EDK27682.1| Smf protein [Vibrionales bacterium SWAT-3] Length = 370 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP +RNL I ++ G ISE Sbjct: 172 LGSGLDSIYPARHRNLAARICES-GALISEF 201 >gi|86357273|ref|YP_469165.1| DNA processing chain A protein [Rhizobium etli CFN 42] gi|86281375|gb|ABC90438.1| probable DNA processing chain A protein [Rhizobium etli CFN 42] Length = 380 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 178 LAGGLDKPYPPENLGLIEEITGGNGLAVSEMPFG 211 >gi|15595219|ref|NP_248711.1| hypothetical protein PA0021 [Pseudomonas aeruginosa PAO1] gi|9945840|gb|AAG03411.1|AE004441_12 conserved hypothetical protein [Pseudomonas aeruginosa PAO1] Length = 362 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L I + GG +SE+P Sbjct: 176 LGTGLRRLYPRRHEALARRIVEGGGALVSELPL 208 >gi|320182717|gb|EFW57603.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Shigella boydii ATCC 9905] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|313901983|ref|ZP_07835399.1| DNA protecting protein DprA [Thermaerobacter subterraneus DSM 13965] gi|313467772|gb|EFR63270.1| DNA protecting protein DprA [Thermaerobacter subterraneus DSM 13965] Length = 304 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP E+R L ++ G +SE P G Sbjct: 172 LGHGPDRVYPEEHRPLAAQVAAR-GWLVSEYPPG 204 >gi|309703697|emb|CBJ03038.1| conserved hypothetical protein [Escherichia coli ETEC H10407] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|257055037|ref|YP_003132869.1| DNA protecting protein DprA [Saccharomonospora viridis DSM 43017] gi|256584909|gb|ACU96042.1| DNA protecting protein DprA [Saccharomonospora viridis DSM 43017] Length = 383 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP + LL G +SE P G Sbjct: 181 LGCGLDVGYPAGHVGLLNR-VARRGAVVSEYPPG 213 >gi|212219505|ref|YP_002306292.1| DNA processing protein [Coxiella burnetii CbuK_Q154] gi|212013767|gb|ACJ21147.1| DNA processing protein [Coxiella burnetii CbuK_Q154] Length = 308 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E+I G +SE P Sbjct: 123 LGSGLTNIYPRRHHRLAEQI-SQKGALVSEFPL 154 >gi|16762877|ref|NP_458494.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|29144364|ref|NP_807706.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|213161457|ref|ZP_03347167.1| hypothetical protein Salmoneentericaenterica_16122 [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] gi|213650878|ref|ZP_03380931.1| hypothetical protein SentesTy_28815 [Salmonella enterica subsp. enterica serovar Typhi str. J185] gi|289824190|ref|ZP_06543785.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Typhi str. E98-3139] gi|25346559|pir||AC1010 conserved hypothetical protein STY4392 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gi|16505184|emb|CAD09180.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] gi|29140002|gb|AAO71566.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAMLAENLIATGGAVVSEFPL 199 >gi|193071554|ref|ZP_03052463.1| DNA protecting protein DprA [Escherichia coli E110019] gi|192955142|gb|EDV85636.1| DNA protecting protein DprA [Escherichia coli E110019] gi|320199473|gb|EFW74063.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Escherichia coli EC4100B] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEHGGALVSEFPL 199 >gi|332998299|gb|EGK17900.1| DNA protecting protein DprA [Shigella flexneri VA-6] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L +++ GG +SE P Sbjct: 167 LGNGLNIIHPRRHARLAASLFEQGGALVSEFPL 199 >gi|194435063|ref|ZP_03067301.1| DNA protecting protein DprA [Shigella dysenteriae 1012] gi|194416670|gb|EDX32801.1| DNA protecting protein DprA [Shigella dysenteriae 1012] gi|332086255|gb|EGI91411.1| DNA protecting protein DprA [Shigella dysenteriae 155-74] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|107099014|ref|ZP_01362932.1| hypothetical protein PaerPA_01000022 [Pseudomonas aeruginosa PACS2] gi|254243133|ref|ZP_04936455.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] gi|126196511|gb|EAZ60574.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] Length = 362 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L I + GG +SE+P Sbjct: 176 LGTGLRRLYPRRHEALARRIVEGGGALVSELPL 208 >gi|254237737|ref|ZP_04931060.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] gi|126169668|gb|EAZ55179.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] Length = 362 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L I + GG +SE+P Sbjct: 176 LGTGLRRLYPRRHEALARRIVEGGGALVSELPL 208 >gi|320655924|gb|EFX23844.1| hypothetical protein ECO7815_20646 [Escherichia coli O55:H7 str. 3256-97 TW 07815] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|310778327|ref|YP_003966660.1| DNA protecting protein DprA [Ilyobacter polytropus DSM 2926] gi|309747650|gb|ADO82312.1| DNA protecting protein DprA [Ilyobacter polytropus DSM 2926] Length = 357 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN + E + + G ISE P G Sbjct: 168 GNGLDIVYPQENSKIWERM-EREGTIISEFPLG 199 >gi|289809873|ref|ZP_06540502.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Typhi str. AG3] Length = 248 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 41 LGNGLAKIYPRRHAMLAENLIATGGAVVSEFPL 73 >gi|291284644|ref|YP_003501462.1| hypothetical protein G2583_4004 [Escherichia coli O55:H7 str. CB9615] gi|209757374|gb|ACI76999.1| hypothetical protein ECs4151 [Escherichia coli] gi|290764517|gb|ADD58478.1| hypothetical protein G2583_4004 [Escherichia coli O55:H7 str. CB9615] gi|320661376|gb|EFX28791.1| hypothetical protein ECO5905_01202 [Escherichia coli O55:H7 str. USDA 5905] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|191169308|ref|ZP_03031057.1| DNA protecting protein DprA [Escherichia coli B7A] gi|218555843|ref|YP_002388756.1| DNA protecting protein DprA [Escherichia coli IAI1] gi|218696978|ref|YP_002404645.1| DNA protecting protein DprA [Escherichia coli 55989] gi|256020644|ref|ZP_05434509.1| DNA protecting protein DprA [Shigella sp. D9] gi|300822911|ref|ZP_07103047.1| DNA protecting protein DprA [Escherichia coli MS 119-7] gi|300918260|ref|ZP_07134864.1| DNA protecting protein DprA [Escherichia coli MS 115-1] gi|307315136|ref|ZP_07594719.1| DNA protecting protein DprA [Escherichia coli W] gi|309794561|ref|ZP_07688983.1| DNA protecting protein DprA [Escherichia coli MS 145-7] gi|331670115|ref|ZP_08370954.1| protein smf [Escherichia coli TA271] gi|331679354|ref|ZP_08380024.1| protein smf [Escherichia coli H591] gi|332281840|ref|ZP_08394253.1| DNA protecting protein DprA [Shigella sp. D9] gi|190900663|gb|EDV60463.1| DNA protecting protein DprA [Escherichia coli B7A] gi|218353710|emb|CAU99980.1| conserved hypothetical protein [Escherichia coli 55989] gi|218362611|emb|CAR00237.1| conserved hypothetical protein [Escherichia coli IAI1] gi|300414521|gb|EFJ97831.1| DNA protecting protein DprA [Escherichia coli MS 115-1] gi|300524677|gb|EFK45746.1| DNA protecting protein DprA [Escherichia coli MS 119-7] gi|306905485|gb|EFN36020.1| DNA protecting protein DprA [Escherichia coli W] gi|308121611|gb|EFO58873.1| DNA protecting protein DprA [Escherichia coli MS 145-7] gi|315062577|gb|ADT76904.1| DNA protecting protein DprA [Escherichia coli W] gi|323182764|gb|EFZ68165.1| DNA protecting protein DprA [Escherichia coli 1357] gi|323376836|gb|ADX49104.1| DNA protecting protein DprA [Escherichia coli KO11] gi|323944294|gb|EGB40370.1| DNA protecting protein DprA [Escherichia coli H120] gi|324017408|gb|EGB86627.1| DNA protecting protein DprA [Escherichia coli MS 117-3] gi|324116325|gb|EGC10245.1| DNA protecting protein DprA [Escherichia coli E1167] gi|331062177|gb|EGI34097.1| protein smf [Escherichia coli TA271] gi|331072526|gb|EGI43851.1| protein smf [Escherichia coli H591] gi|332104192|gb|EGJ07538.1| DNA protecting protein DprA [Shigella sp. D9] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEHGGALVSEFPL 199 >gi|157156735|ref|YP_001464753.1| DNA protecting protein DprA [Escherichia coli E24377A] gi|300921906|ref|ZP_07138061.1| DNA protecting protein DprA [Escherichia coli MS 182-1] gi|301325149|ref|ZP_07218681.1| DNA protecting protein DprA [Escherichia coli MS 78-1] gi|157078765|gb|ABV18473.1| DNA protecting protein DprA [Escherichia coli E24377A] gi|300421707|gb|EFK05018.1| DNA protecting protein DprA [Escherichia coli MS 182-1] gi|300847981|gb|EFK75741.1| DNA protecting protein DprA [Escherichia coli MS 78-1] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEHGGALVSEFPL 199 >gi|315924786|ref|ZP_07921003.1| DNA processing protein DprA [Pseudoramibacter alactolyticus ATCC 23263] gi|315621685|gb|EFV01649.1| DNA processing protein DprA [Pseudoramibacter alactolyticus ATCC 23263] Length = 369 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D YP NR L + + G+ +SE Sbjct: 175 LGTGIDRCYPASNRALYDRVAAE-GLLVSEY 204 >gi|260857406|ref|YP_003231297.1| hypothetical protein ECO26_4387 [Escherichia coli O26:H11 str. 11368] gi|257756055|dbj|BAI27557.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEHGGALVSEFPL 199 >gi|168234462|ref|ZP_02659520.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|194468594|ref|ZP_03074578.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194454958|gb|EDX43797.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|205331618|gb|EDZ18382.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAMLAENLIATGGAVVSEFPL 199 >gi|193066497|ref|ZP_03047541.1| DNA protecting protein DprA [Escherichia coli E22] gi|194430286|ref|ZP_03062781.1| DNA protecting protein DprA [Escherichia coli B171] gi|260846083|ref|YP_003223861.1| hypothetical protein ECO103_4017 [Escherichia coli O103:H2 str. 12009] gi|300815504|ref|ZP_07095729.1| DNA protecting protein DprA [Escherichia coli MS 107-1] gi|192925878|gb|EDV80528.1| DNA protecting protein DprA [Escherichia coli E22] gi|194411675|gb|EDX28002.1| DNA protecting protein DprA [Escherichia coli B171] gi|257761230|dbj|BAI32727.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009] gi|300532396|gb|EFK53458.1| DNA protecting protein DprA [Escherichia coli MS 107-1] gi|323162964|gb|EFZ48799.1| DNA protecting protein DprA [Escherichia coli E128010] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEHGGALVSEFPL 199 >gi|296386493|ref|ZP_06875992.1| putative Rossmann fold nucleotide-binding protein [Pseudomonas aeruginosa PAb1] Length = 258 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L I + GG +SE+P Sbjct: 176 LGTGLRRLYPRRHEALARRIVEGGGALVSELPL 208 >gi|197261825|ref|ZP_03161899.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|207858647|ref|YP_002245298.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|197240080|gb|EDY22700.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|206710450|emb|CAR34808.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAMLAENLIATGGAVVSEFPL 199 >gi|289450127|ref|YP_003475174.1| DNA protecting protein DprA [Clostridiales genomosp. BVAB3 str. UPII9-5] gi|289184674|gb|ADC91099.1| DNA protecting protein DprA [Clostridiales genomosp. BVAB3 str. UPII9-5] Length = 416 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP +NR + E IW + + +SE P G Sbjct: 218 LANGIDICYPRQNRPIYEAIWRSQ-VLVSEYPPG 250 >gi|15833405|ref|NP_312178.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. Sakai] gi|168786175|ref|ZP_02811182.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC869] gi|217325833|ref|ZP_03441917.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. TW14588] gi|261224590|ref|ZP_05938871.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. FRIK2000] gi|261254516|ref|ZP_05947049.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. FRIK966] gi|13363624|dbj|BAB37574.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] gi|189373826|gb|EDU92242.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC869] gi|209757368|gb|ACI76996.1| hypothetical protein ECs4151 [Escherichia coli] gi|209757370|gb|ACI76997.1| hypothetical protein ECs4151 [Escherichia coli] gi|217322054|gb|EEC30478.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. TW14588] gi|320639590|gb|EFX09184.1| hypothetical protein ECO5101_01180 [Escherichia coli O157:H7 str. G5101] gi|320645088|gb|EFX14104.1| hypothetical protein ECO9389_00924 [Escherichia coli O157:H- str. 493-89] gi|320650399|gb|EFX18865.1| hypothetical protein ECO2687_03814 [Escherichia coli O157:H- str. H 2687] gi|320666398|gb|EFX33381.1| hypothetical protein ECOSU61_15290 [Escherichia coli O157:H7 str. LSU-61] gi|326342534|gb|EGD66308.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Escherichia coli O157:H7 str. 1044] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|258405017|ref|YP_003197759.1| DNA protecting protein DprA [Desulfohalobium retbaense DSM 5692] gi|257797244|gb|ACV68181.1| DNA protecting protein DprA [Desulfohalobium retbaense DSM 5692] Length = 395 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD +YP L +E+ + G ISE G Sbjct: 183 MGTGLDIVYPARQHQLWQEVAAH-GCLISEFAPG 215 >gi|168752266|ref|ZP_02777288.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4113] gi|168758513|ref|ZP_02783520.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4401] gi|168769147|ref|ZP_02794154.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4486] gi|168777857|ref|ZP_02802864.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4196] gi|168783852|ref|ZP_02808859.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4076] gi|195939833|ref|ZP_03085215.1| hypothetical protein EscherichcoliO157_26116 [Escherichia coli O157:H7 str. EC4024] gi|208808566|ref|ZP_03250903.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4206] gi|208812997|ref|ZP_03254326.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4045] gi|208818340|ref|ZP_03258660.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4042] gi|209395952|ref|YP_002272742.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4115] gi|254795222|ref|YP_003080059.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. TW14359] gi|187766998|gb|EDU30842.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4196] gi|188013853|gb|EDU51975.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4113] gi|188998884|gb|EDU67870.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4076] gi|189354674|gb|EDU73093.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4401] gi|189361780|gb|EDU80199.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4486] gi|208728367|gb|EDZ77968.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4206] gi|208734274|gb|EDZ82961.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4045] gi|208738463|gb|EDZ86145.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4042] gi|209157352|gb|ACI34785.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4115] gi|209757372|gb|ACI76998.1| hypothetical protein ECs4151 [Escherichia coli] gi|209757376|gb|ACI77000.1| hypothetical protein ECs4151 [Escherichia coli] gi|254594622|gb|ACT73983.1| conserved protein [Escherichia coli O157:H7 str. TW14359] gi|326344521|gb|EGD68270.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Escherichia coli O157:H7 str. 1125] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|54310615|ref|YP_131635.1| putative Smf protein [Photobacterium profundum SS9] gi|46915058|emb|CAG21833.1| Hypothetical Smf protein [Photobacterium profundum SS9] Length = 365 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +R L +I + G +SE Sbjct: 170 LGSGLNHIYPASHRTLASQIIEQ-GALVSEF 199 >gi|150016069|ref|YP_001308323.1| DNA protecting protein DprA [Clostridium beijerinckii NCIMB 8052] gi|149902534|gb|ABR33367.1| DNA protecting protein DprA [Clostridium beijerinckii NCIMB 8052] Length = 351 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN+ L +I + G+ ISE G Sbjct: 167 LGCGIDRTYPSENKMLFSKIAE-KGVVISEFLLG 199 >gi|238792970|ref|ZP_04636600.1| DNA protecting protein DprA [Yersinia intermedia ATCC 29909] gi|238727824|gb|EEQ19348.1| DNA protecting protein DprA [Yersinia intermedia ATCC 29909] Length = 373 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +R+L +EI GG +SE Sbjct: 167 LGSGLENIYPRRHRHLAKEIEYQGGALVSEF 197 >gi|167554202|ref|ZP_02347943.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|205321543|gb|EDZ09382.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAMLAENLIATGGAVVSEFPL 199 >gi|16766694|ref|NP_462309.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|167995180|ref|ZP_02576270.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|168245232|ref|ZP_02670164.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|194443920|ref|YP_002042657.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194450294|ref|YP_002047430.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|197251290|ref|YP_002148326.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|16421961|gb|AAL22268.1| putative protein involved in DNA uptake [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|194402583|gb|ACF62805.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194408598|gb|ACF68817.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|197214993|gb|ACH52390.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|205327101|gb|EDZ13865.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|205336013|gb|EDZ22777.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|261248562|emb|CBG26400.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580] gi|267995614|gb|ACY90499.1| hypothetical protein STM14_4108 [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] gi|301159948|emb|CBW19467.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|312914428|dbj|BAJ38402.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240] gi|321226457|gb|EFX51507.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] gi|332990257|gb|AEF09240.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1] Length = 374 Score = 55.0 bits (133), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAMLAENLIATGGAVVSEFPL 199 >gi|323154123|gb|EFZ40326.1| DNA protecting protein DprA [Escherichia coli EPECa14] Length = 374 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEHGGALVSEFPL 199 >gi|294084185|ref|YP_003550943.1| DNA protecting protein DprA [Candidatus Puniceispirillum marinum IMCC1322] gi|292663758|gb|ADE38859.1| DNA protecting protein DprA [Candidatus Puniceispirillum marinum IMCC1322] Length = 367 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +YP EN +L + I + G+ ++E+P G Sbjct: 164 IASGIDLVYPQENADLFDSIIER-GLLLAEMPPG 196 >gi|213418739|ref|ZP_03351805.1| hypothetical protein Salmonentericaenterica_13129 [Salmonella enterica subsp. enterica serovar Typhi str. E01-6750] Length = 222 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAMLAENLIATGGAVVSEFPL 199 >gi|168468038|ref|ZP_02701875.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|195628896|gb|EDX48306.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Newport str. SL317] Length = 374 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAMLAENLIATGGAVVSEFPL 199 >gi|164685831|ref|ZP_01945729.2| DNA protecting protein DprA [Coxiella burnetii 'MSU Goat Q177'] gi|165918185|ref|ZP_02218271.1| DNA protecting protein DprA [Coxiella burnetii RSA 334] gi|164601347|gb|EAX33608.2| DNA protecting protein DprA [Coxiella burnetii 'MSU Goat Q177'] gi|165918045|gb|EDR36649.1| DNA protecting protein DprA [Coxiella burnetii RSA 334] Length = 296 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E+I G +SE P Sbjct: 111 LGSGLTNIYPRRHHRLAEQI-SQKGALVSEFPL 142 >gi|171464333|ref|YP_001798446.1| SMF family protein [Polynucleobacter necessarius subsp. necessarius STIR1] gi|171193871|gb|ACB44832.1| SMF family protein [Polynucleobacter necessarius subsp. necessarius STIR1] Length = 161 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +N +L + I G+ +SE+P G Sbjct: 39 LGTGVDLVYPRQNISLAQAI-GQQGLLVSELPLG 71 >gi|161616431|ref|YP_001590396.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|161365795|gb|ABX69563.1| hypothetical protein SPAB_04246 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] Length = 374 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAMLAENLIATGGAVVSEFPL 199 >gi|293453604|ref|ZP_06664023.1| DNA processing protein [Escherichia coli B088] gi|291321730|gb|EFE61161.1| DNA processing protein [Escherichia coli B088] Length = 367 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 160 LGNGLNTIHPRRHARLAASLLEHGGALVSEFPL 192 >gi|15803813|ref|NP_289847.1| DNA protecting protein DprA [Escherichia coli O157:H7 EDL933] gi|12517912|gb|AAG58407.1|AE005555_7 hypothetical protein Z4656 [Escherichia coli O157:H7 str. EDL933] Length = 374 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|332085432|gb|EGI90598.1| DNA protecting protein DprA [Shigella boydii 5216-82] Length = 364 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 157 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 189 >gi|306836382|ref|ZP_07469360.1| DNA protecting protein DprA [Corynebacterium accolens ATCC 49726] gi|304567742|gb|EFM43329.1| DNA protecting protein DprA [Corynebacterium accolens ATCC 49726] Length = 393 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D YP NR L ++I DN G +SE Sbjct: 193 ACGIDKNYPARNRGLFDQIADN-GCIVSEFAP 223 >gi|260431072|ref|ZP_05785043.1| DNA protecting protein DprA [Silicibacter lacuscaerulensis ITI-1157] gi|260414900|gb|EEX08159.1| DNA protecting protein DprA [Silicibacter lacuscaerulensis ITI-1157] Length = 378 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YP EN +L +I G+ +SE P G Sbjct: 180 MAGGVDIIYPAENADLARDISKR-GLRLSEQPMG 212 >gi|238028946|ref|YP_002913177.1| DNA processing protein DprA [Burkholderia glumae BGR1] gi|237878140|gb|ACR30473.1| DNA processing protein DprA, putative [Burkholderia glumae BGR1] Length = 445 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP + L E I G +SE P G Sbjct: 181 GTGVDRVYPAAHHLLAEAI-AQHGAVLSEWPLG 212 >gi|90413781|ref|ZP_01221769.1| Hypothetical Smf protein [Photobacterium profundum 3TCK] gi|90325250|gb|EAS41747.1| Hypothetical Smf protein [Photobacterium profundum 3TCK] Length = 364 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +R L +I + G +SE Sbjct: 169 LGSGLNHIYPASHRTLASQIIEQ-GALVSEF 198 >gi|258653287|ref|YP_003202443.1| DNA protecting protein DprA [Nakamurella multipartita DSM 44233] gi|258556512|gb|ACV79454.1| DNA protecting protein DprA [Nakamurella multipartita DSM 44233] Length = 423 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP NR+LL ++ G +SE P G Sbjct: 205 LACGIDRAYPEANRDLL-DLIARHGSVVSEYPPG 237 >gi|323173922|gb|EFZ59550.1| DNA protecting protein DprA [Escherichia coli LT-68] Length = 364 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 157 LGNGLNTIHPRRHARLAASLLEHGGALVSEFPL 189 >gi|218506638|ref|ZP_03504516.1| DNA processing chain A protein [Rhizobium etli Brasil 5] Length = 167 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 25/34 (73%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 39 LPGGLDRPYPPENLGLIEEIAGGNGLAVSEMPFG 72 >gi|209920751|ref|YP_002294835.1| DNA protecting protein DprA [Escherichia coli SE11] gi|209914010|dbj|BAG79084.1| conserved hypothetical protein [Escherichia coli SE11] Length = 374 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEHGGALVSEFPL 199 >gi|332875642|ref|ZP_08443454.1| DNA protecting protein DprA [Acinetobacter baumannii 6014059] gi|332736215|gb|EGJ67230.1| DNA protecting protein DprA [Acinetobacter baumannii 6014059] Length = 383 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 187 GTGLDTTYPAQNKKLAEYILAKNGAIITEFLPG 219 >gi|289434558|ref|YP_003464430.1| polypeptide deformylase Smf family protein [Listeria seeligeri serovar 1/2b str. SLCC3954] gi|289170802|emb|CBH27344.1| polypeptide deformylase Smf family protein [Listeria seeligeri serovar 1/2b str. SLCC3954] Length = 288 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D +YP +N L +EI G+ +SE Sbjct: 166 LGSGVDNIYPRKNIQLAKEII-QKGLLLSEYMP 197 >gi|218550561|ref|YP_002384352.1| DNA protecting protein DprA [Escherichia fergusonii ATCC 35469] gi|218358102|emb|CAQ90749.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469] gi|323966247|gb|EGB61682.1| DNA protecting protein DprA [Escherichia coli M863] gi|323974762|gb|EGB69875.1| DNA protecting protein DprA [Escherichia coli TW10509] gi|324111964|gb|EGC05943.1| DNA protecting protein DprA [Escherichia fergusonii B253] gi|327250934|gb|EGE62627.1| DNA protecting protein DprA [Escherichia coli STEC_7v] Length = 374 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLATSLLEHGGALVSEFPL 199 >gi|167834977|ref|ZP_02461860.1| DNA protecting protein DprA [Burkholderia thailandensis MSMB43] Length = 396 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 180 IGTGADIVYPACHHALAHEIAER-GALVSEWPLG 212 >gi|213855561|ref|ZP_03383801.1| hypothetical protein SentesT_16550 [Salmonella enterica subsp. enterica serovar Typhi str. M223] Length = 375 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAMLAENLIATGGAVVSEFPL 199 >gi|213618842|ref|ZP_03372668.1| hypothetical protein SentesTyp_21205 [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068] Length = 205 Score = 54.6 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAMLAENLIATGGAVVSEFPL 199 >gi|284051638|ref|ZP_06381848.1| DNA protecting protein DprA [Arthrospira platensis str. Paraca] Length = 377 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP +NR L E++ G+ ISE P G Sbjct: 177 LGTGVDIAYPKQNRPLCEQVLKQ-GLLISEFPSG 209 >gi|161831372|ref|YP_001595979.1| DNA protecting protein DprA [Coxiella burnetii RSA 331] gi|161763239|gb|ABX78881.1| DNA protecting protein DprA [Coxiella burnetii RSA 331] Length = 296 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E+I G +SE P Sbjct: 111 LGSGLTNIYPRRHHRLAEQI-SQKGALVSEFPL 142 >gi|325272508|ref|ZP_08138886.1| DNA protecting protein DprA [Pseudomonas sp. TJI-51] gi|324102369|gb|EGB99837.1| DNA protecting protein DprA [Pseudomonas sp. TJI-51] Length = 285 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L + I D+GG +SE P Sbjct: 101 LGTGLQKLYPQRHTALAQAIIDSGGALVSEYPL 133 >gi|218245511|ref|YP_002370882.1| DNA protecting protein DprA [Cyanothece sp. PCC 8801] gi|218165989|gb|ACK64726.1| DNA protecting protein DprA [Cyanothece sp. PCC 8801] Length = 375 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +R L I G+ +SE P G Sbjct: 177 LGTGVDMVYPSNHRQLHRNI-QQQGLILSEYPAG 209 >gi|172062106|ref|YP_001809758.1| DNA protecting protein DprA [Burkholderia ambifaria MC40-6] gi|171994623|gb|ACB65542.1| DNA protecting protein DprA [Burkholderia ambifaria MC40-6] Length = 422 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP +R L EI G +SE P G Sbjct: 180 IATGADLVYPARHRTLAHEIAAR-GALVSEWPLG 212 >gi|117621477|ref|YP_854788.1| DNA protecting protein DprA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] gi|117562884|gb|ABK39832.1| DNA protecting protein DprA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] Length = 371 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLDCLYP ++ L EI GG+ ISE+ Sbjct: 174 LGSGLDCLYPKRHQGLAMEILVRGGLLISELAP 206 >gi|170697717|ref|ZP_02888804.1| DNA protecting protein DprA [Burkholderia ambifaria IOP40-10] gi|170137332|gb|EDT05573.1| DNA protecting protein DprA [Burkholderia ambifaria IOP40-10] Length = 422 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP +R L EI G +SE P G Sbjct: 180 IATGADLVYPARHRALAHEIAAR-GAIVSEWPLG 212 >gi|126434555|ref|YP_001070246.1| DNA protecting protein DprA [Mycobacterium sp. JLS] gi|126234355|gb|ABN97755.1| DNA protecting protein DprA [Mycobacterium sp. JLS] Length = 376 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D YP + LL I N G+ +SE P G Sbjct: 182 AGGIDVPYPAGHSALLARIRAN-GLVLSEYPPG 213 >gi|297156864|gb|ADI06576.1| DNA processing Smf-family protein [Streptomyces bingchenggensis BCW-1] Length = 367 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+E I + G+ ++E+P G Sbjct: 150 LASGVDIPYPRGHAELIERIAEQ-GLVLAELPPG 182 >gi|82545648|ref|YP_409595.1| DNA protecting protein DprA [Shigella boydii Sb227] gi|81247059|gb|ABB67767.1| Predicted Rossmann-fold nucleotide-binding protein involved in DNA uptake [Shigella boydii Sb227] gi|320187007|gb|EFW61719.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Shigella flexneri CDC 796-83] gi|332090239|gb|EGI95337.1| DNA protecting protein DprA [Shigella boydii 3594-74] Length = 374 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLATSLLEHGGALVSEFPL 199 >gi|291571641|dbj|BAI93913.1| DNA processing protein [Arthrospira platensis NIES-39] Length = 377 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP +NR L E++ G+ ISE P G Sbjct: 177 LGTGVDIAYPKQNRPLCEQVLKQ-GLLISEFPSG 209 >gi|288922424|ref|ZP_06416612.1| DNA protecting protein DprA [Frankia sp. EUN1f] gi|288346227|gb|EFC80568.1| DNA protecting protein DprA [Frankia sp. EUN1f] Length = 383 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + +LL+EI + G+ +SE P G Sbjct: 171 LAGGVDVPYPAAHADLLDEIAAS-GLVLSETPPG 203 >gi|322506376|gb|ADX01830.1| Rossmann-fold nucleotide-binding protein [Acinetobacter baumannii 1656-2] Length = 376 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 180 GTGLDTTYPAQNKKLAEYILAKNGAIITEFLPG 212 >gi|300907197|ref|ZP_07124860.1| putative DNA protecting protein DprA [Escherichia coli MS 84-1] gi|301303624|ref|ZP_07209746.1| putative DNA protecting protein DprA [Escherichia coli MS 124-1] gi|300401072|gb|EFJ84610.1| putative DNA protecting protein DprA [Escherichia coli MS 84-1] gi|300841123|gb|EFK68883.1| putative DNA protecting protein DprA [Escherichia coli MS 124-1] gi|315257854|gb|EFU37822.1| putative DNA protecting protein DprA [Escherichia coli MS 85-1] Length = 324 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GL+ P +N L +EI D GG ISE P G Sbjct: 178 LAHGLEEAKPKQNSRLAQEILDKGGAWISEYPMG 211 >gi|187731689|ref|YP_001881969.1| DNA protecting protein DprA [Shigella boydii CDC 3083-94] gi|187428681|gb|ACD07955.1| DNA protecting protein DprA [Shigella boydii CDC 3083-94] gi|320173930|gb|EFW49106.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Shigella dysenteriae CDC 74-1112] Length = 374 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLATSLLEHGGALVSEFPL 199 >gi|134297377|ref|YP_001121112.1| DNA protecting protein DprA [Burkholderia vietnamiensis G4] gi|134140534|gb|ABO56277.1| DNA protecting protein DprA [Burkholderia vietnamiensis G4] Length = 449 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP +R L EI + G+ +SE P G Sbjct: 195 IATGADLVYPARHRMLAHEIAAH-GVIVSEWPLG 227 >gi|325498854|gb|EGC96713.1| DNA protecting protein DprA [Escherichia fergusonii ECD227] Length = 374 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLATSLLEHGGALVSEFPL 199 >gi|331684928|ref|ZP_08385514.1| protein smf [Escherichia coli H299] gi|331077299|gb|EGI48511.1| protein smf [Escherichia coli H299] Length = 374 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLATSLLEHGGALVSEFPL 199 >gi|293416704|ref|ZP_06659341.1| DNA processing protein [Escherichia coli B185] gi|291431280|gb|EFF04265.1| DNA processing protein [Escherichia coli B185] Length = 374 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLATSLLEHGGALVSEFPL 199 >gi|188492261|ref|ZP_02999531.1| DNA protecting protein DprA [Escherichia coli 53638] gi|188487460|gb|EDU62563.1| DNA protecting protein DprA [Escherichia coli 53638] Length = 374 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLATSLLEHGGALVSEFPL 199 >gi|332304411|ref|YP_004432262.1| DNA protecting protein DprA [Glaciecola agarilytica 4H-3-7+YE-5] gi|332171740|gb|AEE20994.1| DNA protecting protein DprA [Glaciecola agarilytica 4H-3-7+YE-5] Length = 379 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 15/33 (45%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + N+ I + G +SE Sbjct: 184 LGTGLSNIYPKRHVNMASRILEQNGALVSEFYP 216 >gi|325846110|ref|ZP_08169204.1| DNA protecting protein DprA [Anaerococcus hydrogenalis ACS-025-V-Sch4] gi|325481703|gb|EGC84738.1| DNA protecting protein DprA [Anaerococcus hydrogenalis ACS-025-V-Sch4] Length = 359 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP N+ L E+I + G+ ISE Sbjct: 167 IGSGLDIIYPKANKYLYEKI-EEKGLIISEF 196 >gi|215485950|ref|YP_002328381.1| hypothetical protein E2348C_0815 [Escherichia coli O127:H6 str. E2348/69] gi|312969113|ref|ZP_07783320.1| SMF family protein [Escherichia coli 2362-75] gi|331676604|ref|ZP_08377300.1| DNA protecting protein DprA [Escherichia coli H591] gi|215264022|emb|CAS08363.1| predicted protein [Escherichia coli O127:H6 str. E2348/69] gi|312286515|gb|EFR14428.1| SMF family protein [Escherichia coli 2362-75] gi|323942733|gb|EGB38898.1| DNA recombination-mediator protein A [Escherichia coli E482] gi|331075293|gb|EGI46591.1| DNA protecting protein DprA [Escherichia coli H591] Length = 319 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GL+ P +N L +EI D GG ISE P G Sbjct: 173 LAHGLEEAKPKQNSRLAQEILDKGGAWISEYPMG 206 >gi|82778583|ref|YP_404932.1| DNA protecting protein DprA [Shigella dysenteriae Sd197] gi|309785608|ref|ZP_07680239.1| DNA protecting protein DprA [Shigella dysenteriae 1617] gi|81242731|gb|ABB63441.1| predicted Rossmann-fold nucleotide-binding protein [Shigella dysenteriae Sd197] gi|308926728|gb|EFP72204.1| DNA protecting protein DprA [Shigella dysenteriae 1617] Length = 374 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLATSLLEHGGALVSEFPL 199 >gi|296129327|ref|YP_003636577.1| DNA protecting protein DprA [Cellulomonas flavigena DSM 20109] gi|296021142|gb|ADG74378.1| DNA protecting protein DprA [Cellulomonas flavigena DSM 20109] Length = 402 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP N LLEE+ GG SE+P G Sbjct: 203 LAGGVDRAYPAGNARLLEEVVRAGGSLFSEVPPG 236 >gi|283778858|ref|YP_003369613.1| DNA protecting protein DprA [Pirellula staleyi DSM 6068] gi|283437311|gb|ADB15753.1| DNA protecting protein DprA [Pirellula staleyi DSM 6068] Length = 401 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL C+YPPE+ +L +EI + G +SE P Sbjct: 184 LGSGLACIYPPEHLDLAKEIAE-KGALLSEQPP 215 >gi|29655281|ref|NP_820973.1| DNA protecting protein DprA [Coxiella burnetii RSA 493] gi|29542553|gb|AAO91487.1| DNA processing protein [Coxiella burnetii RSA 493] Length = 308 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YPP + L E+I G +SE P Sbjct: 123 LGSGLTNIYPPRHHRLAEQI-SQKGALVSEFPL 154 >gi|326625150|gb|EGE31495.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Dublin str. 3246] Length = 391 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 184 LGNGLAKIYPRRHAVLAENLIATGGAVVSEFPL 216 >gi|148643816|ref|YP_001274329.1| Smf protein [Methanobrevibacter smithii ATCC 35061] gi|148552833|gb|ABQ87961.1| Smf protein [Methanobrevibacter smithii ATCC 35061] Length = 312 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ + P N+ L + I + GG +SE Sbjct: 170 LPCGLNVISPSSNKKLAKSIIEQGGCLVSEYEP 202 >gi|331654878|ref|ZP_08355877.1| protein smf [Escherichia coli M718] gi|331046893|gb|EGI18971.1| protein smf [Escherichia coli M718] Length = 374 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLATSLLEHGGALVSEFPL 199 >gi|257058549|ref|YP_003136437.1| DNA protecting protein DprA [Cyanothece sp. PCC 8802] gi|256588715|gb|ACU99601.1| DNA protecting protein DprA [Cyanothece sp. PCC 8802] Length = 375 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +R L I G+ +SE P G Sbjct: 177 LGTGVDMVYPSNHRQLHRNI-QQQGLILSEYPAG 209 >gi|108798955|ref|YP_639152.1| DNA processing protein DprA, putative [Mycobacterium sp. MCS] gi|119868070|ref|YP_938022.1| DNA protecting protein DprA [Mycobacterium sp. KMS] gi|108769374|gb|ABG08096.1| DNA protecting protein DprA [Mycobacterium sp. MCS] gi|119694159|gb|ABL91232.1| DNA protecting protein DprA [Mycobacterium sp. KMS] Length = 376 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D YP + LL I N G+ +SE P G Sbjct: 182 AGGIDVPYPAGHSALLARIRAN-GLVLSEYPPG 213 >gi|320191680|gb|EFW66330.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Escherichia coli O157:H7 str. EC1212] Length = 310 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLLEQGGALVSEFPL 199 >gi|221638586|ref|YP_002524848.1| DNA protecting protein DprA [Rhodobacter sphaeroides KD131] gi|221159367|gb|ACM00347.1| DNA protecting protein DprA [Rhodobacter sphaeroides KD131] Length = 372 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L EI G ISE P G Sbjct: 177 AGGVDVIYPAENAGLAAEIAAR-GCRISEQPMG 208 >gi|220933380|ref|YP_002512279.1| smf protein [Thioalkalivibrio sp. HL-EbGR7] gi|219994690|gb|ACL71292.1| smf protein [Thioalkalivibrio sp. HL-EbGR7] Length = 375 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G D +YP NR+L I + G ++E P G Sbjct: 173 ATGPDRIYPALNRDLAHRIAEQ-GALVTEYPTG 204 >gi|170681650|ref|YP_001745548.1| DNA protecting protein DprA [Escherichia coli SMS-3-5] gi|215488585|ref|YP_002331016.1| DNA protecting protein DprA [Escherichia coli O127:H6 str. E2348/69] gi|300935283|ref|ZP_07150294.1| DNA protecting protein DprA [Escherichia coli MS 21-1] gi|312968389|ref|ZP_07782599.1| DNA protecting protein DprA [Escherichia coli 2362-75] gi|170519368|gb|ACB17546.1| DNA protecting protein DprA [Escherichia coli SMS-3-5] gi|215266657|emb|CAS11096.1| predicted protein [Escherichia coli O127:H6 str. E2348/69] gi|300459486|gb|EFK22979.1| DNA protecting protein DprA [Escherichia coli MS 21-1] gi|312287214|gb|EFR15124.1| DNA protecting protein DprA [Escherichia coli 2362-75] gi|323189109|gb|EFZ74393.1| DNA protecting protein DprA [Escherichia coli RN587/1] Length = 374 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLATSLLEHGGALVSEFPL 199 >gi|58580206|ref|YP_199222.1| DNA processing chain A [Xanthomonas oryzae pv. oryzae KACC10331] gi|84622201|ref|YP_449573.1| DNA processing chain A [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|58424800|gb|AAW73837.1| DNA processing chain A [Xanthomonas oryzae pv. oryzae KACC10331] gi|84366141|dbj|BAE67299.1| DNA processing chain A [Xanthomonas oryzae pv. oryzae MAFF 311018] Length = 380 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D YP ++ L + I ++GG +SE G Sbjct: 175 GTGTDVAYPERHQGLRDRIAESGGAVVSEYLPG 207 >gi|218706893|ref|YP_002414412.1| DNA protecting protein DprA [Escherichia coli UMN026] gi|293406883|ref|ZP_06650807.1| hypothetical protein ECGG_03573 [Escherichia coli FVEC1412] gi|298382624|ref|ZP_06992219.1| DNA processing protein [Escherichia coli FVEC1302] gi|300896633|ref|ZP_07115150.1| DNA protecting protein DprA [Escherichia coli MS 198-1] gi|301018857|ref|ZP_07183096.1| DNA protecting protein DprA [Escherichia coli MS 69-1] gi|331664898|ref|ZP_08365799.1| protein smf [Escherichia coli TA143] gi|218433990|emb|CAR14907.1| conserved hypothetical protein [Escherichia coli UMN026] gi|291425694|gb|EFE98728.1| hypothetical protein ECGG_03573 [Escherichia coli FVEC1412] gi|298276460|gb|EFI17978.1| DNA processing protein [Escherichia coli FVEC1302] gi|300359510|gb|EFJ75380.1| DNA protecting protein DprA [Escherichia coli MS 198-1] gi|300399514|gb|EFJ83052.1| DNA protecting protein DprA [Escherichia coli MS 69-1] gi|331057408|gb|EGI29394.1| protein smf [Escherichia coli TA143] Length = 374 Score = 54.6 bits (132), Expect = 5e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLATSLLEHGGALVSEFPL 199 >gi|295836279|ref|ZP_06823212.1| SMF protein [Streptomyces sp. SPB74] gi|197697356|gb|EDY44289.1| SMF protein [Streptomyces sp. SPB74] Length = 395 Score = 54.2 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YPP + LL I + G+ + E+P G Sbjct: 186 LACGIDRSYPPGHARLLARIAEQ-GLLVGELPPG 218 >gi|114330415|ref|YP_746637.1| DNA protecting protein DprA [Nitrosomonas eutropha C91] gi|114307429|gb|ABI58672.1| DNA protecting protein DprA [Nitrosomonas eutropha C91] Length = 373 Score = 54.2 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +NR L ++ D G ISE P G Sbjct: 175 GTGLDLVYPSKNRELAHKLADE-GALISEFPLG 206 >gi|254562490|ref|YP_003069585.1| DNA protecting protein DprA [Methylobacterium extorquens DM4] gi|254269768|emb|CAX25740.1| DNA protecting protein DprA [Methylobacterium extorquens DM4] Length = 397 Score = 54.2 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP + L+EEI GG ++E+P G Sbjct: 166 LAGGQDQIYPENHAGLVEEIVGAGGAVVAEMPMG 199 >gi|332557608|ref|ZP_08411930.1| hypothetical protein RSWS8N_01115 [Rhodobacter sphaeroides WS8N] gi|332275320|gb|EGJ20635.1| hypothetical protein RSWS8N_01115 [Rhodobacter sphaeroides WS8N] Length = 372 Score = 54.2 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L EI G ISE P G Sbjct: 177 AGGVDVIYPAENAGLAAEIAAR-GCRISEQPMG 208 >gi|256832232|ref|YP_003160959.1| DNA protecting protein DprA [Jonesia denitrificans DSM 20603] gi|256685763|gb|ACV08656.1| DNA protecting protein DprA [Jonesia denitrificans DSM 20603] Length = 395 Score = 54.2 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D LYP N+ LL+ + D+ G +SE+P G Sbjct: 163 LAGGVDRLYPQGNKKLLQRLIDH-GALVSEMPVG 195 >gi|166713740|ref|ZP_02244947.1| DNA processing chain A [Xanthomonas oryzae pv. oryzicola BLS256] Length = 380 Score = 54.2 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D YP ++ L + I ++GG +SE G Sbjct: 175 GTGTDVAYPERHQGLRDRIAESGGAVVSEYLPG 207 >gi|293412704|ref|ZP_06655372.1| hypothetical protein ECEG_03768 [Escherichia coli B354] gi|291468351|gb|EFF10844.1| hypothetical protein ECEG_03768 [Escherichia coli B354] Length = 364 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 157 LGNGLNTIHPRRHARLATSLLEHGGALVSEFPL 189 >gi|120403195|ref|YP_953024.1| transcriptional regulator, TrmB [Mycobacterium vanbaalenii PYR-1] gi|119956013|gb|ABM13018.1| DNA protecting protein DprA [Mycobacterium vanbaalenii PYR-1] Length = 379 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + LL G+ +SE P G Sbjct: 180 LAGGIDVPYPAGHSALLHR-VSGSGLLVSEYPPG 212 >gi|159036855|ref|YP_001536108.1| DNA protecting protein DprA [Salinispora arenicola CNS-205] gi|157915690|gb|ABV97117.1| DNA protecting protein DprA [Salinispora arenicola CNS-205] Length = 452 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD YP N L + I D G+ +SE G Sbjct: 223 LACGLDRPYPMGNAALFDRIADT-GLLVSEWMPG 255 >gi|62181911|ref|YP_218328.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|224585200|ref|YP_002638999.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|238913880|ref|ZP_04657717.1| hypothetical protein SentesTe_22485 [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] gi|62129544|gb|AAX67247.1| putative protein involved in DNA uptake [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|224469728|gb|ACN47558.1| hypothetical protein SPC_3474 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|322716397|gb|EFZ07968.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] Length = 374 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAMLAENLIAAGGAVVSEFPL 199 >gi|163848745|ref|YP_001636789.1| DNA protecting protein DprA [Chloroflexus aurantiacus J-10-fl] gi|222526691|ref|YP_002571162.1| DNA protecting protein DprA [Chloroflexus sp. Y-400-fl] gi|163670034|gb|ABY36400.1| DNA protecting protein DprA [Chloroflexus aurantiacus J-10-fl] gi|222450570|gb|ACM54836.1| DNA protecting protein DprA [Chloroflexus sp. Y-400-fl] Length = 361 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +YP N L +I + G +S+ P G Sbjct: 172 LASGVDRIYPERNHALAGQIIAS-GALLSDYPPG 204 >gi|294815382|ref|ZP_06774025.1| DNA processing Smf-family protein [Streptomyces clavuligerus ATCC 27064] gi|326443734|ref|ZP_08218468.1| putative DNA processing Smf-family protein [Streptomyces clavuligerus ATCC 27064] gi|294327981|gb|EFG09624.1| DNA processing Smf-family protein [Streptomyces clavuligerus ATCC 27064] Length = 384 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +YP + LL I + G+ I+E+P G Sbjct: 179 LACGVDMVYPRGHTELLGRIAEQ-GLLIAELPPG 211 >gi|163751678|ref|ZP_02158897.1| DNA processing protein DprA, putative [Shewanella benthica KT99] gi|161328417|gb|EDP99573.1| DNA processing protein DprA, putative [Shewanella benthica KT99] Length = 339 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP +R + E+I + G +SE G Sbjct: 143 LGTGTDVIYPRRHRAIYEKI-QHHGAIVSEFWPG 175 >gi|330466300|ref|YP_004404043.1| DNA protecting protein DprA [Verrucosispora maris AB-18-032] gi|328809271|gb|AEB43443.1| DNA protecting protein DprA [Verrucosispora maris AB-18-032] Length = 391 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G+D YP N L + I D+ G+ +SE P Sbjct: 192 LACGVDRPYPVGNTALFDRIADS-GLLVSEWPP 223 >gi|255263932|ref|ZP_05343274.1| DNA protecting protein DprA [Thalassiobium sp. R2A62] gi|255106267|gb|EET48941.1| DNA protecting protein DprA [Thalassiobium sp. R2A62] Length = 197 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+DC+YP EN L +I G+ +SE P G Sbjct: 153 MAGGVDCIYPSENTELARKI-AQNGVRVSEQPIG 185 >gi|322688898|ref|YP_004208632.1| hypothetical protein BLIF_0711 [Bifidobacterium longum subsp. infantis 157F] gi|320460234|dbj|BAJ70854.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis 157F] Length = 550 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 240 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 272 >gi|317482280|ref|ZP_07941301.1| DNA recombination-mediator protein A [Bifidobacterium sp. 12_1_47BFAA] gi|316916296|gb|EFV37697.1| DNA recombination-mediator protein A [Bifidobacterium sp. 12_1_47BFAA] Length = 550 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 240 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 272 >gi|227545995|ref|ZP_03976044.1| possible Rossmann fold nucleotide-binding protein involved in DNA uptake [Bifidobacterium longum subsp. infantis ATCC 55813] gi|322690873|ref|YP_004220443.1| hypothetical protein BLLJ_0683 [Bifidobacterium longum subsp. longum JCM 1217] gi|227213629|gb|EEI81478.1| possible Rossmann fold nucleotide-binding protein involved in DNA uptake [Bifidobacterium longum subsp. infantis ATCC 55813] gi|320455729|dbj|BAJ66351.1| conserved hypothetical protein [Bifidobacterium longum subsp. longum JCM 1217] Length = 566 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 256 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 288 >gi|56416598|ref|YP_153672.1| DNA processing protein, chain A [Anaplasma marginale str. St. Maries] gi|222474964|ref|YP_002563379.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale str. Florida] gi|56387830|gb|AAV86417.1| DNA processing protein, chain A [Anaplasma marginale str. St. Maries] gi|222419100|gb|ACM49123.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale str. Florida] Length = 377 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 22/32 (68%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP +N +L I NGG+ ++E+PF Sbjct: 176 ASGIDVVYPKDNLHLYRAIVHNGGVVVTELPF 207 >gi|23465510|ref|NP_696113.1| hypothetical protein BL0937 [Bifidobacterium longum NCC2705] gi|23326169|gb|AAN24749.1| hypothetical protein with partial similarity to smf DNA processing protein [Bifidobacterium longum NCC2705] Length = 566 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 256 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 288 >gi|255002940|ref|ZP_05277904.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale str. Puerto Rico] gi|255004065|ref|ZP_05278866.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale str. Virginia] Length = 354 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 22/32 (68%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP +N +L I NGG+ ++E+PF Sbjct: 153 ASGIDVVYPKDNLHLYRAIVHNGGVVVTELPF 184 >gi|238063318|ref|ZP_04608027.1| DNA protecting protein dprA [Micromonospora sp. ATCC 39149] gi|237885129|gb|EEP73957.1| DNA protecting protein dprA [Micromonospora sp. ATCC 39149] Length = 232 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP N L + I + G+ +SE G Sbjct: 26 LACGIDRPYPMGNAALFDRIAET-GLLVSEWMPG 58 >gi|168264714|ref|ZP_02686687.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|200387711|ref|ZP_03214323.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|199604809|gb|EDZ03354.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|205346865|gb|EDZ33496.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] Length = 374 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAMLAENLIAAGGAVVSEFPL 199 >gi|296171474|ref|ZP_06852760.1| smf family protein [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295894160|gb|EFG73920.1| smf family protein [Mycobacterium parascrofulaceum ATCC BAA-614] Length = 250 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP + LL I G+ +E P G Sbjct: 184 LAGGLDVPYPSGHSALLHRI-GQHGLLFTEYPPG 216 >gi|77462726|ref|YP_352230.1| hypothetical protein RSP_2177 [Rhodobacter sphaeroides 2.4.1] gi|77387144|gb|ABA78329.1| hypothetical protein RSP_2177 [Rhodobacter sphaeroides 2.4.1] Length = 372 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L EI G ISE P G Sbjct: 177 AGGVDVIYPAENAGLAAEIAAR-GCRISEQPMG 208 >gi|145224718|ref|YP_001135396.1| DNA protecting protein DprA [Mycobacterium gilvum PYR-GCK] gi|315445048|ref|YP_004077927.1| DNA protecting protein DprA [Mycobacterium sp. Spyr1] gi|145217204|gb|ABP46608.1| DNA protecting protein DprA [Mycobacterium gilvum PYR-GCK] gi|315263351|gb|ADU00093.1| DNA protecting protein DprA [Mycobacterium sp. Spyr1] Length = 388 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD YP + LL G+ +SE P G Sbjct: 184 LAAGLDVPYPAGHSALLHR-VGKHGLLVSEYPPG 216 >gi|312132950|ref|YP_004000289.1| smf [Bifidobacterium longum subsp. longum BBMN68] gi|311773931|gb|ADQ03419.1| Smf [Bifidobacterium longum subsp. longum BBMN68] Length = 514 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 204 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 236 >gi|309811480|ref|ZP_07705262.1| DNA protecting protein DprA [Dermacoccus sp. Ellin185] gi|308434531|gb|EFP58381.1| DNA protecting protein DprA [Dermacoccus sp. Ellin185] Length = 438 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP + L I + G+ +SE+P G Sbjct: 244 AGGVDRVYPTAHEELFARIRER-GVIVSEMPLG 275 >gi|254283620|ref|ZP_04958588.1| DNA protecting protein DprA [gamma proteobacterium NOR51-B] gi|219679823|gb|EED36172.1| DNA protecting protein DprA [gamma proteobacterium NOR51-B] Length = 374 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +R L E I + G ISE G Sbjct: 178 LPTGVDRVYPARHRALAEAITE-KGALISEFVPG 210 >gi|168239762|ref|ZP_02664820.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|194735114|ref|YP_002116349.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|194710616|gb|ACF89837.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197287577|gb|EDY26969.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|322615054|gb|EFY11978.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] gi|322617341|gb|EFY14242.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] gi|322625563|gb|EFY22388.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] gi|322626405|gb|EFY23214.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] gi|322632083|gb|EFY28836.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] gi|322635038|gb|EFY31761.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] gi|322643261|gb|EFY39828.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] gi|322646655|gb|EFY43162.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] gi|322650001|gb|EFY46420.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675] gi|322652718|gb|EFY49058.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] gi|322659525|gb|EFY55769.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] gi|322665533|gb|EFY61720.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] gi|322670427|gb|EFY66566.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] gi|322670500|gb|EFY66634.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] gi|322675076|gb|EFY71159.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] gi|322681613|gb|EFY77642.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] gi|322685957|gb|EFY81946.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] gi|323195827|gb|EFZ81000.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] gi|323196417|gb|EFZ81568.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] gi|323202702|gb|EFZ87741.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] gi|323207307|gb|EFZ92257.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] gi|323211257|gb|EFZ96102.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] gi|323216034|gb|EGA00765.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] gi|323223475|gb|EGA07803.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] gi|323226795|gb|EGA10985.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] gi|323231843|gb|EGA15953.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] gi|323233204|gb|EGA17299.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] gi|323237271|gb|EGA21336.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] gi|323245506|gb|EGA29505.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] gi|323249012|gb|EGA32934.1| hypothetical protein SEEM9199_19300 [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] gi|323250635|gb|EGA34516.1| hypothetical protein SEEM8282_12355 [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] gi|323263013|gb|EGA46560.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] gi|323266013|gb|EGA49508.1| hypothetical protein SEEM8285_14309 [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] gi|323272770|gb|EGA56173.1| hypothetical protein SEEM8287_01932 [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287] Length = 374 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAVLAENLIATGGAVVSEFPL 199 >gi|126658133|ref|ZP_01729284.1| SMF protein [Cyanothece sp. CCY0110] gi|126620504|gb|EAZ91222.1| SMF protein [Cyanothece sp. CCY0110] Length = 375 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +R L + G+ ISE P G Sbjct: 177 LGTGVDIVYPSHHRQLHRD-LQKRGLIISEYPAG 209 >gi|188574931|ref|YP_001911860.1| DNA protecting protein DprA [Xanthomonas oryzae pv. oryzae PXO99A] gi|188519383|gb|ACD57328.1| DNA protecting protein DprA [Xanthomonas oryzae pv. oryzae PXO99A] Length = 311 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D YP ++ L + I ++GG +SE G Sbjct: 106 GTGTDVAYPERHQGLRDRIAESGGAVVSEYLPG 138 >gi|160934426|ref|ZP_02081813.1| hypothetical protein CLOLEP_03299 [Clostridium leptum DSM 753] gi|156867099|gb|EDO60471.1| hypothetical protein CLOLEP_03299 [Clostridium leptum DSM 753] Length = 396 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG D YPP + + I +NGG +SE P Sbjct: 171 LGGGADVDYPPNFAGMRKRILENGGAVLSEYPP 203 >gi|238763700|ref|ZP_04624659.1| DNA protecting protein DprA [Yersinia kristensenii ATCC 33638] gi|238698002|gb|EEP90760.1| DNA protecting protein DprA [Yersinia kristensenii ATCC 33638] Length = 373 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L EI GG+ +SE Sbjct: 167 LGSGLEHIYPRRHSQLAREIEYQGGVLVSEF 197 >gi|237728620|ref|ZP_04559101.1| conserved hypothetical protein [Citrobacter sp. 30_2] gi|226909242|gb|EEH95160.1| conserved hypothetical protein [Citrobacter sp. 30_2] Length = 374 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P ++ L E + + GG +SE P Sbjct: 167 LGNGLETIHPRQHIRLAERLIEAGGALVSEFPL 199 >gi|126461618|ref|YP_001042732.1| DNA protecting protein DprA [Rhodobacter sphaeroides ATCC 17029] gi|126103282|gb|ABN75960.1| DNA protecting protein DprA [Rhodobacter sphaeroides ATCC 17029] Length = 372 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L EI G ISE P G Sbjct: 177 AGGVDVIYPAENAGLAAEIAAR-GCRISEQPMG 208 >gi|254230001|ref|ZP_04923402.1| DNA protecting protein DprA, putative [Vibrio sp. Ex25] gi|262392833|ref|YP_003284687.1| DNA uptake Rossmann fold nucleotide-binding protein [Vibrio sp. Ex25] gi|151937503|gb|EDN56360.1| DNA protecting protein DprA, putative [Vibrio sp. Ex25] gi|262336427|gb|ACY50222.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio sp. Ex25] Length = 369 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +R L + + ++ G +SE Sbjct: 174 LGSGLENIYPARHRGLAQRVIEH-GALVSEF 203 >gi|119387028|ref|YP_918083.1| DNA protecting protein DprA [Paracoccus denitrificans PD1222] gi|119377623|gb|ABL72387.1| DNA protecting protein DprA [Paracoccus denitrificans PD1222] Length = 418 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YP EN L EEI + G+ ++E P G Sbjct: 182 MAGGIDKIYPGENAALAEEICET-GLLVTEQPPG 214 >gi|46190458|ref|ZP_00206472.1| COG0758: Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Bifidobacterium longum DJO10A] gi|189439541|ref|YP_001954622.1| putative DNA uptake protein [Bifidobacterium longum DJO10A] gi|189427976|gb|ACD98124.1| Putative DNA uptake protein [Bifidobacterium longum DJO10A] Length = 514 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 204 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 236 >gi|238797210|ref|ZP_04640711.1| DNA protecting protein DprA [Yersinia mollaretii ATCC 43969] gi|238718847|gb|EEQ10662.1| DNA protecting protein DprA [Yersinia mollaretii ATCC 43969] Length = 373 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L +EI GG +SE Sbjct: 167 LGSGLENIYPRRHSQLAKEIEHQGGALVSEF 197 >gi|168823237|ref|ZP_02835237.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|205340490|gb|EDZ27254.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|320087851|emb|CBY97614.1| Protein smf [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] Length = 374 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAVLAENLIATGGAVVSEFPL 199 >gi|56415325|ref|YP_152400.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197364255|ref|YP_002143892.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|56129582|gb|AAV79088.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197095732|emb|CAR61302.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] Length = 374 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAVLAENLIATGGAVVSEFPL 199 >gi|198243264|ref|YP_002217369.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|197937780|gb|ACH75113.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] Length = 374 Score = 54.2 bits (131), Expect = 6e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAVLAENLIATGGAVVSEFPL 199 >gi|239621949|ref|ZP_04664980.1| DNA protecting protein DprA [Bifidobacterium longum subsp. infantis CCUG 52486] gi|239515140|gb|EEQ55007.1| DNA protecting protein DprA [Bifidobacterium longum subsp. infantis CCUG 52486] Length = 514 Score = 54.2 bits (131), Expect = 7e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 204 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 236 >gi|148556726|ref|YP_001264308.1| DNA protecting protein DprA [Sphingomonas wittichii RW1] gi|148501916|gb|ABQ70170.1| DNA protecting protein DprA [Sphingomonas wittichii RW1] Length = 592 Score = 54.2 bits (131), Expect = 7e-06, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPPEN L E I + G+ I+E P G Sbjct: 395 IAGGIDIVYPPENAALQEAIAER-GLLIAEQPPG 427 >gi|325001299|ref|ZP_08122411.1| DNA protecting protein DprA [Pseudonocardia sp. P1] Length = 327 Score = 54.2 bits (131), Expect = 7e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D YP + L+E I + G+ ++E P G Sbjct: 192 LACGPDRSYPAAHEGLIERIAER-GLVLTEYPPG 224 >gi|183981827|ref|YP_001850118.1| hypothetical protein MMAR_1814 [Mycobacterium marinum M] gi|183175153|gb|ACC40263.1| conserved hypothetical membrane protein [Mycobacterium marinum M] Length = 391 Score = 54.2 bits (131), Expect = 7e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + LL I G+ ++E P G Sbjct: 183 LAGGIDIPYPTGHSALLHRI-GQHGLLVTEYPPG 215 >gi|302877265|ref|YP_003845829.1| DNA protecting protein DprA [Gallionella capsiferriformans ES-2] gi|302580054|gb|ADL54065.1| DNA protecting protein DprA [Gallionella capsiferriformans ES-2] Length = 360 Score = 54.2 bits (131), Expect = 7e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR L G ISE P G Sbjct: 174 GTGLDKVYPAANRELAHR-LAKAGTLISEFPLG 205 >gi|328543466|ref|YP_004303575.1| DNA protecting protein DprA [polymorphum gilvum SL003B-26A1] gi|326413210|gb|ADZ70273.1| DNA protecting protein DprA, putative [Polymorphum gilvum SL003B-26A1] Length = 380 Score = 54.2 bits (131), Expect = 7e-06, Method: Composition-based stats. Identities = 22/33 (66%), Positives = 25/33 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYPPE+ LL I D GG AISE+PFG Sbjct: 179 AGGIDILYPPEHDGLLARILDAGGSAISEMPFG 211 >gi|308177311|ref|YP_003916717.1| smf family protein [Arthrobacter arilaitensis Re117] gi|307744774|emb|CBT75746.1| putative smf family protein [Arthrobacter arilaitensis Re117] Length = 414 Score = 54.2 bits (131), Expect = 7e-06, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D LYP N NLL +I G+ +SE+P G Sbjct: 216 MAGGIDRLYPSGNSNLLNQIVAR-GVLLSEVPPG 248 >gi|313836671|gb|EFS74385.1| DNA protecting protein DprA [Propionibacterium acnes HL037PA2] gi|314928178|gb|EFS92009.1| DNA protecting protein DprA [Propionibacterium acnes HL044PA1] gi|314972177|gb|EFT16274.1| DNA protecting protein DprA [Propionibacterium acnes HL037PA3] Length = 377 Score = 53.8 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD YP N +LE+I + G ISE+P G Sbjct: 178 LACGLDTFYPRGNTAVLEKIAET-GALISELPPG 210 >gi|291612478|ref|YP_003522635.1| DNA protecting protein DprA [Sideroxydans lithotrophicus ES-1] gi|291582590|gb|ADE10248.1| DNA protecting protein DprA [Sideroxydans lithotrophicus ES-1] Length = 354 Score = 53.8 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR+L + G ISE P G Sbjct: 174 GTGLDKVYPAANRDLAHT-LAHHGTIISEFPLG 205 >gi|303326956|ref|ZP_07357398.1| DNA processing protein DprA [Desulfovibrio sp. 3_1_syn3] gi|302862944|gb|EFL85876.1| DNA processing protein DprA [Desulfovibrio sp. 3_1_syn3] Length = 444 Score = 53.8 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP L + + G+ +SE P G Sbjct: 204 LGTGIDQIYPRSGEPLFRAMAEQ-GLLLSEFPPG 236 >gi|269119854|ref|YP_003308031.1| SMF family protein [Sebaldella termitidis ATCC 33386] gi|268613732|gb|ACZ08100.1| SMF family protein [Sebaldella termitidis ATCC 33386] Length = 234 Score = 53.8 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD ++P E+R L E I +N G+ ISE P G Sbjct: 161 GSGLDKIFPYESRKLWERIPEN-GMLISEYPPG 192 >gi|297202659|ref|ZP_06920056.1| DNA processing Smf-family protein [Streptomyces sviceus ATCC 29083] gi|197713234|gb|EDY57268.1| DNA processing Smf-family protein [Streptomyces sviceus ATCC 29083] Length = 385 Score = 53.8 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+ I + G+ I E+P G Sbjct: 180 LACGVDRPYPRGHAQLITRIAEQ-GLVIGELPPG 212 >gi|304309701|ref|YP_003809299.1| SMF protein [gamma proteobacterium HdN1] gi|301795434|emb|CBL43632.1| SMF protein [gamma proteobacterium HdN1] Length = 419 Score = 53.8 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+ +YP +R L I + G ISE P G Sbjct: 182 LAHGMHQIYPARHRVLASRIAET-GALISEFPVG 214 >gi|326562328|gb|EGE12654.1| DNA protecting protein DprA [Moraxella catarrhalis 103P14B1] gi|326575532|gb|EGE25457.1| DNA protecting protein DprA [Moraxella catarrhalis 101P30B1] Length = 414 Score = 53.8 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 M G++ YP + L +I +GG ISE+ Sbjct: 181 MGTGINVCYPRNHNALFAQIIKDGGCLISEL 211 >gi|213692568|ref|YP_002323154.1| SMF family protein [Bifidobacterium longum subsp. infantis ATCC 15697] gi|213524029|gb|ACJ52776.1| SMF family protein [Bifidobacterium longum subsp. infantis ATCC 15697] Length = 566 Score = 53.8 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 256 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 288 >gi|311277760|ref|YP_003939991.1| DNA protecting protein DprA [Enterobacter cloacae SCF1] gi|308746955|gb|ADO46707.1| DNA protecting protein DprA [Enterobacter cloacae SCF1] Length = 374 Score = 53.8 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL YP + +L + I D+GG +SE P Sbjct: 167 LGNGLFHHYPRCHASLAQHILDSGGALVSEFPL 199 >gi|254463787|ref|ZP_05077198.1| DNA protecting protein DprA [Rhodobacterales bacterium Y4I] gi|206684695|gb|EDZ45177.1| DNA protecting protein DprA [Rhodobacterales bacterium Y4I] Length = 365 Score = 53.8 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP EN L EEI G+ +SE P G Sbjct: 153 LAGGADVIYPAENTRLAEEICKT-GLRLSEQPMG 185 >gi|320458720|dbj|BAJ69341.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis ATCC 15697] Length = 550 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 240 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 272 >gi|150021484|ref|YP_001306838.1| DNA protecting protein DprA [Thermosipho melanesiensis BI429] gi|149794005|gb|ABR31453.1| DNA protecting protein DprA [Thermosipho melanesiensis BI429] Length = 264 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D YP ENR L +I G +SE Sbjct: 136 LGNGVDYCYPKENRELYLKIIKE-GCVVSEY 165 >gi|325297496|ref|YP_004257413.1| SMF family protein [Bacteroides salanitronis DSM 18170] gi|324317049|gb|ADY34940.1| SMF family protein [Bacteroides salanitronis DSM 18170] Length = 343 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 20/33 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD +P N+ L EEI GG +SE PFG Sbjct: 200 ASGLDITHPKVNKTLQEEIVAKGGTIVSEHPFG 232 >gi|329889387|ref|ZP_08267730.1| DNA protecting protein DprA [Brevundimonas diminuta ATCC 11568] gi|328844688|gb|EGF94252.1| DNA protecting protein DprA [Brevundimonas diminuta ATCC 11568] Length = 362 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG+D +YP +N +L +I + G +SE P G Sbjct: 168 LGGGVDDVYPSDNADLYRQIAER-GCIVSESPVG 200 >gi|296453948|ref|YP_003661091.1| SMF family protein [Bifidobacterium longum subsp. longum JDM301] gi|296183379|gb|ADH00261.1| SMF family protein [Bifidobacterium longum subsp. longum JDM301] Length = 566 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 256 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 288 >gi|163738379|ref|ZP_02145794.1| DNA processing protein DprA, putative [Phaeobacter gallaeciensis BS107] gi|161388300|gb|EDQ12654.1| DNA processing protein DprA, putative [Phaeobacter gallaeciensis BS107] Length = 355 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YP EN L +I + G+ ISE P G Sbjct: 123 MAGGVDVIYPTENTRLAGDIAEQ-GVMISEHPMG 155 >gi|296114104|ref|YP_003628042.1| DNA protecting protein DprA [Moraxella catarrhalis RH4] gi|295921798|gb|ADG62149.1| DNA protecting protein DprA [Moraxella catarrhalis RH4] Length = 414 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 M G++ YP + L +I +GG ISE+ Sbjct: 181 MGTGINVCYPRNHNALFAQIIKDGGCLISEL 211 >gi|258622992|ref|ZP_05718007.1| Smf/DprA family protein [Vibrio mimicus VM573] gi|258584775|gb|EEW09509.1| Smf/DprA family protein [Vibrio mimicus VM573] Length = 371 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLTQIYPKQHQRLAERIITQ-GALVSEFAP 203 >gi|328907959|gb|EGG27719.1| DNA protecting protein DprA [Propionibacterium sp. P08] Length = 391 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD YP N +LE+I + G ISE+P G Sbjct: 192 LACGLDTFYPRGNTAVLEKIAET-GALISELPPG 224 >gi|218960463|ref|YP_001740238.1| DNA processing protein DprA, putative (fragment) [Candidatus Cloacamonas acidaminovorans] gi|167729120|emb|CAO80031.1| DNA processing protein DprA, putative (fragment) [Candidatus Cloacamonas acidaminovorans] Length = 362 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD +YPP N+ L E I +N G +SE G Sbjct: 174 ASGLDNIYPPMNKTLAENICEN-GALVSEYEPG 205 >gi|290957087|ref|YP_003488269.1| DNA mediated transformation protein [Streptomyces scabiei 87.22] gi|260646613|emb|CBG69710.1| putative DNA mediated transformation protein [Streptomyces scabiei 87.22] Length = 390 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+ I + G+ + E+P G Sbjct: 185 LACGVDRPYPRGHAQLISRIAEQ-GLVVGELPPG 217 >gi|15895060|ref|NP_348409.1| DNA uptake protein [Clostridium acetobutylicum ATCC 824] gi|15024755|gb|AAK79749.1|AE007687_6 DNA uptake protein [Clostridium acetobutylicum ATCC 824] gi|325509198|gb|ADZ20834.1| DNA uptake protein [Clostridium acetobutylicum EA 2018] Length = 354 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G D +YP EN+NL +I G IS+ Sbjct: 160 LGCGADVIYPKENKNLYCQII-RNGCIISQYKP 191 >gi|90417726|ref|ZP_01225638.1| DNA processing protein DprA, putative [Aurantimonas manganoxydans SI85-9A1] gi|90337398|gb|EAS51049.1| DNA processing protein DprA, putative [Aurantimonas manganoxydans SI85-9A1] Length = 376 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGLD YP ENR L+ I D GG +SE FG Sbjct: 177 AGGLDRPYPDENRPLMRRIVDEGGCLLSERAFG 209 >gi|89098656|ref|ZP_01171538.1| DNA processing protein (Smf family protein) [Bacillus sp. NRRL B-14911] gi|89086618|gb|EAR65737.1| DNA processing protein (Smf family protein) [Bacillus sp. NRRL B-14911] Length = 281 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGL+ +YP N L + ++ + ISE P Sbjct: 164 IAGGLNHIYPKSNERLARRMMEDH-LVISEYPP 195 >gi|238783198|ref|ZP_04627224.1| DNA protecting protein DprA [Yersinia bercovieri ATCC 43970] gi|238715994|gb|EEQ07980.1| DNA protecting protein DprA [Yersinia bercovieri ATCC 43970] Length = 373 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L +EI GG +SE Sbjct: 167 LGSGLENIYPRRHSQLAKEIEHQGGALVSEF 197 >gi|163742204|ref|ZP_02149592.1| DNA processing protein DprA, putative [Phaeobacter gallaeciensis 2.10] gi|161384534|gb|EDQ08915.1| DNA processing protein DprA, putative [Phaeobacter gallaeciensis 2.10] Length = 355 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YP EN L +I + G+ ISE P G Sbjct: 123 MAGGVDVIYPTENTRLAGDIAEQ-GVMISEHPMG 155 >gi|326561730|gb|EGE12065.1| DNA protecting protein DprA [Moraxella catarrhalis 7169] gi|326569048|gb|EGE19117.1| DNA protecting protein DprA [Moraxella catarrhalis BC1] gi|326571737|gb|EGE21750.1| DNA protecting protein DprA [Moraxella catarrhalis BC8] gi|326571808|gb|EGE21814.1| DNA protecting protein DprA [Moraxella catarrhalis BC7] Length = 414 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 M G++ YP + L +I +GG ISE+ Sbjct: 181 MGTGINVCYPRNHNALFAQIIKDGGCLISEL 211 >gi|326560687|gb|EGE11055.1| DNA protecting protein DprA [Moraxella catarrhalis 46P47B1] gi|326573495|gb|EGE23461.1| DNA protecting protein DprA [Moraxella catarrhalis O35E] gi|326574348|gb|EGE24291.1| DNA protecting protein DprA [Moraxella catarrhalis CO72] Length = 414 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 M G++ YP + L +I +GG ISE+ Sbjct: 181 MGTGINVCYPRNHNALFAQIIKDGGCLISEL 211 >gi|323256864|gb|EGA40578.1| hypothetical protein SEEM8283_16856 [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283] Length = 266 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E + GG +SE P Sbjct: 167 LGNGLAKIYPRRHAVLAENLIATGGAVVSEFPL 199 >gi|284923292|emb|CBG36386.1| conserved hypothetical protein [Escherichia coli 042] Length = 374 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHAPLAASLLEQGGALVSEFPL 199 >gi|283835703|ref|ZP_06355444.1| hypothetical protein CIT292_10095 [Citrobacter youngae ATCC 29220] gi|291068382|gb|EFE06491.1| DNA protecting protein DprA [Citrobacter youngae ATCC 29220] Length = 374 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P ++ L E + + GG +SE P Sbjct: 167 LGNGLETIHPRQHVRLAERLIEAGGALVSEFPL 199 >gi|295982522|pdb|3MAJ|A Chain A, Crystal Structure Of Putative Dna Processing Protein Dpra Fr Rhodopseudomonas Palustris Cga009 Length = 382 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP E+ +LL +I G AISE P G Sbjct: 185 LAGGHDKIYPAEHEDLLLDIIQTRGAAISEXPLG 218 >gi|237703015|ref|ZP_04533496.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA] gi|226902279|gb|EEH88538.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA] gi|315284580|gb|EFU44025.1| DNA protecting protein DprA [Escherichia coli MS 110-3] gi|323954592|gb|EGB50375.1| DNA protecting protein DprA [Escherichia coli H263] Length = 374 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHAPLAASLLEQGGALVSEFPL 199 >gi|152989517|ref|YP_001345418.1| DNA-processing protein smf chain A [Pseudomonas aeruginosa PA7] gi|150964675|gb|ABR86700.1| protein smf (DNA-processing chain A) [Pseudomonas aeruginosa PA7] Length = 362 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L I + GG +SE+P Sbjct: 176 LGTGLRTLYPRRHAALARRIVEGGGALVSELPL 208 >gi|22298974|ref|NP_682221.1| SMF protein [Thermosynechococcus elongatus BP-1] gi|22295155|dbj|BAC08983.1| SMF protein [Thermosynechococcus elongatus BP-1] Length = 355 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP ENR L +I + GG SE P G Sbjct: 158 LGTGVDMIYPQENRPLYYQIHERGGFL-SEYPRG 190 >gi|87121015|ref|ZP_01076907.1| predicted Rossmann-fold nucleotide-binding protein involved in DNA uptake [Marinomonas sp. MED121] gi|86163853|gb|EAQ65126.1| predicted Rossmann-fold nucleotide-binding protein involved in DNA uptake [Marinomonas sp. MED121] Length = 446 Score = 53.8 bits (130), Expect = 8e-06, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWD-NGGIAISEIPF 33 M GL YP N+ L I + N G +SE P Sbjct: 203 MGSGLLHPYPKSNQALFNRILETNSGCLMSEYPL 236 >gi|317125405|ref|YP_004099517.1| DNA protecting protein DprA [Intrasporangium calvum DSM 43043] gi|315589493|gb|ADU48790.1| DNA protecting protein DprA [Intrasporangium calvum DSM 43043] Length = 389 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+E I + G +SE+ G Sbjct: 166 LASGIDRPYPSGHARLIERIAET-GAVLSEVAPG 198 >gi|312194959|ref|YP_004015020.1| DNA protecting protein DprA [Frankia sp. EuI1c] gi|311226295|gb|ADP79150.1| DNA protecting protein DprA [Frankia sp. EuI1c] Length = 414 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + LL+EI + G+ +SE+P G Sbjct: 186 LACGVDIPYPAAHLRLLDEIRER-GLLVSEVPPG 218 >gi|256847172|ref|ZP_05552618.1| DNA protecting protein DprA [Lactobacillus coleohominis 101-4-CHN] gi|256715836|gb|EEU30811.1| DNA protecting protein DprA [Lactobacillus coleohominis 101-4-CHN] Length = 293 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GL+ +YPPE+ L +I G+ ISE P Sbjct: 169 GNGLNRIYPPEHDRLQRQI-KRHGLLISEYPL 199 >gi|256823829|ref|YP_003147792.1| DNA protecting protein DprA [Kangiella koreensis DSM 16069] gi|256797368|gb|ACV28024.1| DNA protecting protein DprA [Kangiella koreensis DSM 16069] Length = 363 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ++ + +I G +SE G Sbjct: 172 GTGLDRVYPARHKEMAIQI-SQQGALVSEFALG 203 >gi|110643524|ref|YP_671254.1| DNA protecting protein DprA [Escherichia coli 536] gi|191174469|ref|ZP_03035970.1| DNA protecting protein DprA [Escherichia coli F11] gi|300973965|ref|ZP_07172372.1| DNA protecting protein DprA [Escherichia coli MS 200-1] gi|306816372|ref|ZP_07450510.1| DNA protecting protein DprA [Escherichia coli NC101] gi|331649082|ref|ZP_08350168.1| protein smf [Escherichia coli M605] gi|110345116|gb|ABG71353.1| hypothetical protein Smf [Escherichia coli 536] gi|190905277|gb|EDV64915.1| DNA protecting protein DprA [Escherichia coli F11] gi|222034994|emb|CAP77737.1| Protein smf [Escherichia coli LF82] gi|281180320|dbj|BAI56650.1| conserved hypothetical protein [Escherichia coli SE15] gi|300308975|gb|EFJ63495.1| DNA protecting protein DprA [Escherichia coli MS 200-1] gi|305850768|gb|EFM51225.1| DNA protecting protein DprA [Escherichia coli NC101] gi|312947836|gb|ADR28663.1| DNA protecting protein DprA [Escherichia coli O83:H1 str. NRG 857C] gi|324014962|gb|EGB84181.1| DNA protecting protein DprA [Escherichia coli MS 60-1] gi|330909330|gb|EGH37844.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Escherichia coli AA86] gi|331041580|gb|EGI13724.1| protein smf [Escherichia coli M605] Length = 374 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHAPLAASLLEQGGALVSEFPL 199 >gi|270157751|ref|ZP_06186408.1| DNA protecting protein DprA [Legionella longbeachae D-4968] gi|289163980|ref|YP_003454118.1| Protein smf [Legionella longbeachae NSW150] gi|269989776|gb|EEZ96030.1| DNA protecting protein DprA [Legionella longbeachae D-4968] gi|288857153|emb|CBJ10969.1| Protein smf [Legionella longbeachae NSW150] Length = 357 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+DC+YP + L ++I G+ +SE P Sbjct: 171 LGTGIDCIYPHRHVTLSQQI-SQNGLLLSEFPL 202 >gi|254420463|ref|ZP_05034187.1| DNA protecting protein DprA, putative [Brevundimonas sp. BAL3] gi|196186640|gb|EDX81616.1| DNA protecting protein DprA, putative [Brevundimonas sp. BAL3] Length = 356 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG+D +YPPE+ +L + D G +SE P G Sbjct: 166 LGGGVDDIYPPEHADLYARLVDQ-GCVVSESPVG 198 >gi|170769588|ref|ZP_02904041.1| DNA protecting protein DprA [Escherichia albertii TW07627] gi|170121645|gb|EDS90576.1| DNA protecting protein DprA [Escherichia albertii TW07627] Length = 374 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + ++GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAAGLLEHGGALVSEFPL 199 >gi|255325243|ref|ZP_05366349.1| DNA protecting protein DprA [Corynebacterium tuberculostearicum SK141] gi|255297808|gb|EET77119.1| DNA protecting protein DprA [Corynebacterium tuberculostearicum SK141] Length = 393 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D YP N NL +I DN G +SE Sbjct: 193 ACGIDRDYPARNANLFAKIADN-GCIVSEFAP 223 >gi|257063753|ref|YP_003143425.1| DNA protecting protein DprA [Slackia heliotrinireducens DSM 20476] gi|256791406|gb|ACV22076.1| DNA protecting protein DprA [Slackia heliotrinireducens DSM 20476] Length = 319 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG D YP EN +L +++ D GG +SE P+ Sbjct: 109 LGGGCDMPYPVENFDLFQQVVDAGGAVVSEHPW 141 >gi|311739717|ref|ZP_07713552.1| DNA protecting protein DprA [Corynebacterium pseudogenitalium ATCC 33035] gi|311305533|gb|EFQ81601.1| DNA protecting protein DprA [Corynebacterium pseudogenitalium ATCC 33035] Length = 393 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D YP N NL +I DN G +SE Sbjct: 193 ACGIDRDYPARNANLFAKIADN-GCIVSEFAP 223 >gi|166031219|ref|ZP_02234048.1| hypothetical protein DORFOR_00906 [Dorea formicigenerans ATCC 27755] gi|166029066|gb|EDR47823.1| hypothetical protein DORFOR_00906 [Dorea formicigenerans ATCC 27755] Length = 364 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP EN L +I GG ISE G Sbjct: 171 LGCGVDICYPRENIGLYMDIQREGG-IISEQIPG 203 >gi|86137984|ref|ZP_01056560.1| DNA processing protein DprA, putative [Roseobacter sp. MED193] gi|85825576|gb|EAQ45775.1| DNA processing protein DprA, putative [Roseobacter sp. MED193] Length = 368 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG D +YP +N L ++I G+ +SE P Sbjct: 117 LAGGCDVIYPSQNSALAQDIAA-KGLILSEQPM 148 >gi|23099000|ref|NP_692466.1| DNA processing protein [Oceanobacillus iheyensis HTE831] gi|22777228|dbj|BAC13501.1| DNA processing protein (Smf family) [Oceanobacillus iheyensis HTE831] Length = 294 Score = 53.8 bits (130), Expect = 9e-06, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG +YP E+ +L EI G+ ++E P Sbjct: 172 LGGGFHHIYPREHLSLFHEIT-QKGLVLTEYPP 203 >gi|254474217|ref|ZP_05087608.1| DNA processing chain A [Pseudovibrio sp. JE062] gi|211956747|gb|EEA91956.1| DNA processing chain A [Pseudovibrio sp. JE062] Length = 397 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 19/32 (59%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGG+D +YP EN L + G AISE+P Sbjct: 182 AGGIDTVYPKENLELFSSMIATNGAAISEMPI 213 >gi|26249870|ref|NP_755910.1| DNA protecting protein DprA [Escherichia coli CFT073] gi|91212712|ref|YP_542698.1| DNA protecting protein DprA [Escherichia coli UTI89] gi|117625568|ref|YP_858891.1| hypothetical protein APECO1_3161 [Escherichia coli APEC O1] gi|218560347|ref|YP_002393260.1| DNA protecting protein DprA [Escherichia coli S88] gi|218691572|ref|YP_002399784.1| DNA protecting protein DprA [Escherichia coli ED1a] gi|227883417|ref|ZP_04001222.1| SMF family Rossmann fold nucleotide-binding protein [Escherichia coli 83972] gi|300979822|ref|ZP_07174724.1| DNA protecting protein DprA [Escherichia coli MS 45-1] gi|301046056|ref|ZP_07193235.1| DNA protecting protein DprA [Escherichia coli MS 185-1] gi|331659576|ref|ZP_08360514.1| protein smf [Escherichia coli TA206] gi|26110298|gb|AAN82484.1|AE016767_244 Unknown protein fragment 1 [Escherichia coli CFT073] gi|91074286|gb|ABE09167.1| unknown protein [Escherichia coli UTI89] gi|115514692|gb|ABJ02767.1| conserved hypothetical protein [Escherichia coli APEC O1] gi|218367116|emb|CAR04890.1| conserved hypothetical protein [Escherichia coli S88] gi|218429136|emb|CAR10088.2| conserved hypothetical protein [Escherichia coli ED1a] gi|227839561|gb|EEJ50027.1| SMF family Rossmann fold nucleotide-binding protein [Escherichia coli 83972] gi|294490069|gb|ADE88825.1| DNA protecting protein DprA [Escherichia coli IHE3034] gi|300301941|gb|EFJ58326.1| DNA protecting protein DprA [Escherichia coli MS 185-1] gi|300409428|gb|EFJ92966.1| DNA protecting protein DprA [Escherichia coli MS 45-1] gi|307555373|gb|ADN48148.1| DNA protecting protein DprA [Escherichia coli ABU 83972] gi|307628320|gb|ADN72624.1| DNA protecting protein DprA [Escherichia coli UM146] gi|315292339|gb|EFU51691.1| DNA protecting protein DprA [Escherichia coli MS 153-1] gi|315297151|gb|EFU56431.1| DNA protecting protein DprA [Escherichia coli MS 16-3] gi|323950199|gb|EGB46081.1| DNA protecting protein DprA [Escherichia coli H252] gi|324009051|gb|EGB78270.1| DNA protecting protein DprA [Escherichia coli MS 57-2] gi|331052791|gb|EGI24824.1| protein smf [Escherichia coli TA206] Length = 374 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRRHAPLAASLLEQGGALVSEFPL 199 >gi|298291505|ref|YP_003693444.1| DNA protecting protein DprA [Starkeya novella DSM 506] gi|296928016|gb|ADH88825.1| DNA protecting protein DprA [Starkeya novella DSM 506] Length = 369 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D YP EN L+E I G +SE+P G Sbjct: 173 IAGGHDRPYPRENEKLMEAIAAE-GAILSEMPMG 205 >gi|219847449|ref|YP_002461882.1| DNA protecting protein DprA [Chloroflexus aggregans DSM 9485] gi|219541708|gb|ACL23446.1| DNA protecting protein DprA [Chloroflexus aggregans DSM 9485] Length = 362 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP NR L E+I G IS+ P G Sbjct: 173 LACGADRVYPERNRILAEQIV-TAGALISDYPLG 205 >gi|83954521|ref|ZP_00963232.1| DNA processing protein DprA, putative [Sulfitobacter sp. NAS-14.1] gi|83840805|gb|EAP79976.1| DNA processing protein DprA, putative [Sulfitobacter sp. NAS-14.1] Length = 365 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L ++I G+ ISE P G Sbjct: 170 AGGVDVIYPVENTTLAQDIAAQ-GLRISEQPMG 201 >gi|126455418|ref|YP_001064441.1| DNA protecting protein DprA [Burkholderia pseudomallei 1106a] gi|242314805|ref|ZP_04813821.1| DNA protecting protein DprA [Burkholderia pseudomallei 1106b] gi|126229060|gb|ABN92600.1| DNA protecting protein DprA [Burkholderia pseudomallei 1106a] gi|242138044|gb|EES24446.1| DNA protecting protein DprA [Burkholderia pseudomallei 1106b] Length = 434 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 218 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 250 >gi|113476509|ref|YP_722570.1| DNA protecting protein DprA [Trichodesmium erythraeum IMS101] gi|110167557|gb|ABG52097.1| DNA protecting protein DprA [Trichodesmium erythraeum IMS101] Length = 380 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP +N++L E++ G+A+SE P G Sbjct: 178 GNGVDIVYPRQNKSLAEQVVKQ-GLAVSEYPAG 209 >gi|325983535|ref|YP_004295937.1| DNA protecting protein DprA [Nitrosomonas sp. AL212] gi|325533054|gb|ADZ27775.1| DNA protecting protein DprA [Nitrosomonas sp. AL212] Length = 365 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +N L + G ISE P G Sbjct: 174 GTGLDIVYPAKNHPLAHK-LAKEGALISEFPLG 205 >gi|251797454|ref|YP_003012185.1| DNA protecting protein DprA [Paenibacillus sp. JDR-2] gi|247545080|gb|ACT02099.1| DNA protecting protein DprA [Paenibacillus sp. JDR-2] Length = 371 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A +D YPPENR+L ++I G+ +SE P G Sbjct: 177 LASPVDHCYPPENRSLYQQIV-REGLILSESPVG 209 >gi|330861817|emb|CBX71989.1| protein smf [Yersinia enterocolitica W22703] Length = 367 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L EI +GG+ +SE Sbjct: 161 LGSGLENIYPRRHSQLAREIEHHGGVLVSEF 191 >gi|313206318|ref|YP_004045495.1| DNA protecting protein dpra [Riemerella anatipestifer DSM 15868] gi|312445634|gb|ADQ81989.1| DNA protecting protein DprA [Riemerella anatipestifer DSM 15868] gi|315023184|gb|EFT36195.1| Smf protein DNA processing chain A [Riemerella anatipestifer RA-YM] gi|325336237|gb|ADZ12511.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Riemerella anatipestifer RA-GD] Length = 367 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 20/31 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GL +YP +++ L EEI +NGG SE Sbjct: 174 LAHGLHIIYPSKHKILAEEILNNGGALFSEF 204 >gi|87199818|ref|YP_497075.1| DNA processing protein DprA, putative [Novosphingobium aromaticivorans DSM 12444] gi|87135499|gb|ABD26241.1| DNA protecting protein DprA [Novosphingobium aromaticivorans DSM 12444] Length = 375 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YPPE+ +L E+ + G+ I+E+P G Sbjct: 181 IASGIDVTYPPEHGDLQEQ-VAHEGLLIAEMPPG 213 >gi|88855250|ref|ZP_01129915.1| DNA processing factor [marine actinobacterium PHSC20C1] gi|88815778|gb|EAR25635.1| DNA processing factor [marine actinobacterium PHSC20C1] Length = 434 Score = 53.4 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + +LL I +N G ISE+P G Sbjct: 218 LAGGVDRFYPSGHDSLLSRIVEN-GAVISELPCG 250 >gi|262371338|ref|ZP_06064656.1| DNA protecting protein DprA [Acinetobacter johnsonii SH046] gi|262313675|gb|EEY94724.1| DNA protecting protein DprA [Acinetobacter johnsonii SH046] Length = 377 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 M GLD YP +++ L +I +N G I+E Sbjct: 179 MGTGLDLTYPSQHQALRTQILENNGCIITEF 209 >gi|239917443|ref|YP_002957001.1| DNA protecting protein DprA [Micrococcus luteus NCTC 2665] gi|239838650|gb|ACS30447.1| DNA protecting protein DprA [Micrococcus luteus NCTC 2665] Length = 424 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP + +LL + G+ +SE+P G Sbjct: 222 LAGGLDRFYPAGHEDLLRAVMAA-GLLVSEMPPG 254 >gi|332996762|gb|EGK16387.1| DNA protecting protein DprA [Shigella flexneri K-272] gi|333014513|gb|EGK33861.1| DNA protecting protein DprA [Shigella flexneri K-227] Length = 374 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L +++ GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLFEQGGALVSEFPL 199 >gi|332998315|gb|EGK17915.1| DNA protecting protein DprA [Shigella flexneri K-218] Length = 374 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L +++ GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLFEQGGALVSEFPL 199 >gi|307330047|ref|ZP_07609198.1| DNA protecting protein DprA [Streptomyces violaceusniger Tu 4113] gi|306884308|gb|EFN15343.1| DNA protecting protein DprA [Streptomyces violaceusniger Tu 4113] Length = 466 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+E I + G+ ++E+P G Sbjct: 249 LASGVDIPYPRGHAELIERIAEQ-GLVLAELPPG 281 >gi|126439436|ref|YP_001057202.1| DNA protecting protein DprA [Burkholderia pseudomallei 668] gi|126218929|gb|ABN82435.1| DNA protecting protein DprA [Burkholderia pseudomallei 668] Length = 434 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 218 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 250 >gi|332163226|ref|YP_004299803.1| DNA protecting protein DprA [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|325667456|gb|ADZ44100.1| DNA protecting protein DprA [Yersinia enterocolitica subsp. palearctica 105.5R(r)] Length = 373 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L EI +GG+ +SE Sbjct: 167 LGSGLENIYPRRHSQLAREIEHHGGVLVSEF 197 >gi|307243657|ref|ZP_07525798.1| DNA protecting protein DprA [Peptostreptococcus stomatis DSM 17678] gi|306492967|gb|EFM64979.1| DNA protecting protein DprA [Peptostreptococcus stomatis DSM 17678] Length = 418 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M +D +YP N NL +EI D GG+ +SE G Sbjct: 202 MGTSIDNIYPRSNTNLFKEILDQGGLILSETGPG 235 >gi|110679407|ref|YP_682414.1| DNA processing protein DprA, putative [Roseobacter denitrificans OCh 114] gi|109455523|gb|ABG31728.1| DNA processing protein DprA, putative [Roseobacter denitrificans OCh 114] Length = 389 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L + ++ G+ ISE P G Sbjct: 183 AGGVDVIYPAENTELALSMAEH-GLRISEQPMG 214 >gi|115353234|ref|YP_775073.1| DNA protecting protein DprA [Burkholderia ambifaria AMMD] gi|115283222|gb|ABI88739.1| DNA protecting protein DprA [Burkholderia ambifaria AMMD] Length = 422 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP +R L EI G +SE P G Sbjct: 180 IATGADLVYPARHRTLAHEIAAR-GAILSEWPLG 212 >gi|85705143|ref|ZP_01036243.1| DNA processing protein DprA, putative [Roseovarius sp. 217] gi|85670465|gb|EAQ25326.1| DNA processing protein DprA, putative [Roseovarius sp. 217] Length = 342 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YP EN L +I N G+ +SE P G Sbjct: 139 MAGGVDVIYPAENSKLASDILAN-GLRLSEQPIG 171 >gi|123444063|ref|YP_001008033.1| DNA protecting protein DprA [Yersinia enterocolitica subsp. enterocolitica 8081] gi|122091024|emb|CAL13907.1| conserved hypothetical protein [Yersinia enterocolitica subsp. enterocolitica 8081] Length = 373 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L EI +GG+ +SE Sbjct: 167 LGSGLENIYPRRHSQLAREIEHHGGVLVSEF 197 >gi|91226256|ref|ZP_01261096.1| hypothetical protein V12G01_10321 [Vibrio alginolyticus 12G01] gi|91189267|gb|EAS75546.1| hypothetical protein V12G01_10321 [Vibrio alginolyticus 12G01] Length = 329 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 20/31 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GL+ +YP +N+ L EI + G+ I+E Sbjct: 169 LAHGLEKVYPAQNKELASEIVKSNGLLITEY 199 >gi|332749749|gb|EGJ80164.1| DNA protecting protein DprA [Shigella flexneri 4343-70] Length = 285 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L +++ GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLFEQGGALVSEFPL 199 >gi|309791245|ref|ZP_07685776.1| DNA protecting protein DprA [Oscillochloris trichoides DG6] gi|308226671|gb|EFO80368.1| DNA protecting protein DprA [Oscillochloris trichoides DG6] Length = 361 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D YP NR+L I ++ G IS+ P Sbjct: 173 LGSGVDLPYPERNRDLAARISEH-GALISDYPL 204 >gi|159027634|emb|CAO87006.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 382 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D +YP +R L +I G+ ISE P Sbjct: 177 LGTGVDVVYPSRHRQLHADI-QKQGLVISEHP 207 >gi|153834329|ref|ZP_01986996.1| protein smf [Vibrio harveyi HY01] gi|148869337|gb|EDL68351.1| protein smf [Vibrio harveyi HY01] Length = 369 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +R L + + +N G +SE Sbjct: 174 LGSGLEQVYPARHRGLAQRVAEN-GALVSEF 203 >gi|318607708|emb|CBY29206.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Yersinia enterocolitica subsp. palearctica Y11] Length = 373 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L EI +GG+ +SE Sbjct: 167 LGSGLENIYPRRHSQLAREIEHHGGVLVSEF 197 >gi|163803313|ref|ZP_02197191.1| Smf protein [Vibrio sp. AND4] gi|159172883|gb|EDP57722.1| Smf protein [Vibrio sp. AND4] Length = 369 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +R L + + +N G +SE Sbjct: 174 LGSGLEQVYPARHRGLAQRVIEN-GALVSEF 203 >gi|74316030|ref|YP_313770.1| SMF protein [Thiobacillus denitrificans ATCC 25259] gi|74055525|gb|AAZ95965.1| SMF protein [Thiobacillus denitrificans ATCC 25259] Length = 320 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP N+ L E+ N G+ +SE G Sbjct: 136 IGTGLDRIYPARNKALAHELAAN-GLVVSEFALG 168 >gi|75676200|ref|YP_318621.1| SMF protein [Nitrobacter winogradskyi Nb-255] gi|74421070|gb|ABA05269.1| SMF protein [Nitrobacter winogradskyi Nb-255] Length = 372 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP E+ +LL + ++GG ISE+P G Sbjct: 175 LAGGHDRIYPLEHEDLLAAVLESGGA-ISEMPMG 207 >gi|30064607|ref|NP_838778.1| DNA protecting protein DprA [Shigella flexneri 2a str. 2457T] gi|56480309|ref|NP_709073.2| DNA protecting protein DprA [Shigella flexneri 2a str. 301] gi|110807133|ref|YP_690653.1| DNA protecting protein DprA [Shigella flexneri 5 str. 8401] gi|30042866|gb|AAP18589.1| hypothetical protein S3542 [Shigella flexneri 2a str. 2457T] gi|56383860|gb|AAN44780.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] gi|110616681|gb|ABF05348.1| hypothetical protein SFV_3305 [Shigella flexneri 5 str. 8401] gi|281602654|gb|ADA75638.1| putative Rossmann fold nucleotide-binding protein involved in DNA uptake [Shigella flexneri 2002017] gi|313648792|gb|EFS13232.1| DNA protecting protein DprA [Shigella flexneri 2a str. 2457T] gi|332749606|gb|EGJ80023.1| DNA protecting protein DprA [Shigella flexneri K-671] gi|332754008|gb|EGJ84381.1| DNA protecting protein DprA [Shigella flexneri 2747-71] gi|332766531|gb|EGJ96738.1| DNA protecting protein DprA [Shigella flexneri 2930-71] gi|333012292|gb|EGK31673.1| DNA protecting protein DprA [Shigella flexneri K-304] Length = 374 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L +++ GG +SE P Sbjct: 167 LGNGLNTIHPRRHARLAASLFEQGGALVSEFPL 199 >gi|262166816|ref|ZP_06034553.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio mimicus VM223] gi|262026532|gb|EEY45200.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio mimicus VM223] Length = 371 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLTQIYPKQHQGLAERII-TQGALVSEFAP 203 >gi|298529949|ref|ZP_07017351.1| DNA protecting protein DprA [Desulfonatronospira thiodismutans ASO3-1] gi|298509323|gb|EFI33227.1| DNA protecting protein DprA [Desulfonatronospira thiodismutans ASO3-1] Length = 381 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N++L I D+ G+ +SE P G Sbjct: 177 LGTGIDLIYPAINQDLWTHIRDH-GLILSEFPRG 209 >gi|302554439|ref|ZP_07306781.1| DNA processing Smf-family protein [Streptomyces viridochromogenes DSM 40736] gi|302472057|gb|EFL35150.1| DNA processing Smf-family protein [Streptomyces viridochromogenes DSM 40736] Length = 386 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+ I D G+ + E+P G Sbjct: 181 LACGVDRPYPRGHAQLITRIADQ-GLVVGELPPG 213 >gi|313633475|gb|EFS00299.1| DNA protecting protein DprA [Listeria seeligeri FSL N1-067] gi|313638165|gb|EFS03421.1| DNA protecting protein DprA [Listeria seeligeri FSL S4-171] Length = 288 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP +N L +EI G+ +SE Sbjct: 166 LGSGVDNIYPRKNIQLAKEII-RKGLLLSEY 195 >gi|312958122|ref|ZP_07772645.1| DNA processing protein [Pseudomonas fluorescens WH6] gi|311287553|gb|EFQ66111.1| DNA processing protein [Pseudomonas fluorescens WH6] Length = 367 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 15/33 (45%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ YP +R L + G +SE P Sbjct: 181 LGTGLENFYPQRHRRLAAAMIAQGSAVVSEFPL 213 >gi|258626116|ref|ZP_05720967.1| Smf/DprA family protein [Vibrio mimicus VM603] gi|258581642|gb|EEW06540.1| Smf/DprA family protein [Vibrio mimicus VM603] Length = 371 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLTQIYPKQHQGLAERII-TQGALVSEFAP 203 >gi|296120323|ref|YP_003628101.1| DNA protecting protein DprA [Planctomyces limnophilus DSM 3776] gi|296012663|gb|ADG65902.1| DNA protecting protein DprA [Planctomyces limnophilus DSM 3776] Length = 368 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG++ LYP E+ L ++ + G ISE Sbjct: 173 LGGGINQLYPREHIELARQVVEQ-GALISEYAP 204 >gi|26986814|ref|NP_742239.1| DNA protecting protein DprA [Pseudomonas putida KT2440] gi|24981411|gb|AAN65703.1|AE016197_1 smf protein [Pseudomonas putida KT2440] Length = 365 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP +R+L + + DNG +SE P Sbjct: 181 LGTGLQKLYPQRHRDLAQAMIDNGSALVSEYPL 213 >gi|83943948|ref|ZP_00956405.1| DNA processing protein DprA, putative [Sulfitobacter sp. EE-36] gi|83845195|gb|EAP83075.1| DNA processing protein DprA, putative [Sulfitobacter sp. EE-36] Length = 365 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L ++I G+ ISE P G Sbjct: 170 AGGVDVIYPVENTTLAQDIAAQ-GLRISEQPMG 201 >gi|254182255|ref|ZP_04888852.1| DNA protecting protein DprA [Burkholderia pseudomallei 1655] gi|184212793|gb|EDU09836.1| DNA protecting protein DprA [Burkholderia pseudomallei 1655] Length = 434 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 218 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 250 >gi|326387674|ref|ZP_08209280.1| DNA processing protein DprA, putative [Novosphingobium nitrogenifigens DSM 19370] gi|326207720|gb|EGD58531.1| DNA processing protein DprA, putative [Novosphingobium nitrogenifigens DSM 19370] Length = 383 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YPP++ L E I G+ ++E+P G Sbjct: 182 IAGGIDVAYPPDHAALQERIAAE-GLLVAEMPPG 214 >gi|262172814|ref|ZP_06040492.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio mimicus MB-451] gi|261893890|gb|EEY39876.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio mimicus MB-451] Length = 371 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLTQIYPKQHQGLAERII-TQGALVSEFAP 203 >gi|269792957|ref|YP_003317861.1| DNA protecting protein DprA [Thermanaerovibrio acidaminovorans DSM 6589] gi|269100592|gb|ACZ19579.1| DNA protecting protein DprA [Thermanaerovibrio acidaminovorans DSM 6589] Length = 361 Score = 53.4 bits (129), Expect = 1e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D ++P ++R L E + G +SE P G Sbjct: 175 LGNGVDVVFPADHRELFE-LVARDGCLVSEYPLG 207 >gi|34335037|gb|AAQ65012.1| unknown [synthetic construct] gi|301159282|emb|CBW18797.1| putative competence protein [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|323131067|gb|ADX18497.1| putative competence protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] Length = 325 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GL+ P +N L +I +NGG +SE P G Sbjct: 178 LAHGLELAKPKQNAKLARDILENGGAWMSEYPVG 211 >gi|217424972|ref|ZP_03456468.1| DNA protecting protein DprA [Burkholderia pseudomallei 576] gi|217391992|gb|EEC32018.1| DNA protecting protein DprA [Burkholderia pseudomallei 576] Length = 434 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 218 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 250 >gi|167843766|ref|ZP_02469274.1| DNA protecting protein DprA [Burkholderia pseudomallei B7210] Length = 396 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 180 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 212 >gi|313496441|gb|ADR57807.1| DprA [Pseudomonas putida BIRD-1] Length = 365 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP +R+L + + DNG +SE P Sbjct: 181 LGTGLQKLYPQRHRDLAQAMIDNGSALVSEYPL 213 >gi|237810336|ref|YP_002894787.1| DNA protecting protein DprA [Burkholderia pseudomallei MSHR346] gi|254197171|ref|ZP_04903594.1| DNA protecting protein DprA [Burkholderia pseudomallei S13] gi|169653913|gb|EDS86606.1| DNA protecting protein DprA [Burkholderia pseudomallei S13] gi|237503399|gb|ACQ95717.1| DNA protecting protein DprA [Burkholderia pseudomallei MSHR346] Length = 434 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 218 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 250 >gi|134284081|ref|ZP_01770775.1| DNA protecting protein DprA [Burkholderia pseudomallei 305] gi|134244533|gb|EBA44637.1| DNA protecting protein DprA [Burkholderia pseudomallei 305] Length = 434 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 218 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 250 >gi|302865902|ref|YP_003834539.1| DNA protecting protein DprA [Micromonospora aurantiaca ATCC 27029] gi|302568761|gb|ADL44963.1| DNA protecting protein DprA [Micromonospora aurantiaca ATCC 27029] Length = 393 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP N L + I + G+ +SE G Sbjct: 191 LACGVDRPYPMGNAALFDRIAET-GLLVSEWIPG 223 >gi|116494885|ref|YP_806619.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus casei ATCC 334] gi|116105035|gb|ABJ70177.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus casei ATCC 334] Length = 271 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A GLD +YP +NR+L +I + G+ +SE P Sbjct: 152 IANGLDQVYPAKNRDLQVQI-AHVGLVLSEYPP 183 >gi|269962642|ref|ZP_06176987.1| conserved hypothetical protein [Vibrio harveyi 1DA3] gi|269832565|gb|EEZ86679.1| conserved hypothetical protein [Vibrio harveyi 1DA3] Length = 369 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +R L + + +N G +SE Sbjct: 174 LGSGLEQVYPARHRGLAQRVMEN-GALVSEF 203 >gi|239631516|ref|ZP_04674547.1| rossmann nucleotide-binding protein for DNA uptake [Lactobacillus paracasei subsp. paracasei 8700:2] gi|239525981|gb|EEQ64982.1| rossmann nucleotide-binding protein for DNA uptake [Lactobacillus paracasei subsp. paracasei 8700:2] Length = 289 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A GLD +YP +NR+L +I + G+ +SE P Sbjct: 170 IANGLDQVYPAKNRDLQVQI-AHVGLVLSEYPP 201 >gi|156972724|ref|YP_001443631.1| nucleotide-binding protein [Vibrio harveyi ATCC BAA-1116] gi|156524318|gb|ABU69404.1| hypothetical protein VIBHAR_00389 [Vibrio harveyi ATCC BAA-1116] Length = 369 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +R L + + +N G +SE Sbjct: 174 LGSGLEQVYPARHRGLAQRVAEN-GALVSEF 203 >gi|254360309|ref|ZP_04976579.1| DNA protecting protein DprA [Burkholderia mallei 2002721280] gi|148029549|gb|EDK87454.1| DNA protecting protein DprA [Burkholderia mallei 2002721280] Length = 434 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 218 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 250 >gi|121598283|ref|YP_994103.1| DNA protecting protein DprA [Burkholderia mallei SAVP1] gi|126448750|ref|YP_001081877.1| DNA protecting protein DprA [Burkholderia mallei NCTC 10247] gi|238561913|ref|ZP_00441208.2| DNA protecting protein DprA [Burkholderia mallei GB8 horse 4] gi|251767986|ref|ZP_02269085.2| DNA protecting protein DprA [Burkholderia mallei PRL-20] gi|254203662|ref|ZP_04910022.1| DNA protecting protein DprA [Burkholderia mallei FMH] gi|121227093|gb|ABM49611.1| DNA protecting protein DprA [Burkholderia mallei SAVP1] gi|126241620|gb|ABO04713.1| DNA protecting protein DprA [Burkholderia mallei NCTC 10247] gi|147745174|gb|EDK52254.1| DNA protecting protein DprA [Burkholderia mallei FMH] gi|238523607|gb|EEP87044.1| DNA protecting protein DprA [Burkholderia mallei GB8 horse 4] gi|243061152|gb|EES43338.1| DNA protecting protein DprA [Burkholderia mallei PRL-20] Length = 434 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 218 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 250 >gi|332799163|ref|YP_004460662.1| DNA protecting protein DprA [Tepidanaerobacter sp. Re1] gi|332696898|gb|AEE91355.1| DNA protecting protein DprA [Tepidanaerobacter sp. Re1] Length = 364 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPPEN +L++EI G IS P G Sbjct: 173 GCGIDIIYPPENISLMKEILKC-GCVISSFPLG 204 >gi|315186397|gb|EFU20157.1| DNA protecting protein DprA [Spirochaeta thermophila DSM 6578] Length = 340 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP +R L I + GG ISE Sbjct: 172 LGSGLCELYPRHHRRLAIRIVEAGGALISEYAP 204 >gi|308447376|ref|XP_003087416.1| hypothetical protein CRE_14455 [Caenorhabditis remanei] gi|308256659|gb|EFP00612.1| hypothetical protein CRE_14455 [Caenorhabditis remanei] Length = 561 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP +NR L E+I + G ++E Sbjct: 179 IGTGLDLVYPSQNRQLQEQILQHSGTILTEY 209 >gi|281414066|ref|ZP_06245808.1| DNA protecting protein DprA [Micrococcus luteus NCTC 2665] Length = 319 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP + +LL + G+ +SE+P G Sbjct: 117 LAGGLDRFYPAGHEDLLRAVMAA-GLLVSEMPPG 149 >gi|269958987|ref|YP_003328776.1| putativeDNA recombination-mediator protein A [Anaplasma centrale str. Israel] gi|269848818|gb|ACZ49462.1| putativeDNA recombination-mediator protein A [Anaplasma centrale str. Israel] Length = 378 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 22/32 (68%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP +N +L I NGG+ ++E+PF Sbjct: 176 ANGIDVVYPKDNLHLYRAIVHNGGVVVTELPF 207 >gi|152965377|ref|YP_001361161.1| DNA protecting protein DprA [Kineococcus radiotolerans SRS30216] gi|151359894|gb|ABS02897.1| DNA protecting protein DprA [Kineococcus radiotolerans SRS30216] Length = 395 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YPP N LL + + G +SE+P G Sbjct: 199 LACGVDRSYPPGNAALLARLAER-GALVSEVPPG 231 >gi|307718590|ref|YP_003874122.1| DNA processing protein DprA [Spirochaeta thermophila DSM 6192] gi|306532315|gb|ADN01849.1| putative DNA processing protein DprA [Spirochaeta thermophila DSM 6192] Length = 340 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP +R L I + GG ISE Sbjct: 172 LGSGLCELYPRHHRRLAIRIVEAGGALISEYAP 204 >gi|261213227|ref|ZP_05927509.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio sp. RC341] gi|260837501|gb|EEX64204.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio sp. RC341] Length = 371 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L + I G +SE Sbjct: 172 LGSGLTHIYPKQHQALAQRIL-TQGALVSEFAP 203 >gi|323524422|ref|YP_004226575.1| DNA protecting protein DprA [Burkholderia sp. CCGE1001] gi|323381424|gb|ADX53515.1| DNA protecting protein DprA [Burkholderia sp. CCGE1001] Length = 448 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L +I G +SE P G Sbjct: 180 IGTGADLVYPSAHHALARQIAAQ-GAILSEWPLG 212 >gi|262402046|ref|ZP_06078610.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio sp. RC586] gi|262351692|gb|EEZ00824.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio sp. RC586] Length = 371 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L E I G +SE Sbjct: 172 LGSGLTQIYPKQHQGLAERII-TQGALVSEFAP 203 >gi|320195377|gb|EFW70004.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Escherichia coli WV_060327] Length = 374 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ ++P + L + + GG +SE P Sbjct: 167 LGNGLNTIHPRSHAPLAASLLEQGGALVSEFPL 199 >gi|307151412|ref|YP_003886796.1| DNA protecting protein DprA [Cyanothece sp. PCC 7822] gi|306981640|gb|ADN13521.1| DNA protecting protein DprA [Cyanothece sp. PCC 7822] Length = 402 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP +R L +EI G+ +SE G Sbjct: 203 LGTGVDIAYPSSHRQLHQEI-QQQGLLLSEYSQG 235 >gi|167746953|ref|ZP_02419080.1| hypothetical protein ANACAC_01665 [Anaerostipes caccae DSM 14662] gi|317471764|ref|ZP_07931103.1| DNA recombination-mediator protein A [Anaerostipes sp. 3_2_56FAA] gi|167653913|gb|EDR98042.1| hypothetical protein ANACAC_01665 [Anaerostipes caccae DSM 14662] gi|316900741|gb|EFV22716.1| DNA recombination-mediator protein A [Anaerostipes sp. 3_2_56FAA] Length = 359 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP ++ L + + G+ SE G Sbjct: 169 LGCGIDRIYPKVHQKLFAD-VEKQGVIYSEYGPG 201 >gi|76808666|ref|YP_331760.1| SMF family protein [Burkholderia pseudomallei 1710b] gi|226194651|ref|ZP_03790246.1| DNA protecting protein DprA [Burkholderia pseudomallei Pakistan 9] gi|254188220|ref|ZP_04894732.1| DNA protecting protein DprA [Burkholderia pseudomallei Pasteur 52237] gi|254261973|ref|ZP_04953027.1| DNA protecting protein DprA [Burkholderia pseudomallei 1710a] gi|254295704|ref|ZP_04963161.1| DNA protecting protein DprA [Burkholderia pseudomallei 406e] gi|76578119|gb|ABA47594.1| SMF family protein [Burkholderia pseudomallei 1710b] gi|157806182|gb|EDO83352.1| DNA protecting protein DprA [Burkholderia pseudomallei 406e] gi|157935900|gb|EDO91570.1| DNA protecting protein DprA [Burkholderia pseudomallei Pasteur 52237] gi|225933352|gb|EEH29344.1| DNA protecting protein DprA [Burkholderia pseudomallei Pakistan 9] gi|254220662|gb|EET10046.1| DNA protecting protein DprA [Burkholderia pseudomallei 1710a] Length = 434 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 218 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 250 >gi|167900761|ref|ZP_02487966.1| DNA protecting protein DprA [Burkholderia pseudomallei NCTC 13177] Length = 396 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 180 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 212 >gi|163733552|ref|ZP_02140995.1| DNA processing protein DprA, putative [Roseobacter litoralis Och 149] gi|161393340|gb|EDQ17666.1| DNA processing protein DprA, putative [Roseobacter litoralis Och 149] Length = 358 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L + ++ G+ +SE P G Sbjct: 154 AGGVDVIYPAENTELALSMAEH-GLRVSEQPMG 185 >gi|191638396|ref|YP_001987562.1| DNA processing protein [Lactobacillus casei BL23] gi|190712698|emb|CAQ66704.1| DNA processing protein [Lactobacillus casei BL23] gi|327382425|gb|AEA53901.1| DNA processing protein DprA, putative [Lactobacillus casei LC2W] gi|327385625|gb|AEA57099.1| DNA processing protein DprA, putative [Lactobacillus casei BD-II] Length = 271 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A GLD +YP +NR+L +I + G+ +SE P Sbjct: 152 IANGLDQVYPAKNRDLQVQI-AHVGLVLSEYPP 183 >gi|91205528|ref|YP_537883.1| putative DNA processing protein DprA [Rickettsia bellii RML369-C] gi|91069072|gb|ABE04794.1| Putative DNA processing protein DprA [Rickettsia bellii RML369-C] Length = 225 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPPEN+ L E + + G+ I+E+P G Sbjct: 13 IAGGIDHIYPPENKKLFENLAEE-GLIIAELPVG 45 >gi|315122272|ref|YP_004062761.1| hypothetical protein CKC_02620 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495674|gb|ADR52273.1| hypothetical protein CKC_02620 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 298 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGGLDCLYPPENR+LLEEIW + GIAISE+PFG Sbjct: 179 MAGGLDCLYPPENRSLLEEIW-HEGIAISEMPFG 211 >gi|296117639|ref|ZP_06836223.1| smf family protein [Corynebacterium ammoniagenes DSM 20306] gi|295969370|gb|EFG82611.1| smf family protein [Corynebacterium ammoniagenes DSM 20306] Length = 387 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G+D YP N L E I G +SE G Sbjct: 188 ACGIDYDYPARNAPLFERI-ARTGTIVSEFAPG 219 >gi|163791332|ref|ZP_02185745.1| DNA processing protein DprA, putative [Carnobacterium sp. AT7] gi|159873411|gb|EDP67502.1| DNA processing protein DprA, putative [Carnobacterium sp. AT7] Length = 289 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN L +EI N + ISE P G Sbjct: 172 IGTGLDQFYPFENEKLQKEIAKNH-LLISEYPLG 204 >gi|149375616|ref|ZP_01893385.1| probable smf protein [Marinobacter algicola DG893] gi|149360018|gb|EDM48473.1| probable smf protein [Marinobacter algicola DG893] Length = 388 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP +R L E I G+ +SE P G Sbjct: 192 IGNGVDKPYPYRHRTLSERIAGE-GVIVSEYPPG 224 >gi|291545339|emb|CBL18447.1| DNA protecting protein DprA [Ruminococcus sp. SR1/5] Length = 235 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP +R + I + G ISE G Sbjct: 104 LGNGVDICYPSSSRGIYRRIPEKNGGIISEYEPG 137 >gi|71066689|ref|YP_265416.1| DNA processing protein [Psychrobacter arcticus 273-4] gi|71039674|gb|AAZ19982.1| possible DNA processing protein [Psychrobacter arcticus 273-4] Length = 405 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 M G+D YP + L +I + GG ISE+ Sbjct: 185 MGTGIDVNYPNHHDQLFSQIIEKGGCIISEL 215 >gi|152978247|ref|YP_001343876.1| DNA protecting protein DprA [Actinobacillus succinogenes 130Z] gi|150839970|gb|ABR73941.1| DNA protecting protein DprA [Actinobacillus succinogenes 130Z] Length = 376 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP NR L + I DN G ++E Sbjct: 170 LGNGLNQIYPAVNRKLAQAILDNDGTLVTEF 200 >gi|330806736|ref|YP_004351198.1| hypothetical protein PSEBR_a72 [Pseudomonas brassicacearum subsp. brassicacearum NFM421] gi|327374844|gb|AEA66194.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp. brassicacearum NFM421] Length = 364 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ YP NR L + + G +SE P Sbjct: 181 LGTGLENFYPQRNRRLADAMIAQGSAVLSEFPL 213 >gi|229829215|ref|ZP_04455284.1| hypothetical protein GCWU000342_01302 [Shuttleworthia satelles DSM 14600] gi|229792378|gb|EEP28492.1| hypothetical protein GCWU000342_01302 [Shuttleworthia satelles DSM 14600] Length = 385 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G D +YP EN L + I + G S+ P Sbjct: 191 LGCGADIVYPKENWILYDRIVET-GCLFSKYPP 222 >gi|227504795|ref|ZP_03934844.1| DNA processing protein [Corynebacterium striatum ATCC 6940] gi|227198645|gb|EEI78693.1| DNA processing protein [Corynebacterium striatum ATCC 6940] Length = 392 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP N L ++I G ISE G Sbjct: 194 PCGIDRAYPARNGKLFDQIT-RSGCLISEFALG 225 >gi|166363019|ref|YP_001655292.1| SMF family DNA processing protein [Microcystis aeruginosa NIES-843] gi|166085392|dbj|BAG00100.1| SMF family DNA processing protein [Microcystis aeruginosa NIES-843] Length = 382 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D +YP +R L +I G+ ISE P Sbjct: 177 LGTGVDVVYPSRHRQLHADI-QKQGLVISEHP 207 >gi|328957577|ref|YP_004374963.1| DNA processing Smf single strand binding protein [Carnobacterium sp. 17-4] gi|328673901|gb|AEB29947.1| DNA processing Smf single strand binding protein [Carnobacterium sp. 17-4] Length = 289 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN +L EI N + ISE P G Sbjct: 172 IGTGLDHYYPFENESLQREIAKNH-LLISEYPLG 204 >gi|220907030|ref|YP_002482341.1| DNA protecting protein DprA [Cyanothece sp. PCC 7425] gi|219863641|gb|ACL43980.1| DNA protecting protein DprA [Cyanothece sp. PCC 7425] Length = 370 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 G+D +YPP N+ L E+I G+ +SE P Sbjct: 178 GTGVDLVYPPRNKFLYEKIL-QQGLVLSEYP 207 >gi|157827244|ref|YP_001496308.1| putative DNA processing protein DprA [Rickettsia bellii OSU 85-389] gi|157802548|gb|ABV79271.1| Putative DNA processing protein DprA [Rickettsia bellii OSU 85-389] Length = 223 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPPEN+ L E + + G+ I+E+P G Sbjct: 13 IAGGIDHIYPPENKKLFENLAEE-GLIIAELPVG 45 >gi|256827137|ref|YP_003151096.1| DNA protecting protein DprA [Cryptobacterium curtum DSM 15641] gi|256583280|gb|ACU94414.1| DNA protecting protein DprA [Cryptobacterium curtum DSM 15641] Length = 328 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GG D YPP + L +EI +NGG +SE Sbjct: 124 LGGGCDQPYPPSHVPLFQEIINNGGAIVSE 153 >gi|170783520|ref|YP_001742013.1| putative smf family protein [Arthrobacter sp. AK-1] gi|150035007|gb|ABR67018.1| putative smf family protein [Arthrobacter sp. AK-1] Length = 399 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP N +L I N G+ +SE+P G Sbjct: 281 LAGGLDRDYPSGNADLAAAIRAN-GLTLSELPPG 313 >gi|301066446|ref|YP_003788469.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus casei str. Zhang] gi|300438853|gb|ADK18619.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus casei str. Zhang] Length = 271 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A GLD +YP +NR+L +I + G+ +SE P Sbjct: 152 IANGLDQVYPAKNRDLQVQI-AHVGLVLSEYPP 183 >gi|56964044|ref|YP_175775.1| Smf family DNA processing protein [Bacillus clausii KSM-K16] gi|56910287|dbj|BAD64814.1| Smf family DNA processing protein [Bacillus clausii KSM-K16] Length = 303 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G D +YPPE+ L + ++ + +SE P Sbjct: 175 LGSGFDNIYPPEHSTLFHALAEHQ-LLLSEYPP 206 >gi|269966997|ref|ZP_06181067.1| Smf protein [Vibrio alginolyticus 40B] gi|269828391|gb|EEZ82655.1| Smf protein [Vibrio alginolyticus 40B] Length = 369 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP +R L + + ++ G +SE Sbjct: 174 LGSGLANIYPARHRGLAQRVIEH-GALVSEF 203 >gi|91226305|ref|ZP_01261145.1| Smf protein [Vibrio alginolyticus 12G01] gi|91189316|gb|EAS75595.1| Smf protein [Vibrio alginolyticus 12G01] Length = 369 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP +R L + + ++ G +SE Sbjct: 174 LGSGLANIYPARHRGLAQRVIEH-GALVSEF 203 >gi|288941785|ref|YP_003444025.1| DNA protecting protein DprA [Allochromatium vinosum DSM 180] gi|288897157|gb|ADC62993.1| DNA protecting protein DprA [Allochromatium vinosum DSM 180] Length = 377 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP +R+L + + G+ +SE+P G Sbjct: 177 LGTGPDRVYPAVHRDLARRLVER-GVMVSELPPG 209 >gi|227535117|ref|ZP_03965166.1| DNA processing protein [Lactobacillus paracasei subsp. paracasei ATCC 25302] gi|227187258|gb|EEI67325.1| DNA processing protein [Lactobacillus paracasei subsp. paracasei ATCC 25302] Length = 271 Score = 53.0 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A GLD +YP +NR+L +I + G+ +SE P Sbjct: 152 IANGLDQVYPAKNRDLQVQI-AHVGLVLSEYPP 183 >gi|330719080|ref|ZP_08313680.1| DNA processing protein [Leuconostoc fallax KCTC 3537] Length = 293 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP NR L +I G+ +SE G Sbjct: 172 IGTGIDQFYPASNRQLQSQI-ARSGLVLSEYAPG 204 >gi|309810346|ref|ZP_07704181.1| putative DNA protecting protein DprA [Dermacoccus sp. Ellin185] gi|308435659|gb|EFP59456.1| putative DNA protecting protein DprA [Dermacoccus sp. Ellin185] Length = 283 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP + LL +I D G+ +SE+P G Sbjct: 197 LAGGLDRPYPAGHHELLNQIGD-VGLLVSELPPG 229 >gi|172037937|ref|YP_001804438.1| DNA processing protein [Cyanothece sp. ATCC 51142] gi|171699391|gb|ACB52372.1| DNA processing protein [Cyanothece sp. ATCC 51142] Length = 374 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +R L + G+ ISE P G Sbjct: 177 LGTGVDMVYPSHHRQLHRD-LQKDGLIISEYPAG 209 >gi|70733537|ref|YP_257176.1| smf protein [Pseudomonas fluorescens Pf-5] gi|68347836|gb|AAY95442.1| smf protein [Pseudomonas fluorescens Pf-5] Length = 364 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ YP +R L + D G +SE P Sbjct: 177 LGTGLENFYPQRHRALARAMIDQGSAVVSEFPL 209 >gi|67458923|ref|YP_246547.1| putative DNA processing protein DprA [Rickettsia felis URRWXCal2] gi|67004456|gb|AAY61382.1| Putatie DNA processing protein DprA [Rickettsia felis URRWXCal2] Length = 382 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPPEN+ L E + + G+ ++E+P G Sbjct: 177 IAGGIDHIYPPENKKLFENLAEE-GLILAELPIG 209 >gi|28899814|ref|NP_799419.1| Smf protein [Vibrio parahaemolyticus RIMD 2210633] gi|153837670|ref|ZP_01990337.1| protein smf [Vibrio parahaemolyticus AQ3810] gi|260362020|ref|ZP_05775025.1| DNA-processing protein Smf [Vibrio parahaemolyticus K5030] gi|260876493|ref|ZP_05888848.1| DNA-processing protein Smf [Vibrio parahaemolyticus AN-5034] gi|260897450|ref|ZP_05905946.1| DNA-processing protein Smf [Vibrio parahaemolyticus Peru-466] gi|260901341|ref|ZP_05909736.1| DNA-processing protein Smf [Vibrio parahaemolyticus AQ4037] gi|28808066|dbj|BAC61303.1| Smf protein [Vibrio parahaemolyticus RIMD 2210633] gi|149748960|gb|EDM59787.1| protein smf [Vibrio parahaemolyticus AQ3810] gi|308087925|gb|EFO37620.1| DNA-processing protein Smf [Vibrio parahaemolyticus Peru-466] gi|308090386|gb|EFO40081.1| DNA-processing protein Smf [Vibrio parahaemolyticus AN-5034] gi|308109879|gb|EFO47419.1| DNA-processing protein Smf [Vibrio parahaemolyticus AQ4037] gi|308114175|gb|EFO51715.1| DNA-processing protein Smf [Vibrio parahaemolyticus K5030] Length = 370 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +R+L + + +N G +SE Sbjct: 175 LGSGLEHIYPARHRSLAQRVTEN-GALVSEF 204 >gi|158313010|ref|YP_001505518.1| DNA protecting protein DprA [Frankia sp. EAN1pec] gi|158108415|gb|ABW10612.1| DNA protecting protein DprA [Frankia sp. EAN1pec] Length = 408 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + +LL+EI + G+ +SE P G Sbjct: 184 LAGGVDVPYPAAHADLLDEIAAS-GLVLSETPPG 216 >gi|332711096|ref|ZP_08431030.1| DNA protecting protein DprA [Lyngbya majuscula 3L] gi|332350078|gb|EGJ29684.1| DNA protecting protein DprA [Lyngbya majuscula 3L] Length = 377 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + GLD +YP N L ++I + G+ ISE P Sbjct: 179 LGTGLDVVYPLSNSYLYKQIQEQ-GLVISEYP 209 >gi|327309882|ref|YP_004336780.1| SMF family protein [Pseudonocardia dioxanivorans CB1190] gi|326955217|gb|AEA28913.1| SMF family protein [Pseudonocardia dioxanivorans CB1190] Length = 324 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP + NLL+ I + G+ +S P G Sbjct: 190 LGCGIDRAYPAAHENLLDRI-AHTGLLVSAQPPG 222 >gi|239928676|ref|ZP_04685629.1| DNA processing Smf-family protein [Streptomyces ghanaensis ATCC 14672] gi|291437000|ref|ZP_06576390.1| DNA processing Smf-family protein [Streptomyces ghanaensis ATCC 14672] gi|291339895|gb|EFE66851.1| DNA processing Smf-family protein [Streptomyces ghanaensis ATCC 14672] Length = 386 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+ I + G+ I E+P G Sbjct: 181 LACGVDRPYPRGHTGLITRIAEQ-GLVIGELPPG 213 >gi|328471165|gb|EGF42067.1| Smf protein [Vibrio parahaemolyticus 10329] Length = 370 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +R+L + + +N G +SE Sbjct: 175 LGSGLEHIYPARHRSLAQRVTEN-GALVSEF 204 >gi|255020220|ref|ZP_05292289.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Acidithiobacillus caldus ATCC 51756] gi|254970362|gb|EET27855.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Acidithiobacillus caldus ATCC 51756] Length = 364 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP E+ L I D G+ +SE G Sbjct: 168 LATGPDIVYPREHLELAHRILDA-GLLVSEQAPG 200 >gi|170718904|ref|YP_001784075.1| DNA protecting protein DprA [Haemophilus somnus 2336] gi|168827033|gb|ACA32404.1| DNA protecting protein DprA [Haemophilus somnus 2336] Length = 368 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 21/31 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GGL+ LYP +++ L +++ D GG +SE Sbjct: 170 LGGGLEELYPKQHKKLAQQMLDYGGALVSEF 200 >gi|269468580|gb|EEZ80229.1| SMF protein [uncultured SUP05 cluster bacterium] Length = 362 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ++++L +I G +SE G Sbjct: 171 GTGLDRIYPAKHKSLAHQI-SLKGALVSEFCIG 202 >gi|226227307|ref|YP_002761413.1| putative DNA processing chain A [Gemmatimonas aurantiaca T-27] gi|226090498|dbj|BAH38943.1| putative DNA processing chain A [Gemmatimonas aurantiaca T-27] Length = 348 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP +R L E I + G+ +SE G Sbjct: 161 LGTGIDITYPKSHRLLQERI-AHEGLVLSEQTPG 193 >gi|220904239|ref|YP_002479551.1| DNA protecting protein DprA [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] gi|219868538|gb|ACL48873.1| DNA protecting protein DprA [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] Length = 442 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP NR + + + G+ +SE G Sbjct: 184 LGTGIDVVYPSVNRKIFG-MMEQQGLLVSEFMPG 216 >gi|29829173|ref|NP_823807.1| DNA processing Smf-family protein [Streptomyces avermitilis MA-4680] gi|29606279|dbj|BAC70342.1| putative DNA processing Smf-family protein [Streptomyces avermitilis MA-4680] Length = 381 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+ I + G+ + E+P G Sbjct: 176 LACGVDQPYPRGHTELITRIAEQ-GLVVGELPPG 208 >gi|296134587|ref|YP_003641829.1| DNA protecting protein DprA [Thiomonas intermedia K12] gi|295794709|gb|ADG29499.1| DNA protecting protein DprA [Thiomonas intermedia K12] Length = 379 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YPP ++ L + D G+ +SE G Sbjct: 181 LGTGCDRVYPPRHKELAHLMADR-GLLLSEFALG 213 >gi|53724673|ref|YP_101981.1| DNA processing protein DprA [Burkholderia mallei ATCC 23344] gi|124383553|ref|YP_001028236.1| DNA protecting protein DprA [Burkholderia mallei NCTC 10229] gi|254177084|ref|ZP_04883741.1| DNA protecting protein DprA [Burkholderia mallei ATCC 10399] gi|254208637|ref|ZP_04914985.1| DNA protecting protein DprA [Burkholderia mallei JHU] gi|52428096|gb|AAU48689.1| DNA processing protein DprA, putative [Burkholderia mallei ATCC 23344] gi|124291573|gb|ABN00842.1| DNA protecting protein DprA [Burkholderia mallei NCTC 10229] gi|147750513|gb|EDK57582.1| DNA protecting protein DprA [Burkholderia mallei JHU] gi|160698125|gb|EDP88095.1| DNA protecting protein DprA [Burkholderia mallei ATCC 10399] Length = 396 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 180 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 212 >gi|289764615|ref|ZP_06523993.1| smf protein [Fusobacterium sp. D11] gi|289716170|gb|EFD80182.1| smf protein [Fusobacterium sp. D11] Length = 288 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP N +L EI + G+ +SE G Sbjct: 103 IASGLDIVYPASNLSLYREI-EEKGLILSEYEAG 135 >gi|260494674|ref|ZP_05814804.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_33] gi|260197836|gb|EEW95353.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_33] Length = 288 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP N +L EI + G+ +SE G Sbjct: 103 IASGLDIVYPASNLSLYREI-EEKGLILSEYEAG 135 >gi|256026614|ref|ZP_05440448.1| Smf protein [Fusobacterium sp. D11] Length = 284 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP N +L EI + G+ +SE G Sbjct: 99 IASGLDIVYPASNLSLYREI-EEKGLILSEYEAG 131 >gi|237744892|ref|ZP_04575373.1| SMF family protein [Fusobacterium sp. 7_1] gi|229432121|gb|EEO42333.1| SMF family protein [Fusobacterium sp. 7_1] Length = 288 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP N +L EI + G+ +SE G Sbjct: 103 IASGLDIVYPASNLSLYREI-EEKGLILSEYEAG 135 >gi|113460558|ref|YP_718622.1| DNA processing chain A [Haemophilus somnus 129PT] gi|112822601|gb|ABI24690.1| DNA processing chain A [Haemophilus somnus 129PT] Length = 368 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 21/31 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GGL+ LYP +++ L +++ D GG +SE Sbjct: 170 LGGGLEELYPKQHKKLAQQMLDYGGALVSEF 200 >gi|282854572|ref|ZP_06263907.1| DNA protecting protein DprA [Propionibacterium acnes J139] gi|282582154|gb|EFB87536.1| DNA protecting protein DprA [Propionibacterium acnes J139] gi|314981836|gb|EFT25929.1| DNA protecting protein DprA [Propionibacterium acnes HL110PA3] gi|315090701|gb|EFT62677.1| DNA protecting protein DprA [Propionibacterium acnes HL110PA4] Length = 377 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G ISE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALISELPPG 210 >gi|254780304|ref|YP_003064717.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] gi|254039981|gb|ACT56777.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] Length = 34 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 34/34 (100%), Positives = 34/34 (100%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG Sbjct: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 >gi|283798137|ref|ZP_06347290.1| DNA processing protein DprA [Clostridium sp. M62/1] gi|291074116|gb|EFE11480.1| DNA processing protein DprA [Clostridium sp. M62/1] Length = 364 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D YP E+ L E I GG I+E Sbjct: 173 LGCGIDICYPREHTELAERIGLQGG-LITEF 202 >gi|167917027|ref|ZP_02504118.1| DNA protecting protein DprA [Burkholderia pseudomallei BCC215] Length = 396 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 180 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 212 >gi|260583824|ref|ZP_05851572.1| DNA protecting protein DprA [Granulicatella elegans ATCC 700633] gi|260158450|gb|EEW93518.1| DNA protecting protein DprA [Granulicatella elegans ATCC 700633] Length = 288 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ YP EN+ L + I G+ +SE P Sbjct: 169 IGNGINICYPKENKALYDAI-GRKGLILSEYPL 200 >gi|217077870|ref|YP_002335588.1| DNA protecting protein DprA [Thermosipho africanus TCF52B] gi|217037725|gb|ACJ76247.1| DNA protecting protein DprA [Thermosipho africanus TCF52B] Length = 266 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D YP +N+ + ++I G ISE Sbjct: 138 LGCGVDICYPKQNKYIYDKISKE-GCLISEY 167 >gi|53717761|ref|YP_106747.1| SMF family protein [Burkholderia pseudomallei K96243] gi|167813631|ref|ZP_02445311.1| DNA protecting protein DprA [Burkholderia pseudomallei 91] gi|52208175|emb|CAH34106.1| SMF family protein [Burkholderia pseudomallei K96243] Length = 396 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 180 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 212 >gi|167736557|ref|ZP_02409331.1| DNA protecting protein DprA [Burkholderia pseudomallei 14] gi|167822175|ref|ZP_02453646.1| DNA protecting protein DprA [Burkholderia pseudomallei 9] gi|167892268|ref|ZP_02479670.1| DNA protecting protein DprA [Burkholderia pseudomallei 7894] gi|167908985|ref|ZP_02496076.1| DNA protecting protein DprA [Burkholderia pseudomallei 112] Length = 396 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 180 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 212 >gi|226952178|ref|ZP_03822642.1| Rossmann-fold nucleotide-binding protein involved in DNA uptake (Smf) [Acinetobacter sp. ATCC 27244] gi|226837016|gb|EEH69399.1| Rossmann-fold nucleotide-binding protein involved in DNA uptake (Smf) [Acinetobacter sp. ATCC 27244] Length = 364 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GLD +YP ++ L ++I G ISE Sbjct: 168 GTGLDRVYPAQHVQLAQQI-AQSGAIISEF 196 >gi|317121806|ref|YP_004101809.1| DNA protecting protein DprA [Thermaerobacter marianensis DSM 12885] gi|315591786|gb|ADU51082.1| DNA protecting protein DprA [Thermaerobacter marianensis DSM 12885] Length = 314 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP E+R L++ + G ++E P G Sbjct: 172 LGHGPDRVYPEEHRALMDRMAAT-GWLVAEYPPG 204 >gi|295091717|emb|CBK77824.1| DNA protecting protein DprA [Clostridium cf. saccharolyticum K10] Length = 364 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D YP E+ L E I GG I+E Sbjct: 173 LGCGIDICYPREHTELAERIGLQGG-LITEF 202 >gi|254251080|ref|ZP_04944398.1| hypothetical protein BDAG_00251 [Burkholderia dolosa AUO158] gi|124893689|gb|EAY67569.1| hypothetical protein BDAG_00251 [Burkholderia dolosa AUO158] Length = 440 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP +R L E+ G +SE P G Sbjct: 195 IATGADLVYPARHRALAHEVAAR-GAIVSEWPLG 227 >gi|326693682|ref|ZP_08230687.1| DNA processing protein DprA, putative [Leuconostoc argentinum KCTC 3773] Length = 288 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP + +L +I + + +SE P G Sbjct: 167 IGTGIDVAYPKAHHHLQTQIGEQV-LVLSEYPPG 199 >gi|269140539|ref|YP_003297240.1| hypothetical protein ETAE_3198 [Edwardsiella tarda EIB202] gi|267986200|gb|ACY86029.1| hypothetical protein ETAE_3198 [Edwardsiella tarda EIB202] gi|304560324|gb|ADM42988.1| hypothetical protein ETAF_2886 [Edwardsiella tarda FL6-60] Length = 370 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G DC+ P +R L + I + G +SE G Sbjct: 164 LGSGPDCVAPRTHRGLAQAILEADGALVSEFFPG 197 >gi|104779339|ref|YP_605837.1| Smf protein, DNA processing chain A [Pseudomonas entomophila L48] gi|95108326|emb|CAK13020.1| putative Smf protein, DNA processing chain A [Pseudomonas entomophila L48] Length = 365 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL YP +R+L + D+G +SE P Sbjct: 181 LGTGLQKCYPQRHRDLARMMIDSGSALVSEYPL 213 >gi|332533675|ref|ZP_08409534.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Pseudoalteromonas haloplanktis ANT/505] gi|332036839|gb|EGI73300.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Pseudoalteromonas haloplanktis ANT/505] Length = 363 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP ++ L +++ +N G+ +SE G Sbjct: 173 LGTGVDIYYPKRHKLLTDQVLEN-GLLVSEFLPG 205 >gi|255689876|ref|ZP_05413551.1| putative DNA processing protein DprA [Bacteroides finegoldii DSM 17565] gi|260624481|gb|EEX47352.1| putative DNA processing protein DprA [Bacteroides finegoldii DSM 17565] Length = 309 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD +P N++L +EI GG +SE PFG Sbjct: 179 ASGLDITHPKVNKSLQDEIIAKGGTILSEHPFG 211 >gi|254303090|ref|ZP_04970448.1| possible SMF family DNA processing protein [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] gi|148323282|gb|EDK88532.1| possible SMF family DNA processing protein [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] Length = 284 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP N +L EI + G+ +SE G Sbjct: 99 IASGLDIVYPASNLSLYREI-EEKGLILSEYEAG 131 >gi|302558131|ref|ZP_07310473.1| SMF protein [Streptomyces griseoflavus Tu4000] gi|302475749|gb|EFL38842.1| SMF protein [Streptomyces griseoflavus Tu4000] Length = 386 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+ I + G+ + E+P G Sbjct: 181 LACGVDRPYPRGHTGLIGRIAEQ-GLVVGELPPG 213 >gi|212709013|ref|ZP_03317141.1| hypothetical protein PROVALCAL_00045 [Providencia alcalifaciens DSM 30120] gi|212688379|gb|EEB47907.1| hypothetical protein PROVALCAL_00045 [Providencia alcalifaciens DSM 30120] Length = 369 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ++ +L E I + G+ +SE Sbjct: 177 LGSGLAHIYPKQHADLAERI-RHEGVLVSEYFP 208 >gi|296445900|ref|ZP_06887851.1| DNA protecting protein DprA [Methylosinus trichosporium OB3b] gi|296256568|gb|EFH03644.1| DNA protecting protein DprA [Methylosinus trichosporium OB3b] Length = 412 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG YP E+ L+ EI GG +SE+P Sbjct: 175 LAGGHARPYPSEHAPLIAEIAARGGAVLSEMPI 207 >gi|309775661|ref|ZP_07670660.1| DNA protecting protein DprA [Erysipelotrichaceae bacterium 3_1_53] gi|308916567|gb|EFP62308.1| DNA protecting protein DprA [Erysipelotrichaceae bacterium 3_1_53] Length = 243 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP E+ L + + ISE P G Sbjct: 128 IGCGLDVVYPREHAQLY-AVMKKKQLVISEYPKG 160 >gi|295098995|emb|CBK88084.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Eubacterium cylindroides T2-87] Length = 245 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N+ L +++ + ISE P G Sbjct: 131 IGCGIDRIYPYVNKELFLKMYAIQ-LVISEYPPG 163 >gi|257881193|ref|ZP_05660846.1| SMF protein [Enterococcus faecium 1,231,502] gi|257816851|gb|EEV44179.1| SMF protein [Enterococcus faecium 1,231,502] Length = 277 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 169 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 200 >gi|187250577|ref|YP_001875059.1| DNA protecting protein DprA [Elusimicrobium minutum Pei191] gi|186970737|gb|ACC97722.1| DNA protecting protein DprA (DNA processing chain A) [Elusimicrobium minutum Pei191] Length = 372 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 G+ YP EN+ L + +NGG ISE+ Sbjct: 175 GTGIGRCYPAENKALANAVLENGGAIISEL 204 >gi|188582755|ref|YP_001926200.1| DNA protecting protein DprA [Methylobacterium populi BJ001] gi|179346253|gb|ACB81665.1| DNA protecting protein DprA [Methylobacterium populi BJ001] Length = 397 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP + L++ I D GG ++E+P G Sbjct: 166 LAGGQDKIYPETHAGLVDAIVDAGGAVVAEMPMG 199 >gi|149200840|ref|ZP_01877815.1| DNA processing protein DprA, putative [Roseovarius sp. TM1035] gi|149145173|gb|EDM33199.1| DNA processing protein DprA, putative [Roseovarius sp. TM1035] Length = 356 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YP EN L +I + G+ +SE P G Sbjct: 159 MAGGVDVIYPAENTKLAGDILAS-GLRLSEQPIG 191 >gi|91791395|ref|YP_561046.1| DNA processing protein DprA, putative [Shewanella denitrificans OS217] gi|91713397|gb|ABE53323.1| DNA processing protein DprA, putative [Shewanella denitrificans OS217] Length = 362 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP + +L +I G +SE Sbjct: 166 LGTGIEQIYPKRHLDLYHQI-QQSGCVLSEY 195 >gi|294338533|emb|CAZ86862.1| Protein smf (DNA-processing chain A) [Thiomonas sp. 3As] Length = 379 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YPP ++ L + + G+ +SE G Sbjct: 181 LGTGCDRVYPPRHKELAH-LVADRGLLLSEFALG 213 >gi|238788877|ref|ZP_04632667.1| hypothetical protein yfred0001_26840 [Yersinia frederiksenii ATCC 33641] gi|238722904|gb|EEQ14554.1| hypothetical protein yfred0001_26840 [Yersinia frederiksenii ATCC 33641] Length = 373 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + +L EI GG+ +SE Sbjct: 167 LGSGLENIYPRRHNHLAREIESQGGVLVSEF 197 >gi|160880855|ref|YP_001559823.1| DNA protecting protein DprA [Clostridium phytofermentans ISDg] gi|160429521|gb|ABX43084.1| DNA protecting protein DprA [Clostridium phytofermentans ISDg] Length = 369 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN L +E+ +GG +SE P G Sbjct: 175 IGNGLDLCYPRENYGLYQEVNLHGG-ILSEYPIG 207 >gi|51597954|ref|YP_072145.1| DNA protecting protein DprA [Yersinia pseudotuberculosis IP 32953] gi|170022578|ref|YP_001719083.1| DNA protecting protein DprA [Yersinia pseudotuberculosis YPIII] gi|186897150|ref|YP_001874262.1| DNA protecting protein DprA [Yersinia pseudotuberculosis PB1/+] gi|51591236|emb|CAH22902.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP 32953] gi|169749112|gb|ACA66630.1| DNA protecting protein DprA [Yersinia pseudotuberculosis YPIII] gi|186700176|gb|ACC90805.1| DNA protecting protein DprA [Yersinia pseudotuberculosis PB1/+] Length = 373 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L +EI GG +SE Sbjct: 167 LGSGLENIYPQRHSRLAKEIEYQGGALVSEF 197 >gi|320103360|ref|YP_004178951.1| DNA protecting protein DprA [Isosphaera pallida ATCC 43644] gi|319750642|gb|ADV62402.1| DNA protecting protein DprA [Isosphaera pallida ATCC 43644] Length = 453 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MA GL+ +YPPE+ L + I G +SE P Sbjct: 185 MANGLNSIYPPEHDRLADRIV-QQGALLSESPM 216 >gi|171057039|ref|YP_001789388.1| DNA protecting protein DprA [Leptothrix cholodnii SP-6] gi|170774484|gb|ACB32623.1| DNA protecting protein DprA [Leptothrix cholodnii SP-6] Length = 379 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L EI D G+ +SE G Sbjct: 176 GTGLDRVYPRAHLKLAREIADR-GLLLSEFSIG 207 >gi|160895226|ref|ZP_02075998.1| hypothetical protein CLOL250_02786 [Clostridium sp. L2-50] gi|156863105|gb|EDO56536.1| hypothetical protein CLOL250_02786 [Clostridium sp. L2-50] Length = 366 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ YP EN +L E I + G+ +SE Sbjct: 173 LGCGINICYPRENYDLYECI-ERSGVILSEY 202 >gi|19704403|ref|NP_603965.1| Smf protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gi|19714659|gb|AAL95264.1| Smf protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] Length = 288 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP N +L EI + G+ +SE G Sbjct: 103 IASGLDIVYPASNLSLYREI-EEKGLILSEYEAG 135 >gi|110633709|ref|YP_673917.1| DNA protecting protein DprA [Mesorhizobium sp. BNC1] gi|110284693|gb|ABG62752.1| DNA protecting protein DprA [Chelativorans sp. BNC1] Length = 378 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPPEN L I + G+ ++E+PFG Sbjct: 176 LAGGLDRPYPPENDGLFRAIGER-GVVLTEMPFG 208 >gi|149915652|ref|ZP_01904178.1| DNA processing protein DprA, putative [Roseobacter sp. AzwK-3b] gi|149810544|gb|EDM70387.1| DNA processing protein DprA, putative [Roseobacter sp. AzwK-3b] Length = 357 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D YP EN L ++I G+ +SE P G Sbjct: 155 MAGGVDVPYPAENARLADDIT-RSGLRLSEQPMG 187 >gi|167725507|ref|ZP_02408743.1| DNA protecting protein DprA [Burkholderia pseudomallei DM98] Length = 236 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L EI + G +SE P G Sbjct: 20 IGTGADLVYPACHHALAHEIAER-GALVSEWPLG 52 >gi|310287665|ref|YP_003938923.1| SMF family protein [Bifidobacterium bifidum S17] gi|309251601|gb|ADO53349.1| SMF family protein [Bifidobacterium bifidum S17] Length = 333 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP ENR+L + I +N G+ +S+ G Sbjct: 195 IGTGIDRQYPAENRDLQKRI-ENEGLVLSQFMPG 227 >gi|30249915|ref|NP_841985.1| SMF family protein [Nitrosomonas europaea ATCC 19718] gi|30180952|emb|CAD85879.1| SMF family [Nitrosomonas europaea ATCC 19718] Length = 371 Score = 52.7 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP N L + N G ISE P G Sbjct: 175 GTGLDLVYPSRNHELAHK-LANEGGLISEFPLG 206 >gi|22127894|ref|NP_671317.1| DNA protecting protein DprA [Yersinia pestis KIM 10] gi|45440101|ref|NP_991640.1| DNA protecting protein DprA [Yersinia pestis biovar Microtus str. 91001] gi|108809221|ref|YP_653137.1| DNA protecting protein DprA [Yersinia pestis Antiqua] gi|108813986|ref|YP_649753.1| DNA protecting protein DprA [Yersinia pestis Nepal516] gi|145597484|ref|YP_001161559.1| DNA protecting protein DprA [Yersinia pestis Pestoides F] gi|150260709|ref|ZP_01917437.1| hypothetical protein YPE_3025 [Yersinia pestis CA88-4125] gi|153950674|ref|YP_001402829.1| DNA protecting protein DprA [Yersinia pseudotuberculosis IP 31758] gi|165927839|ref|ZP_02223671.1| DNA protecting protein DprA [Yersinia pestis biovar Orientalis str. F1991016] gi|165936410|ref|ZP_02224978.1| DNA protecting protein DprA [Yersinia pestis biovar Orientalis str. IP275] gi|166010455|ref|ZP_02231353.1| DNA protecting protein DprA [Yersinia pestis biovar Antiqua str. E1979001] gi|166213168|ref|ZP_02239203.1| DNA protecting protein DprA [Yersinia pestis biovar Antiqua str. B42003004] gi|167399527|ref|ZP_02305051.1| DNA protecting protein DprA [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167418705|ref|ZP_02310458.1| DNA protecting protein DprA [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167425608|ref|ZP_02317361.1| DNA protecting protein DprA [Yersinia pestis biovar Mediaevalis str. K1973002] gi|167468247|ref|ZP_02332951.1| DNA protecting protein DprA [Yersinia pestis FV-1] gi|218927449|ref|YP_002345324.1| DNA protecting protein DprA [Yersinia pestis CO92] gi|229836275|ref|ZP_04456442.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Yersinia pestis Pestoides A] gi|229840101|ref|ZP_04460260.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Yersinia pestis biovar Orientalis str. PEXU2] gi|229842183|ref|ZP_04462338.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Yersinia pestis biovar Orientalis str. India 195] gi|229904517|ref|ZP_04519628.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Yersinia pestis Nepal516] gi|270488265|ref|ZP_06205339.1| DNA protecting protein DprA [Yersinia pestis KIM D27] gi|294502317|ref|YP_003566379.1| hypothetical protein YPZ3_0207 [Yersinia pestis Z176003] gi|21961031|gb|AAM87568.1|AE014004_6 hypothetical protein y4024 [Yersinia pestis KIM 10] gi|45434956|gb|AAS60517.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Yersinia pestis biovar Microtus str. 91001] gi|108777634|gb|ABG20153.1| hypothetical protein YPN_3826 [Yersinia pestis Nepal516] gi|108781134|gb|ABG15192.1| hypothetical protein YPA_3230 [Yersinia pestis Antiqua] gi|115346060|emb|CAL18926.1| conserved hypothetical protein [Yersinia pestis CO92] gi|145209180|gb|ABP38587.1| hypothetical protein YPDSF_0165 [Yersinia pestis Pestoides F] gi|149290117|gb|EDM40194.1| hypothetical protein YPE_3025 [Yersinia pestis CA88-4125] gi|152962169|gb|ABS49630.1| DNA protecting protein DprA [Yersinia pseudotuberculosis IP 31758] gi|165915526|gb|EDR34135.1| DNA protecting protein DprA [Yersinia pestis biovar Orientalis str. IP275] gi|165920115|gb|EDR37416.1| DNA protecting protein DprA [Yersinia pestis biovar Orientalis str. F1991016] gi|165990545|gb|EDR42846.1| DNA protecting protein DprA [Yersinia pestis biovar Antiqua str. E1979001] gi|166205466|gb|EDR49946.1| DNA protecting protein DprA [Yersinia pestis biovar Antiqua str. B42003004] gi|166962699|gb|EDR58720.1| DNA protecting protein DprA [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167052031|gb|EDR63439.1| DNA protecting protein DprA [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167055298|gb|EDR65092.1| DNA protecting protein DprA [Yersinia pestis biovar Mediaevalis str. K1973002] gi|229678635|gb|EEO74740.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Yersinia pestis Nepal516] gi|229690493|gb|EEO82547.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Yersinia pestis biovar Orientalis str. India 195] gi|229696467|gb|EEO86514.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Yersinia pestis biovar Orientalis str. PEXU2] gi|229706343|gb|EEO92350.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Yersinia pestis Pestoides A] gi|262360397|gb|ACY57118.1| hypothetical protein YPD4_0209 [Yersinia pestis D106004] gi|262364347|gb|ACY60904.1| hypothetical protein YPD8_0214 [Yersinia pestis D182038] gi|270336769|gb|EFA47546.1| DNA protecting protein DprA [Yersinia pestis KIM D27] gi|294352776|gb|ADE63117.1| hypothetical protein YPZ3_0207 [Yersinia pestis Z176003] gi|320013376|gb|ADV96947.1| Rossmann fold nucleotide-binding protein Smfpossibly involved in DNA uptake [Yersinia pestis biovar Medievalis str. Harbin 35] Length = 373 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L +EI GG +SE Sbjct: 167 LGSGLENIYPQRHSRLAKEIEYQGGALVSEF 197 >gi|296328244|ref|ZP_06870774.1| DNA protecting protein DprA [Fusobacterium nucleatum subsp. nucleatum ATCC 23726] gi|296154644|gb|EFG95431.1| DNA protecting protein DprA [Fusobacterium nucleatum subsp. nucleatum ATCC 23726] Length = 288 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP N +L EI + G+ +SE G Sbjct: 103 IASGLDIVYPASNLSLYREI-EEKGLILSEYEAG 135 >gi|113869637|ref|YP_728126.1| Smf protein [Ralstonia eutropha H16] gi|113528413|emb|CAJ94758.1| Smf protein [Ralstonia eutropha H16] Length = 399 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D +YP EN L E+ G ++E P G Sbjct: 201 GTGADRVYPAENLALAHEVAAR-GAIVTEFPLG 232 >gi|58616939|ref|YP_196138.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Gardel] gi|58416551|emb|CAI27664.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Gardel] Length = 375 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M G++ +YP EN L I DNGG+ +E PF Sbjct: 174 MGNGINIVYPEENTTLYNAITDNGGLIATEFPF 206 >gi|57238947|ref|YP_180083.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Welgevonden] gi|58578880|ref|YP_197092.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Welgevonden] gi|57161026|emb|CAH57932.1| putative DNA processing protein chain A [Ehrlichia ruminantium str. Welgevonden] gi|58417506|emb|CAI26710.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Welgevonden] Length = 375 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M G++ +YP EN L I DNGG+ +E PF Sbjct: 174 MGNGINIVYPEENTTLYNAITDNGGLIATEFPF 206 >gi|257898822|ref|ZP_05678475.1| SMF protein [Enterococcus faecium Com15] gi|257836734|gb|EEV61808.1| SMF protein [Enterococcus faecium Com15] Length = 286 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 169 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 200 >gi|329114375|ref|ZP_08243137.1| Protein Smf [Acetobacter pomorum DM001] gi|326696451|gb|EGE48130.1| Protein Smf [Acetobacter pomorum DM001] Length = 412 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLDC YPPEN +L EI G ++E P G Sbjct: 164 IAGGLDCPYPPENASLQAEI-AQKGAVVTEAPLG 196 >gi|291456570|ref|ZP_06595960.1| putative DNA protecting protein DprA [Bifidobacterium breve DSM 20213] gi|291381847|gb|EFE89365.1| putative DNA protecting protein DprA [Bifidobacterium breve DSM 20213] Length = 539 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 261 AGGLNHMGPARNRTLFERIESQGGALISELCPG 293 >gi|34763132|ref|ZP_00144101.1| Smf protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gi|237742000|ref|ZP_04572481.1| SMF family protein [Fusobacterium sp. 4_1_13] gi|256845340|ref|ZP_05550798.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_36A2] gi|27887195|gb|EAA24297.1| Smf protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gi|229429648|gb|EEO39860.1| SMF family protein [Fusobacterium sp. 4_1_13] gi|256718899|gb|EEU32454.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_36A2] Length = 288 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP N +L EI + G+ +SE G Sbjct: 103 IASGLDIVYPASNLSLYREI-EEKGLILSEYEAG 135 >gi|293570275|ref|ZP_06681344.1| DNA protecting protein DprA [Enterococcus faecium E980] gi|291609682|gb|EFF38943.1| DNA protecting protein DprA [Enterococcus faecium E980] Length = 286 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 169 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 200 >gi|331002043|ref|ZP_08325563.1| hypothetical protein HMPREF0491_00425 [Lachnospiraceae oral taxon 107 str. F0167] gi|330411839|gb|EGG91244.1| hypothetical protein HMPREF0491_00425 [Lachnospiraceae oral taxon 107 str. F0167] Length = 371 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Query: 1 MAGGLDCLYPPENRNLLEE--IWDNGGIAISEIPFG 34 + G++ YP N L + I ++GG ISE P G Sbjct: 177 LGTGVNVCYPESNFKLYNDLCIGEHGG-VISEFPLG 211 >gi|256390722|ref|YP_003112286.1| DNA protecting protein DprA [Catenulispora acidiphila DSM 44928] gi|256356948|gb|ACU70445.1| DNA protecting protein DprA [Catenulispora acidiphila DSM 44928] Length = 600 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +YP + L+ I + G+ +SE+P G Sbjct: 399 LACGIDLVYPAGHEALIGAI-ASEGLVLSELPPG 431 >gi|327539302|gb|EGF25923.1| DNA recombination-mediator protein A [Rhodopirellula baltica WH47] Length = 424 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GGL +YP EN L ++I ++ G ISE Sbjct: 226 LGGGLGKIYPAENAPLADKISEH-GAVISEYAP 257 >gi|331695085|ref|YP_004331324.1| DNA protecting protein DprA [Pseudonocardia dioxanivorans CB1190] gi|326949774|gb|AEA23471.1| DNA protecting protein DprA [Pseudonocardia dioxanivorans CB1190] Length = 292 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +P ++ L + + + GG+ +SE P G Sbjct: 172 LANGVDLTHPHQHARLHQTLIEQGGLLVSEYPIG 205 >gi|294785361|ref|ZP_06750649.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_27] gi|294487075|gb|EFG34437.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_27] Length = 288 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP N +L EI + G+ +SE G Sbjct: 103 IASGLDIVYPASNLSLYREI-EEKGLILSEYEAG 135 >gi|293556765|ref|ZP_06675328.1| DNA protecting protein DprA [Enterococcus faecium E1039] gi|291601097|gb|EFF31386.1| DNA protecting protein DprA [Enterococcus faecium E1039] Length = 286 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 169 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 200 >gi|188995531|ref|YP_001929783.1| putative DNA processing Smf-like protein [Porphyromonas gingivalis ATCC 33277] gi|188595211|dbj|BAG34186.1| putative DNA processing Smf-like protein [Porphyromonas gingivalis ATCC 33277] Length = 374 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R++ E+ NGG+ ++ P G Sbjct: 183 LAHGLDRIYPSSHRSIAMEMLRNGGLL-TDYPMG 215 >gi|149197252|ref|ZP_01874304.1| SMF family protein involved in DNA uptake [Lentisphaera araneosa HTCC2155] gi|149139798|gb|EDM28199.1| SMF family protein involved in DNA uptake [Lentisphaera araneosa HTCC2155] Length = 380 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG+ +YP +N L +I D+ G +SE P Sbjct: 175 LGGGIGKIYPKDNLKLARDICDH-GALVSEYPI 206 >gi|269795658|ref|YP_003315113.1| DNA protecting protein DprA [Sanguibacter keddieii DSM 10542] gi|269097843|gb|ACZ22279.1| DNA protecting protein DprA [Sanguibacter keddieii DSM 10542] Length = 399 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D LYP N +LL + D G+ +SE+P G Sbjct: 192 LAGGPDRLYPAGNADLLRGVLDGAGLVLSELPPG 225 >gi|163792865|ref|ZP_02186841.1| Predicted Rossmann fold nucleotide-binding protein [alpha proteobacterium BAL199] gi|159181511|gb|EDP66023.1| Predicted Rossmann fold nucleotide-binding protein [alpha proteobacterium BAL199] Length = 379 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YPPE+ LL++I +N GIA++E+P G Sbjct: 173 LAGGIDVTYPPEHAGLLQQIVEN-GIAVAEMPVG 205 >gi|145593869|ref|YP_001158166.1| DNA protecting protein DprA [Salinispora tropica CNB-440] gi|145303206|gb|ABP53788.1| DNA protecting protein DprA [Salinispora tropica CNB-440] Length = 444 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD YP N L + I D G+ +SE G Sbjct: 222 LACGLDRPYPMGNAALFDRIADT-GLLVSEWIPG 254 >gi|77359007|ref|YP_338582.1| hypothetical protein PSHAa0025 [Pseudoalteromonas haloplanktis TAC125] gi|76873918|emb|CAI85139.1| conserved protein of unknown function ; Smf protein [Pseudoalteromonas haloplanktis TAC125] Length = 362 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP +++ L ++ + G+ +SE G Sbjct: 173 LGTGVDIYYPKQHKLLTNQVLEQ-GLLVSEFLPG 205 >gi|260771090|ref|ZP_05880018.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio furnissii CIP 102972] gi|260613979|gb|EEX39170.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio furnissii CIP 102972] Length = 371 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL C+YP +R L E I + G +SE Sbjct: 172 LGSGLGCIYPARHRTLAERIMAS-GAVVSEF 201 >gi|227551192|ref|ZP_03981241.1| DNA processing protein DprA [Enterococcus faecium TX1330] gi|227179660|gb|EEI60632.1| DNA processing protein DprA [Enterococcus faecium TX1330] Length = 286 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 169 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 200 >gi|209884919|ref|YP_002288776.1| SMF protein [Oligotropha carboxidovorans OM5] gi|209873115|gb|ACI92911.1| SMF protein [Oligotropha carboxidovorans OM5] Length = 377 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YPPE+ +LL+ I G AISE+ G Sbjct: 176 LAGGHDRIYPPEHESLLDAILAANGGAISEMQLG 209 >gi|119943869|ref|YP_941549.1| DNA protecting protein DprA [Psychromonas ingrahamii 37] gi|119862473|gb|ABM01950.1| DNA protecting protein DprA [Psychromonas ingrahamii 37] Length = 352 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L ++I + G+ +SE Sbjct: 163 LGTGLNNIYPKRHLKLAQQIKE-KGLLVSEF 192 >gi|291563109|emb|CBL41925.1| DNA protecting protein DprA [butyrate-producing bacterium SS3/4] Length = 368 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G++ YP EN + + +NGG +SE G Sbjct: 178 LGCGVNVCYPRENYKIFHAMEENGG-ILSEFVPG 210 >gi|257896185|ref|ZP_05675838.1| SMF protein [Enterococcus faecium Com12] gi|257832750|gb|EEV59171.1| SMF protein [Enterococcus faecium Com12] Length = 285 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 168 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 199 >gi|227872632|ref|ZP_03990964.1| SMF family DNA processing protein [Oribacterium sinus F0268] gi|227841519|gb|EEJ51817.1| SMF family DNA processing protein [Oribacterium sinus F0268] Length = 300 Score = 52.3 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ YP N L E I + G +SE P Sbjct: 105 LGCGVNICYPSCNFRLYENI-EKNGGILSEYPL 136 >gi|315178585|gb|ADT85499.1| Smf protein [Vibrio furnissii NCTC 11218] Length = 371 Score = 52.3 bits (126), Expect = 3e-05, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL C+YP +R L E I + G +SE Sbjct: 172 LGSGLGCIYPARHRTLAERIMAS-GAVVSEF 201 >gi|226942189|ref|YP_002797262.1| DNA processing protein DprA [Azotobacter vinelandii DJ] gi|226717116|gb|ACO76287.1| DNA processing protein, DprA (SMF family) [Azotobacter vinelandii DJ] Length = 366 Score = 52.3 bits (126), Expect = 3e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L EI + GG +SE+P Sbjct: 175 LGTGLRRLYPARHETLAAEILEGGGALLSELPL 207 >gi|15610033|ref|NP_217412.1| hypothetical protein Rv2896c [Mycobacterium tuberculosis H37Rv] gi|2851412|sp|Q10817|Y2896_MYCTU RecName: Full=Uncharacterized protein Rv2896c/MT2964 gi|2529205|emb|CAA98374.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv] Length = 389 Score = 52.3 bits (126), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D YP + LL I G+ +E P G Sbjct: 181 LAGGFDIPYPAGHSALLHRI-AQHGVLFTEYPPG 213 >gi|296117478|ref|ZP_06836065.1| putative DNA processing chain A [Gluconacetobacter hansenii ATCC 23769] gi|295975999|gb|EFG82790.1| putative DNA processing chain A [Gluconacetobacter hansenii ATCC 23769] Length = 375 Score = 52.3 bits (126), Expect = 3e-05, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLDC YPPE+ L +EI G I+E P G Sbjct: 164 IAGGLDCPYPPEHGRLHDEI-AQQGALITEAPPG 196 >gi|261207605|ref|ZP_05922290.1| SMF protein [Enterococcus faecium TC 6] gi|289565117|ref|ZP_06445570.1| SMF protein [Enterococcus faecium D344SRF] gi|294614821|ref|ZP_06694716.1| DNA protecting protein DprA [Enterococcus faecium E1636] gi|260077988|gb|EEW65694.1| SMF protein [Enterococcus faecium TC 6] gi|289163124|gb|EFD10971.1| SMF protein [Enterococcus faecium D344SRF] gi|291592283|gb|EFF23897.1| DNA protecting protein DprA [Enterococcus faecium E1636] Length = 286 Score = 52.3 bits (126), Expect = 3e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 169 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 200 >gi|257884856|ref|ZP_05664509.1| SMF protein [Enterococcus faecium 1,231,501] gi|257820694|gb|EEV47842.1| SMF protein [Enterococcus faecium 1,231,501] Length = 285 Score = 52.3 bits (126), Expect = 3e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 168 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 199 >gi|297191781|ref|ZP_06909179.1| DNA processing Smf-family protein [Streptomyces pristinaespiralis ATCC 25486] gi|297151063|gb|EDY65610.2| DNA processing Smf-family protein [Streptomyces pristinaespiralis ATCC 25486] Length = 393 Score = 52.3 bits (126), Expect = 3e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+ I + G+ I E+P G Sbjct: 188 LACGVDVAYPRGHGELIGRIVEQ-GLVIGELPPG 220 >gi|218779037|ref|YP_002430355.1| DNA protecting protein DprA [Desulfatibacillum alkenivorans AK-01] gi|218760421|gb|ACL02887.1| DNA protecting protein DprA [Desulfatibacillum alkenivorans AK-01] Length = 375 Score = 52.3 bits (126), Expect = 3e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GL +YP + L +I G ISE P G Sbjct: 171 LGCGLGKVYPRGSEELYHKI-AQNGAVISEFPVG 203 >gi|15842439|ref|NP_337476.1| hypothetical protein MT2964 [Mycobacterium tuberculosis CDC1551] gi|148662740|ref|YP_001284263.1| hypothetical protein MRA_2921 [Mycobacterium tuberculosis H37Ra] gi|148824085|ref|YP_001288839.1| hypothetical protein TBFG_12910 [Mycobacterium tuberculosis F11] gi|167969525|ref|ZP_02551802.1| hypothetical protein MtubH3_16471 [Mycobacterium tuberculosis H37Ra] gi|215404870|ref|ZP_03417051.1| hypothetical protein Mtub0_14508 [Mycobacterium tuberculosis 02_1987] gi|215412739|ref|ZP_03421451.1| hypothetical protein Mtub9_15285 [Mycobacterium tuberculosis 94_M4241A] gi|215428337|ref|ZP_03426256.1| hypothetical protein MtubT9_18873 [Mycobacterium tuberculosis T92] gi|215431844|ref|ZP_03429763.1| hypothetical protein MtubE_14486 [Mycobacterium tuberculosis EAS054] gi|215447158|ref|ZP_03433910.1| hypothetical protein MtubT_14922 [Mycobacterium tuberculosis T85] gi|219558920|ref|ZP_03537996.1| hypothetical protein MtubT1_17077 [Mycobacterium tuberculosis T17] gi|253798016|ref|YP_003031017.1| hypothetical protein TBMG_01076 [Mycobacterium tuberculosis KZN 1435] gi|254232989|ref|ZP_04926316.1| conserved hypothetical protein [Mycobacterium tuberculosis C] gi|254551968|ref|ZP_05142415.1| hypothetical protein Mtube_16152 [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] gi|260206214|ref|ZP_05773705.1| hypothetical protein MtubK8_18150 [Mycobacterium tuberculosis K85] gi|289553315|ref|ZP_06442525.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605] gi|289571085|ref|ZP_06451312.1| conserved hypothetical protein [Mycobacterium tuberculosis T17] gi|289575601|ref|ZP_06455828.1| conserved hypothetical protein [Mycobacterium tuberculosis K85] gi|289746695|ref|ZP_06506073.1| smf family protein [Mycobacterium tuberculosis 02_1987] gi|289751561|ref|ZP_06510939.1| conserved hypothetical protein [Mycobacterium tuberculosis T92] gi|289755008|ref|ZP_06514386.1| smf family protein [Mycobacterium tuberculosis EAS054] gi|289759016|ref|ZP_06518394.1| smf family protein [Mycobacterium tuberculosis T85] gi|294994008|ref|ZP_06799699.1| hypothetical protein Mtub2_05718 [Mycobacterium tuberculosis 210] gi|297635514|ref|ZP_06953294.1| hypothetical protein MtubK4_15392 [Mycobacterium tuberculosis KZN 4207] gi|297732513|ref|ZP_06961631.1| hypothetical protein MtubKR_15557 [Mycobacterium tuberculosis KZN R506] gi|298526365|ref|ZP_07013774.1| conserved hypothetical protein [Mycobacterium tuberculosis 94_M4241A] gi|306777184|ref|ZP_07415521.1| hypothetical protein TMAG_01097 [Mycobacterium tuberculosis SUMu001] gi|306781091|ref|ZP_07419428.1| hypothetical protein TMBG_03040 [Mycobacterium tuberculosis SUMu002] gi|306785731|ref|ZP_07424053.1| hypothetical protein TMCG_02146 [Mycobacterium tuberculosis SUMu003] gi|306789770|ref|ZP_07428092.1| hypothetical protein TMDG_00088 [Mycobacterium tuberculosis SUMu004] gi|306794584|ref|ZP_07432886.1| hypothetical protein TMEG_02163 [Mycobacterium tuberculosis SUMu005] gi|306804673|ref|ZP_07441341.1| hypothetical protein TMHG_02101 [Mycobacterium tuberculosis SUMu008] gi|306968964|ref|ZP_07481625.1| hypothetical protein TMIG_02398 [Mycobacterium tuberculosis SUMu009] gi|306973301|ref|ZP_07485962.1| hypothetical protein TMJG_01888 [Mycobacterium tuberculosis SUMu010] gi|307081009|ref|ZP_07490179.1| hypothetical protein TMKG_03330 [Mycobacterium tuberculosis SUMu011] gi|307085608|ref|ZP_07494721.1| hypothetical protein TMLG_01388 [Mycobacterium tuberculosis SUMu012] gi|313659845|ref|ZP_07816725.1| hypothetical protein MtubKV_15557 [Mycobacterium tuberculosis KZN V2475] gi|13882742|gb|AAK47290.1| smf family protein [Mycobacterium tuberculosis CDC1551] gi|124602048|gb|EAY61058.1| conserved hypothetical protein [Mycobacterium tuberculosis C] gi|148506892|gb|ABQ74701.1| conserved hypothetical protein [Mycobacterium tuberculosis H37Ra] gi|148722612|gb|ABR07237.1| conserved hypothetical protein [Mycobacterium tuberculosis F11] gi|253319519|gb|ACT24122.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 1435] gi|289437947|gb|EFD20440.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605] gi|289540032|gb|EFD44610.1| conserved hypothetical protein [Mycobacterium tuberculosis K85] gi|289544839|gb|EFD48487.1| conserved hypothetical protein [Mycobacterium tuberculosis T17] gi|289687223|gb|EFD54711.1| smf family protein [Mycobacterium tuberculosis 02_1987] gi|289692148|gb|EFD59577.1| conserved hypothetical protein [Mycobacterium tuberculosis T92] gi|289695595|gb|EFD63024.1| smf family protein [Mycobacterium tuberculosis EAS054] gi|289714580|gb|EFD78592.1| smf family protein [Mycobacterium tuberculosis T85] gi|298496159|gb|EFI31453.1| conserved hypothetical protein [Mycobacterium tuberculosis 94_M4241A] gi|308214466|gb|EFO73865.1| hypothetical protein TMAG_01097 [Mycobacterium tuberculosis SUMu001] gi|308326077|gb|EFP14928.1| hypothetical protein TMBG_03040 [Mycobacterium tuberculosis SUMu002] gi|308329641|gb|EFP18492.1| hypothetical protein TMCG_02146 [Mycobacterium tuberculosis SUMu003] gi|308333780|gb|EFP22631.1| hypothetical protein TMDG_00088 [Mycobacterium tuberculosis SUMu004] gi|308337174|gb|EFP26025.1| hypothetical protein TMEG_02163 [Mycobacterium tuberculosis SUMu005] gi|308348765|gb|EFP37616.1| hypothetical protein TMHG_02101 [Mycobacterium tuberculosis SUMu008] gi|308353466|gb|EFP42317.1| hypothetical protein TMIG_02398 [Mycobacterium tuberculosis SUMu009] gi|308357331|gb|EFP46182.1| hypothetical protein TMJG_01888 [Mycobacterium tuberculosis SUMu010] gi|308361215|gb|EFP50066.1| hypothetical protein TMKG_03330 [Mycobacterium tuberculosis SUMu011] gi|308364835|gb|EFP53686.1| hypothetical protein TMLG_01388 [Mycobacterium tuberculosis SUMu012] gi|323718506|gb|EGB27677.1| hypothetical protein TMMG_03769 [Mycobacterium tuberculosis CDC1551A] gi|326904510|gb|EGE51443.1| smf family protein [Mycobacterium tuberculosis W-148] gi|328457790|gb|AEB03213.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 4207] Length = 389 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D YP + LL I G+ +E P G Sbjct: 181 LAGGFDIPYPAGHSALLHRI-AQHGVLFTEYPPG 213 >gi|114561214|ref|YP_748727.1| DNA protecting protein DprA [Shewanella frigidimarina NCIMB 400] gi|114332507|gb|ABI69889.1| DNA protecting protein DprA [Shewanella frigidimarina NCIMB 400] Length = 338 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++C+YP +++L +I N G ISE Sbjct: 142 LGCGVECIYPKRHQHLYHDII-NTGCVISEY 171 >gi|306798827|ref|ZP_07437129.1| putative DNA protecting protein DprA [Mycobacterium tuberculosis SUMu006] gi|308340905|gb|EFP29756.1| putative DNA protecting protein DprA [Mycobacterium tuberculosis SUMu006] Length = 385 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D YP + LL I G+ +E P G Sbjct: 181 LAGGFDIPYPAGHSALLHRI-AQHGVLFTEYPPG 213 >gi|28572469|ref|NP_789249.1| DNA processing protein [Tropheryma whipplei TW08/27] gi|28410601|emb|CAD66987.1| putative DNA processing protein [Tropheryma whipplei TW08/27] Length = 381 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP N L +I ++ GI +SE+P G Sbjct: 191 AGGVDWIYPRGNEALFSKICES-GIIVSEMPCG 222 >gi|28493420|ref|NP_787581.1| nucleotide-binding protein [Tropheryma whipplei str. Twist] gi|28476461|gb|AAO44550.1| nucleotide-binding protein [Tropheryma whipplei str. Twist] Length = 399 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP N L +I ++ GI +SE+P G Sbjct: 209 AGGVDWIYPRGNEALFSKICES-GIIVSEMPCG 240 >gi|291517057|emb|CBK70673.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Bifidobacterium longum subsp. longum F8] Length = 514 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 204 AGGLNHIGPMRNRTLFERIETQGGALISELCPG 236 >gi|257887691|ref|ZP_05667344.1| SMF protein [Enterococcus faecium 1,141,733] gi|257823745|gb|EEV50677.1| SMF protein [Enterococcus faecium 1,141,733] Length = 285 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 168 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 199 >gi|257878021|ref|ZP_05657674.1| SMF protein [Enterococcus faecium 1,230,933] gi|257889780|ref|ZP_05669433.1| SMF protein [Enterococcus faecium 1,231,410] gi|258616490|ref|ZP_05714260.1| DNA processing protein DprA, putative [Enterococcus faecium DO] gi|257812249|gb|EEV41007.1| SMF protein [Enterococcus faecium 1,230,933] gi|257826140|gb|EEV52766.1| SMF protein [Enterococcus faecium 1,231,410] Length = 285 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 168 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 199 >gi|31794072|ref|NP_856565.1| hypothetical protein Mb2920c [Mycobacterium bovis AF2122/97] gi|121638777|ref|YP_979001.1| hypothetical protein BCG_2917c [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224991269|ref|YP_002645958.1| hypothetical protein JTY_2912 [Mycobacterium bovis BCG str. Tokyo 172] gi|31619667|emb|CAD96607.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97] gi|121494425|emb|CAL72906.1| Conserved hypothetical protein [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224774384|dbj|BAH27190.1| hypothetical protein JTY_2912 [Mycobacterium bovis BCG str. Tokyo 172] Length = 389 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D YP + LL I G+ +E P G Sbjct: 181 LAGGFDIPYPAGHSALLHRI-AQHGVLFTEYPPG 213 >gi|69246758|ref|ZP_00604106.1| SMF protein [Enterococcus faecium DO] gi|257892283|ref|ZP_05671936.1| SMF protein [Enterococcus faecium 1,231,408] gi|260559071|ref|ZP_05831257.1| SMF protein [Enterococcus faecium C68] gi|293563423|ref|ZP_06677872.1| DNA protecting protein DprA [Enterococcus faecium E1162] gi|293568164|ref|ZP_06679500.1| DNA protecting protein DprA [Enterococcus faecium E1071] gi|294622304|ref|ZP_06701347.1| DNA protecting protein DprA [Enterococcus faecium U0317] gi|314938033|ref|ZP_07845343.1| DNA protecting protein DprA [Enterococcus faecium TX0133a04] gi|314941981|ref|ZP_07848842.1| DNA protecting protein DprA [Enterococcus faecium TX0133C] gi|314948766|ref|ZP_07852138.1| DNA protecting protein DprA [Enterococcus faecium TX0082] gi|314951784|ref|ZP_07854823.1| DNA protecting protein DprA [Enterococcus faecium TX0133A] gi|314991809|ref|ZP_07857267.1| DNA protecting protein DprA [Enterococcus faecium TX0133B] gi|314995850|ref|ZP_07860937.1| DNA protecting protein DprA [Enterococcus faecium TX0133a01] gi|68195112|gb|EAN09572.1| SMF protein [Enterococcus faecium DO] gi|257828662|gb|EEV55269.1| SMF protein [Enterococcus faecium 1,231,408] gi|260074828|gb|EEW63144.1| SMF protein [Enterococcus faecium C68] gi|291589154|gb|EFF20966.1| DNA protecting protein DprA [Enterococcus faecium E1071] gi|291598196|gb|EFF29294.1| DNA protecting protein DprA [Enterococcus faecium U0317] gi|291604684|gb|EFF34169.1| DNA protecting protein DprA [Enterococcus faecium E1162] gi|313589954|gb|EFR68799.1| DNA protecting protein DprA [Enterococcus faecium TX0133a01] gi|313593620|gb|EFR72465.1| DNA protecting protein DprA [Enterococcus faecium TX0133B] gi|313596063|gb|EFR74908.1| DNA protecting protein DprA [Enterococcus faecium TX0133A] gi|313599233|gb|EFR78078.1| DNA protecting protein DprA [Enterococcus faecium TX0133C] gi|313642608|gb|EFS07188.1| DNA protecting protein DprA [Enterococcus faecium TX0133a04] gi|313644832|gb|EFS09412.1| DNA protecting protein DprA [Enterococcus faecium TX0082] Length = 286 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 169 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 200 >gi|325662148|ref|ZP_08150766.1| hypothetical protein HMPREF0490_01504 [Lachnospiraceae bacterium 4_1_37FAA] gi|325471597|gb|EGC74817.1| hypothetical protein HMPREF0490_01504 [Lachnospiraceae bacterium 4_1_37FAA] Length = 376 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP ENR L E+ G +SE G Sbjct: 186 LGSGVDICYPKENRGLYED-LKKYGGILSEQQPG 218 >gi|289448561|ref|ZP_06438305.1| smf family protein [Mycobacterium tuberculosis CPHL_A] gi|289421519|gb|EFD18720.1| smf family protein [Mycobacterium tuberculosis CPHL_A] Length = 376 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D YP + LL I G+ +E P G Sbjct: 168 LAGGFDIPYPAGHSALLHRI-AQHGVLFTEYPPG 200 >gi|260202031|ref|ZP_05769522.1| hypothetical protein MtubT4_18555 [Mycobacterium tuberculosis T46] gi|289444451|ref|ZP_06434195.1| conserved hypothetical protein [Mycobacterium tuberculosis T46] gi|289417370|gb|EFD14610.1| conserved hypothetical protein [Mycobacterium tuberculosis T46] Length = 389 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D YP + LL I G+ +E P G Sbjct: 181 LAGGFDIPYPAGHSALLHRI-AQHGVLFTEYPPG 213 >gi|91763089|ref|ZP_01265053.1| DNA processing chain A [Candidatus Pelagibacter ubique HTCC1002] gi|91717502|gb|EAS84153.1| DNA processing chain A [Candidatus Pelagibacter ubique HTCC1002] Length = 306 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP ENR L + I N GI ++E FG Sbjct: 190 LANGLDTIYPSENRELAKNIL-NKGILLTEYTFG 222 >gi|256425884|ref|YP_003126537.1| DNA protecting protein DprA [Chitinophaga pinensis DSM 2588] gi|256040792|gb|ACU64336.1| DNA protecting protein DprA [Chitinophaga pinensis DSM 2588] Length = 378 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +A GLD +YP ++R+ E+ DNGG+ +E P Sbjct: 181 LAHGLDRIYPQQHRSTAMEMIDNGGLL-TEFP 211 >gi|167757715|ref|ZP_02429842.1| hypothetical protein CLOSCI_00045 [Clostridium scindens ATCC 35704] gi|167664597|gb|EDS08727.1| hypothetical protein CLOSCI_00045 [Clostridium scindens ATCC 35704] Length = 365 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP E+ L ++ +NGG ISE G Sbjct: 175 LGCGVDVCYPREHIGLYMDLQENGG-LISEQIPG 207 >gi|198282166|ref|YP_002218487.1| DNA protecting protein DprA [Acidithiobacillus ferrooxidans ATCC 53993] gi|218666611|ref|YP_002424531.1| DNA processing protein DprA, putative [Acidithiobacillus ferrooxidans ATCC 23270] gi|198246687|gb|ACH82280.1| DNA protecting protein DprA [Acidithiobacillus ferrooxidans ATCC 53993] gi|218518824|gb|ACK79410.1| DNA processing protein DprA, putative [Acidithiobacillus ferrooxidans ATCC 23270] Length = 365 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G D +YP + L +I G+ +SE P Sbjct: 168 LGTGADLIYPRSHLQLARQIAGQ-GLILSEQPP 199 >gi|331085946|ref|ZP_08335029.1| hypothetical protein HMPREF0987_01332 [Lachnospiraceae bacterium 9_1_43BFAA] gi|330406869|gb|EGG86374.1| hypothetical protein HMPREF0987_01332 [Lachnospiraceae bacterium 9_1_43BFAA] Length = 376 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP ENR L E+ G +SE G Sbjct: 186 LGSGVDICYPKENRGLYED-LKKYGGILSEQQPG 218 >gi|238758794|ref|ZP_04619968.1| hypothetical protein yaldo0001_32100 [Yersinia aldovae ATCC 35236] gi|238703091|gb|EEP95634.1| hypothetical protein yaldo0001_32100 [Yersinia aldovae ATCC 35236] Length = 373 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP ++ +L EI GG +SE Sbjct: 167 LGSGLENIYPRQHSHLACEIESQGGALVSEF 197 >gi|285019620|ref|YP_003377331.1| DNA processing chain a protein [Xanthomonas albilineans GPE PC73] gi|283474838|emb|CBA17337.1| putative dna processing chain a protein [Xanthomonas albilineans] Length = 384 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D YP ++ L E I G ISE P G Sbjct: 181 GTGADLAYPRQHAELRERI-ATHGAVISEHPPG 212 >gi|148545342|ref|YP_001265444.1| DNA protecting protein DprA [Pseudomonas putida F1] gi|148509400|gb|ABQ76260.1| DNA protecting protein DprA [Pseudomonas putida F1] Length = 365 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP ++ L + + DNG +SE P Sbjct: 181 LGTGLQKLYPQRHQELAQAMIDNGSALVSEYPL 213 >gi|116492733|ref|YP_804468.1| Rossmann fold nucleotide-binding protein for DNA uptake [Pediococcus pentosaceus ATCC 25745] gi|116102883|gb|ABJ68026.1| Rossmann fold nucleotide-binding protein for DNA uptake [Pediococcus pentosaceus ATCC 25745] Length = 286 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP +N L +I G+ +SE P G Sbjct: 170 IGNGLDITYPKQNAQLQNQI-QKEGLILSEYPQG 202 >gi|119025612|ref|YP_909457.1| hypothetical protein BAD_0594 [Bifidobacterium adolescentis ATCC 15703] gi|118765196|dbj|BAF39375.1| hypothetical protein [Bifidobacterium adolescentis ATCC 15703] Length = 434 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P N+NL E+I + G ISE+ G Sbjct: 228 AGGLNHIGPKSNQNLFEQIESHSGALISELCPG 260 >gi|162420425|ref|YP_001605207.1| DNA protecting protein DprA [Yersinia pestis Angola] gi|162353240|gb|ABX87188.1| DNA protecting protein DprA [Yersinia pestis Angola] Length = 247 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + L +EI GG +SE Sbjct: 167 LGSGLENIYPQRHSRLAKEIEYQGGALVSEF 197 >gi|221135273|ref|ZP_03561576.1| hypothetical protein GHTCC_10125 [Glaciecola sp. HTCC2999] Length = 370 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G + +YP + +L ++I G ISE Sbjct: 174 LGHGHEHMYPRHHAHLRQQILSQQGCIISEFFP 206 >gi|160915178|ref|ZP_02077391.1| hypothetical protein EUBDOL_01186 [Eubacterium dolichum DSM 3991] gi|158432977|gb|EDP11266.1| hypothetical protein EUBDOL_01186 [Eubacterium dolichum DSM 3991] Length = 242 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN L + + + +SE P G Sbjct: 128 IGCGLDVVYPKENARLYAYMKQSQ-LILSEYPKG 160 >gi|154487075|ref|ZP_02028482.1| hypothetical protein BIFADO_00915 [Bifidobacterium adolescentis L2-32] gi|154084938|gb|EDN83983.1| hypothetical protein BIFADO_00915 [Bifidobacterium adolescentis L2-32] Length = 434 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P N+NL E+I + G ISE+ G Sbjct: 228 AGGLNHIGPKSNQNLFEQIESHSGALISELCPG 260 >gi|296268974|ref|YP_003651606.1| DNA protecting protein DprA [Thermobispora bispora DSM 43833] gi|296091761|gb|ADG87713.1| DNA protecting protein DprA [Thermobispora bispora DSM 43833] Length = 475 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D YP + +L + G+ +SE P G Sbjct: 253 LACGTDVCYPSAHEDLFRA-VRSQGVVVSEWPPG 285 >gi|83814168|ref|YP_445312.1| DNA processing protein DprA [Salinibacter ruber DSM 13855] gi|83755562|gb|ABC43675.1| DNA processing protein DprA [Salinibacter ruber DSM 13855] Length = 388 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ +YP ++ L E I ++ G +SE Sbjct: 188 LGSGVGHIYPKKHTALAERIAEH-GAVLSEY 217 >gi|34540135|ref|NP_904614.1| DNA processing protein DprA [Porphyromonas gingivalis W83] gi|34396447|gb|AAQ65513.1| DNA processing protein DprA, putative [Porphyromonas gingivalis W83] Length = 374 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R++ E+ NGG+ ++ P G Sbjct: 183 LAHGLDRIYPSGHRSIAMEMLRNGGLL-TDYPMG 215 >gi|327446261|gb|EGE92915.1| DNA protecting protein DprA [Propionibacterium acnes HL013PA2] Length = 311 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPLG 210 >gi|261342755|ref|ZP_05970613.1| DNA protecting protein DprA [Enterobacter cancerogenus ATCC 35316] gi|288314934|gb|EFC53872.1| DNA protecting protein DprA [Enterobacter cancerogenus ATCC 35316] Length = 374 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP + +L E++ ++GG +SE Sbjct: 167 LGNGLFSVYPRRHHHLAEQLVESGGAIVSEF 197 >gi|85716403|ref|ZP_01047375.1| SMF protein [Nitrobacter sp. Nb-311A] gi|85696760|gb|EAQ34646.1| SMF protein [Nitrobacter sp. Nb-311A] Length = 372 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D +YP E+ +LL + ++GG ISE+P G Sbjct: 175 LAGGHDRIYPLEHEDLLAAVLEDGGA-ISEMPMG 207 >gi|325965583|ref|YP_004243487.1| DNA protecting protein DprA [Arthrobacter phenanthrenivorans Sphe3] gi|323471670|gb|ADX75353.1| DNA protecting protein DprA [Arthrobacter phenanthrenivorans Sphe3] Length = 302 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP N +L I N G+ +SE+P G Sbjct: 184 LAGGLDRDYPSGNADLAAAIRAN-GLTLSELPPG 216 >gi|197104784|ref|YP_002130161.1| dprA protein [Phenylobacterium zucineum HLK1] gi|196478204|gb|ACG77732.1| dprA protein [Phenylobacterium zucineum HLK1] Length = 362 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG+D +YPPE+R L E + + G +SE G Sbjct: 169 LGGGIDDVYPPEHRPLYERLVEA-GCVVSESEPG 201 >gi|145590258|ref|YP_001156855.1| DNA protecting protein DprA [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] gi|145048664|gb|ABP35291.1| DNA protecting protein DprA [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] Length = 229 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP E+ L I N G+ ISE P G Sbjct: 108 GTGLDMAYPKEHAALANAI-GNQGLLISEYPAG 139 >gi|260187915|ref|ZP_05765389.1| hypothetical protein MtubCP_18099 [Mycobacterium tuberculosis CPHL_A] Length = 357 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D YP + LL I G+ +E P G Sbjct: 149 LAGGFDIPYPAGHSALLHRI-AQHGVLFTEYPPG 181 >gi|227503374|ref|ZP_03933423.1| DNA processing protein [Corynebacterium accolens ATCC 49725] gi|227075877|gb|EEI13840.1| DNA processing protein [Corynebacterium accolens ATCC 49725] Length = 393 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D YP N L ++I DN G +SE Sbjct: 193 ACGIDKNYPARNGGLFDQIADN-GCIVSEFAP 223 >gi|163745856|ref|ZP_02153215.1| DNA processing protein DprA, putative [Oceanibulbus indolifex HEL-45] gi|161380601|gb|EDQ05011.1| DNA processing protein DprA, putative [Oceanibulbus indolifex HEL-45] Length = 349 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L +I G+ +SE P G Sbjct: 140 AGGVDTIYPSENSELAGQIAAQ-GLRLSEQPMG 171 >gi|90415411|ref|ZP_01223345.1| DNA processing chain A [marine gamma proteobacterium HTCC2207] gi|90332734|gb|EAS47904.1| DNA processing chain A [marine gamma proteobacterium HTCC2207] Length = 360 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MA G++ +YP + L E+I D GG I+E Sbjct: 174 MATGIEAVYPRAHLKLAEQIIDQGGTLITEFEP 206 >gi|119471683|ref|ZP_01614068.1| hypothetical protein ATW7_16423 [Alteromonadales bacterium TW-7] gi|119445462|gb|EAW26749.1| hypothetical protein ATW7_16423 [Alteromonadales bacterium TW-7] Length = 363 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP ++ L E++ N G+ ISE G Sbjct: 173 LGTGVDIYYPKRHKLLTEQVL-NSGLLISEFLPG 205 >gi|302542196|ref|ZP_07294538.1| SMF protein [Streptomyces hygroscopicus ATCC 53653] gi|302459814|gb|EFL22907.1| SMF protein [Streptomyces himastatinicus ATCC 53653] Length = 399 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + L+E I + G+ ++E+P G Sbjct: 182 LASGVDTPYPRGHTELIERIAEQ-GLVLAELPPG 214 >gi|237740653|ref|ZP_04571134.1| smf protein [Fusobacterium sp. 2_1_31] gi|229422670|gb|EEO37717.1| smf protein [Fusobacterium sp. 2_1_31] Length = 283 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP N +L +EI + G+ +SE G Sbjct: 99 IASGLDIVYPASNLSLYKEI-EEKGLILSEYEAG 131 >gi|170694016|ref|ZP_02885172.1| DNA protecting protein DprA [Burkholderia graminis C4D1M] gi|170141088|gb|EDT09260.1| DNA protecting protein DprA [Burkholderia graminis C4D1M] Length = 431 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L +I G +SE P G Sbjct: 180 IGTGADLVYPAAHHALARQIALQ-GAILSEWPLG 212 >gi|56552090|ref|YP_162929.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ZM4] gi|56543664|gb|AAV89818.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ZM4] Length = 385 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGLD YPPEN+ L + I + G+ +SE+P Sbjct: 173 IAGGLDSFYPPENKELQQAISE-KGLVVSEMPP 204 >gi|260752380|ref|YP_003225273.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|258551743|gb|ACV74689.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 385 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGLD YPPEN+ L + I + G+ +SE+P Sbjct: 173 IAGGLDSFYPPENKELQQAISE-KGLVVSEMPP 204 >gi|209515835|ref|ZP_03264697.1| DNA protecting protein DprA [Burkholderia sp. H160] gi|209503683|gb|EEA03677.1| DNA protecting protein DprA [Burkholderia sp. H160] Length = 409 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L +I G +SE P G Sbjct: 180 IGTGADLVYPAAHHALARQI-ATQGAILSEWPLG 212 >gi|229587598|ref|YP_002869717.1| hypothetical protein PFLU0020 [Pseudomonas fluorescens SBW25] gi|229359464|emb|CAY46305.1| conserved SMF-related protein [Pseudomonas fluorescens SBW25] Length = 364 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ YP ++ L + D G ISE P Sbjct: 181 LGTGLENFYPQRHKRLAAAMIDQGSAVISEFPL 213 >gi|257068192|ref|YP_003154447.1| DNA protecting protein DprA [Brachybacterium faecium DSM 4810] gi|256559010|gb|ACU84857.1| DNA protecting protein DprA [Brachybacterium faecium DSM 4810] Length = 428 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD LYP N LLE I + +SE P G Sbjct: 232 LAGGLDSLYPRGNSQLLERIRARH-LLVSEAPPG 264 >gi|289763072|ref|ZP_06522450.1| smf family protein [Mycobacterium tuberculosis GM 1503] gi|289710578|gb|EFD74594.1| smf family protein [Mycobacterium tuberculosis GM 1503] Length = 308 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D YP + LL I G+ +E P G Sbjct: 100 LAGGFDIPYPAGHSALLHRI-AQHGVLFTEYPPG 132 >gi|241762041|ref|ZP_04760125.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|241373507|gb|EER63094.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 385 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGLD YPPEN+ L + I + G+ +SE+P Sbjct: 173 IAGGLDSFYPPENKELQQAISE-KGLVVSEMPP 204 >gi|157373178|ref|YP_001471778.1| DNA protecting protein DprA [Shewanella sediminis HAW-EB3] gi|157315552|gb|ABV34650.1| DNA protecting protein DprA [Shewanella sediminis HAW-EB3] Length = 368 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP ++ L E+I G ISE Sbjct: 172 LGTGVEVIYPRRHKKLYEKI-QCHGAVISEF 201 >gi|170781198|ref|YP_001709530.1| putative DNA-binding/uptake protein [Clavibacter michiganensis subsp. sepedonicus] gi|169155766|emb|CAQ00887.1| putative DNA-binding/uptake protein [Clavibacter michiganensis subsp. sepedonicus] Length = 478 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D LYP + L + G +SE+P G Sbjct: 261 LAGGVDRLYPSGHAELFARM-RRDGAVVSELPCG 293 >gi|111023512|ref|YP_706484.1| Smf protein [Rhodococcus jostii RHA1] gi|110823042|gb|ABG98326.1| Smf protein [Rhodococcus jostii RHA1] Length = 138 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G+D YP + +L +I G ISE Sbjct: 104 LACGVDRAYPAGHARMLRQI-AQNGAVISEY 133 >gi|329851389|ref|ZP_08266146.1| DNA protecting protein DprA [Asticcacaulis biprosthecum C19] gi|328840235|gb|EGF89807.1| DNA protecting protein DprA [Asticcacaulis biprosthecum C19] Length = 372 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG+D +YPP+N L + + + G+ +SE P G Sbjct: 172 LGGGIDDVYPPDNAALYQRLREQ-GLLVSESPVG 204 >gi|320335675|ref|YP_004172386.1| DNA protecting protein DprA [Deinococcus maricopensis DSM 21211] gi|319756964|gb|ADV68721.1| DNA protecting protein DprA [Deinococcus maricopensis DSM 21211] Length = 358 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 5/34 (14%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN+ L + +SE P G Sbjct: 182 LGSGVDTIYPAENKALAARL-----CVVSEYPLG 210 >gi|258541853|ref|YP_003187286.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-01] gi|256632931|dbj|BAH98906.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-01] gi|256635988|dbj|BAI01957.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-03] gi|256639043|dbj|BAI05005.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-07] gi|256642097|dbj|BAI08052.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-22] gi|256645152|dbj|BAI11100.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-26] gi|256648207|dbj|BAI14148.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-32] gi|256651260|dbj|BAI17194.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-01-42C] gi|256654251|dbj|BAI20178.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-12] Length = 208 Score = 51.9 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLDC YPPEN +L EI G ++E P G Sbjct: 164 IAGGLDCPYPPENASLQAEI-AQKGAVVTEAPLG 196 >gi|319785848|ref|YP_004145323.1| DNA protecting protein DprA [Pseudoxanthomonas suwonensis 11-1] gi|317464360|gb|ADV26092.1| DNA protecting protein DprA [Pseudoxanthomonas suwonensis 11-1] Length = 375 Score = 51.5 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP + L+E + G +SE P G Sbjct: 166 LGTGPDLPYPRHHARLMERVAAQ-GAVVSEHPPG 198 >gi|308375917|ref|ZP_07445533.2| hypothetical protein TMGG_02430 [Mycobacterium tuberculosis SUMu007] gi|308344817|gb|EFP33668.1| hypothetical protein TMGG_02430 [Mycobacterium tuberculosis SUMu007] Length = 342 Score = 51.5 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D YP + LL I G+ +E P G Sbjct: 134 LAGGFDIPYPAGHSALLHRI-AQHGVLFTEYPPG 166 >gi|4100626|gb|AAD00901.1| FIR2 [Rhodococcus fascians] Length = 293 Score = 51.5 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD YP + LLE + + G+ +SE FG Sbjct: 174 MPCGLDRAYPSGHARLLERVAEQ-GVVVSEYSFG 206 >gi|4511994|gb|AAD21554.1| DNA processing chain A [Zymomonas mobilis subsp. mobilis ZM4] Length = 385 Score = 51.5 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGLD YPPEN+ L + I + G+ +SE+P Sbjct: 173 IAGGLDSFYPPENKELQQAISE-KGLVVSEMPP 204 >gi|294507187|ref|YP_003571245.1| SMF protein [Salinibacter ruber M8] gi|294343515|emb|CBH24293.1| SMF protein [Salinibacter ruber M8] Length = 331 Score = 51.5 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ +YP ++ L E I ++ G +SE Sbjct: 131 LGSGVGRVYPKKHTALAERIAEH-GAVLSEY 160 >gi|170719275|ref|YP_001746963.1| DNA protecting protein DprA [Pseudomonas putida W619] gi|169757278|gb|ACA70594.1| DNA protecting protein DprA [Pseudomonas putida W619] Length = 365 Score = 51.5 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP +R+L + + D+G +SE P Sbjct: 181 LGTGLQKLYPQRHRDLAKAMIDSGSALVSEYPL 213 >gi|294617499|ref|ZP_06697130.1| putative DNA processing Smf protein [Enterococcus faecium E1679] gi|291596239|gb|EFF27501.1| putative DNA processing Smf protein [Enterococcus faecium E1679] Length = 176 Score = 51.5 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 59 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 90 >gi|254519203|ref|ZP_05131259.1| SMF family protein [Clostridium sp. 7_2_43FAA] gi|226912952|gb|EEH98153.1| SMF family protein [Clostridium sp. 7_2_43FAA] Length = 348 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP N+ L E++ G+ ISE Sbjct: 164 LGCGIDIVYPKCNKFLYEKVI-REGLLISEF 193 >gi|296112115|ref|YP_003622497.1| DNA processing protein DprA, putative [Leuconostoc kimchii IMSNU 11154] gi|295833647|gb|ADG41528.1| DNA processing protein DprA, putative [Leuconostoc kimchii IMSNU 11154] Length = 288 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP N +L ++I G+ +SE G Sbjct: 167 IGTGIDIFYPRRNESLQKQIALQ-GLVLSEYMPG 199 >gi|326333663|ref|ZP_08199900.1| DNA protecting protein DprA [Nocardioidaceae bacterium Broad-1] gi|325948569|gb|EGD40672.1| DNA protecting protein DprA [Nocardioidaceae bacterium Broad-1] Length = 390 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP NR LL+ I ++ G ISEI G Sbjct: 191 LAGGVDVPYPLRNRRLLDAIAES-GAVISEIAPG 223 >gi|323339884|ref|ZP_08080153.1| DNA protecting protein DprA [Lactobacillus ruminis ATCC 25644] gi|323092757|gb|EFZ35360.1| DNA protecting protein DprA [Lactobacillus ruminis ATCC 25644] Length = 294 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP N L E+ G+ ++E P G Sbjct: 168 IGTGLDVVYPRGNVMLQNEVAA-KGLLLTEYPLG 200 >gi|167031106|ref|YP_001666337.1| DNA protecting protein DprA [Pseudomonas putida GB-1] gi|166857594|gb|ABY96001.1| DNA protecting protein DprA [Pseudomonas putida GB-1] Length = 365 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L + + DNG +SE P Sbjct: 181 LGTGLQKLYPQRHHELAQAMIDNGSALVSEYPL 213 >gi|239944629|ref|ZP_04696566.1| putative DNA processing Smf-family protein [Streptomyces roseosporus NRRL 15998] gi|291448093|ref|ZP_06587483.1| DNA processing Smf-family protein [Streptomyces roseosporus NRRL 15998] gi|291351040|gb|EFE77944.1| DNA processing Smf-family protein [Streptomyces roseosporus NRRL 15998] Length = 378 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G+D YP + LL + + G+ ++E+P Sbjct: 173 LACGVDVPYPRGHAELLGRMAEQ-GLVVAELPP 204 >gi|303237995|ref|ZP_07324538.1| putative DNA protecting protein DprA [Prevotella disiens FB035-09AN] gi|302481785|gb|EFL44837.1| putative DNA protecting protein DprA [Prevotella disiens FB035-09AN] Length = 375 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 17/32 (53%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A GLD +YP + E+ + GG I+E P Sbjct: 177 AHGLDFIYPRTHTQTAAEMCEQGGGVITEYPI 208 >gi|238921408|ref|YP_002934923.1| protein smf [Edwardsiella ictaluri 93-146] gi|238870977|gb|ACR70688.1| protein smf [Edwardsiella ictaluri 93-146] Length = 370 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G DC+ P +R L + I + G +SE G Sbjct: 164 LGSGPDCVAPRTHRWLAQAILEADGALVSEFFPG 197 >gi|51892618|ref|YP_075309.1| hypothetical protein STH1480 [Symbiobacterium thermophilum IAM 14863] gi|51856307|dbj|BAD40465.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM 14863] Length = 386 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG D YP E+ L ++ + G +SE P G Sbjct: 197 LGGGADVCYPQESAALYRQMRET-GAILSEQPPG 229 >gi|293377185|ref|ZP_06623393.1| putative DNA protecting protein DprA [Enterococcus faecium PC4.1] gi|292644205|gb|EFF62307.1| putative DNA protecting protein DprA [Enterococcus faecium PC4.1] Length = 199 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP ENR+L +E+ N + +SE P Sbjct: 82 IGTGIEQVYPAENRDL-QEVIANDHLLLSEYPP 113 >gi|32476472|ref|NP_869466.1| DNA processing chain A [Rhodopirellula baltica SH 1] gi|32447017|emb|CAD78923.1| DNA processing chain A [Rhodopirellula baltica SH 1] Length = 455 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GGL +YP EN L ++I ++ G ISE Sbjct: 257 LGGGLGKIYPAENSPLADKISEH-GAVISEYAP 288 >gi|319789158|ref|YP_004150791.1| DNA protecting protein DprA [Thermovibrio ammonificans HB-1] gi|317113660|gb|ADU96150.1| DNA protecting protein DprA [Thermovibrio ammonificans HB-1] Length = 334 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D ++P N +L EEI ++GG +SE G Sbjct: 155 LGSGVDRVFPLTNLHLAEEIVESGGGLLSEFSLG 188 >gi|313829531|gb|EFS67245.1| DNA protecting protein DprA [Propionibacterium acnes HL063PA2] Length = 377 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPLG 210 >gi|84516624|ref|ZP_01003983.1| DNA processing protein DprA, putative [Loktanella vestfoldensis SKA53] gi|84509660|gb|EAQ06118.1| DNA processing protein DprA, putative [Loktanella vestfoldensis SKA53] Length = 336 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L +I G+ I+E+P G Sbjct: 141 AGGVDVIYPVENTQLAHDIAKQ-GLRIAEMPMG 172 >gi|239991093|ref|ZP_04711757.1| putative DNA processing Smf-family protein [Streptomyces roseosporus NRRL 11379] Length = 370 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G+D YP + LL + + G+ ++E+P Sbjct: 165 LACGVDVPYPRGHAELLGRMAEQ-GLVVAELPP 196 >gi|313813527|gb|EFS51241.1| DNA protecting protein DprA [Propionibacterium acnes HL025PA1] Length = 377 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPLG 210 >gi|325679349|ref|ZP_08158934.1| DNA protecting protein DprA [Ruminococcus albus 8] gi|324108946|gb|EGC03177.1| DNA protecting protein DprA [Ruminococcus albus 8] Length = 288 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+ YP N L E I N G ISE P Sbjct: 172 LGCGIHYDYPRGNGQLKEAI-ANNGAVISEYPP 203 >gi|149910326|ref|ZP_01898969.1| Smf protein [Moritella sp. PE36] gi|149806574|gb|EDM66542.1| Smf protein [Moritella sp. PE36] Length = 368 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L ++I + G +SE Sbjct: 172 LGTGLANVYPKRHLKLAQQIRE-KGALVSEFSP 203 >gi|289427793|ref|ZP_06429504.1| DNA protecting protein DprA [Propionibacterium acnes J165] gi|289159057|gb|EFD07250.1| DNA protecting protein DprA [Propionibacterium acnes J165] gi|313763675|gb|EFS35039.1| DNA protecting protein DprA [Propionibacterium acnes HL013PA1] gi|313801455|gb|EFS42706.1| DNA protecting protein DprA [Propionibacterium acnes HL110PA2] gi|313807865|gb|EFS46346.1| DNA protecting protein DprA [Propionibacterium acnes HL087PA2] gi|313811664|gb|EFS49378.1| DNA protecting protein DprA [Propionibacterium acnes HL083PA1] gi|313816850|gb|EFS54564.1| DNA protecting protein DprA [Propionibacterium acnes HL059PA1] gi|313819650|gb|EFS57364.1| DNA protecting protein DprA [Propionibacterium acnes HL046PA2] gi|313822245|gb|EFS59959.1| DNA protecting protein DprA [Propionibacterium acnes HL036PA1] gi|313823522|gb|EFS61236.1| DNA protecting protein DprA [Propionibacterium acnes HL036PA2] gi|313825850|gb|EFS63564.1| DNA protecting protein DprA [Propionibacterium acnes HL063PA1] gi|313831405|gb|EFS69119.1| DNA protecting protein DprA [Propionibacterium acnes HL007PA1] gi|313835017|gb|EFS72731.1| DNA protecting protein DprA [Propionibacterium acnes HL056PA1] gi|313839826|gb|EFS77540.1| DNA protecting protein DprA [Propionibacterium acnes HL086PA1] gi|314914677|gb|EFS78508.1| DNA protecting protein DprA [Propionibacterium acnes HL005PA4] gi|314919210|gb|EFS83041.1| DNA protecting protein DprA [Propionibacterium acnes HL050PA1] gi|314920880|gb|EFS84711.1| DNA protecting protein DprA [Propionibacterium acnes HL050PA3] gi|314924577|gb|EFS88408.1| DNA protecting protein DprA [Propionibacterium acnes HL036PA3] gi|314930448|gb|EFS94279.1| DNA protecting protein DprA [Propionibacterium acnes HL067PA1] gi|314954499|gb|EFS98905.1| DNA protecting protein DprA [Propionibacterium acnes HL027PA1] gi|314957379|gb|EFT01482.1| DNA protecting protein DprA [Propionibacterium acnes HL002PA1] gi|314961998|gb|EFT06099.1| DNA protecting protein DprA [Propionibacterium acnes HL002PA2] gi|314963577|gb|EFT07677.1| DNA protecting protein DprA [Propionibacterium acnes HL082PA1] gi|314968590|gb|EFT12688.1| DNA protecting protein DprA [Propionibacterium acnes HL037PA1] gi|314974280|gb|EFT18376.1| DNA protecting protein DprA [Propionibacterium acnes HL053PA1] gi|314976715|gb|EFT20810.1| DNA protecting protein DprA [Propionibacterium acnes HL045PA1] gi|314984417|gb|EFT28509.1| DNA protecting protein DprA [Propionibacterium acnes HL005PA1] gi|314986433|gb|EFT30525.1| DNA protecting protein DprA [Propionibacterium acnes HL005PA2] gi|314990793|gb|EFT34884.1| DNA protecting protein DprA [Propionibacterium acnes HL005PA3] gi|315079433|gb|EFT51426.1| DNA protecting protein DprA [Propionibacterium acnes HL053PA2] gi|315081341|gb|EFT53317.1| DNA protecting protein DprA [Propionibacterium acnes HL078PA1] gi|315083542|gb|EFT55518.1| DNA protecting protein DprA [Propionibacterium acnes HL027PA2] gi|315087222|gb|EFT59198.1| DNA protecting protein DprA [Propionibacterium acnes HL002PA3] gi|315095251|gb|EFT67227.1| DNA protecting protein DprA [Propionibacterium acnes HL038PA1] gi|315099301|gb|EFT71277.1| DNA protecting protein DprA [Propionibacterium acnes HL059PA2] gi|315100523|gb|EFT72499.1| DNA protecting protein DprA [Propionibacterium acnes HL046PA1] gi|315106705|gb|EFT78681.1| DNA protecting protein DprA [Propionibacterium acnes HL030PA1] gi|315108930|gb|EFT80906.1| DNA protecting protein DprA [Propionibacterium acnes HL030PA2] gi|327328319|gb|EGE70081.1| DNA processing / uptake protein [Propionibacterium acnes HL096PA2] gi|327329816|gb|EGE71572.1| DNA processing / uptake protein [Propionibacterium acnes HL096PA3] gi|327444344|gb|EGE90998.1| DNA protecting protein DprA [Propionibacterium acnes HL043PA2] gi|327455053|gb|EGF01708.1| DNA protecting protein DprA [Propionibacterium acnes HL087PA3] gi|327457659|gb|EGF04314.1| DNA protecting protein DprA [Propionibacterium acnes HL083PA2] gi|328752257|gb|EGF65873.1| DNA protecting protein DprA [Propionibacterium acnes HL020PA1] gi|328755116|gb|EGF68732.1| DNA protecting protein DprA [Propionibacterium acnes HL087PA1] gi|328758105|gb|EGF71721.1| DNA protecting protein DprA [Propionibacterium acnes HL025PA2] gi|328760131|gb|EGF73709.1| DNA processing / uptake protein [Propionibacterium acnes HL099PA1] gi|332675846|gb|AEE72662.1| DNA processing / uptake protein [Propionibacterium acnes 266] Length = 377 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPLG 210 >gi|327445018|gb|EGE91672.1| DNA protecting protein DprA [Propionibacterium acnes HL043PA1] Length = 377 Score = 51.5 bits (124), Expect = 4e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPLG 210 >gi|314978802|gb|EFT22896.1| DNA protecting protein DprA [Propionibacterium acnes HL072PA2] gi|315089395|gb|EFT61371.1| DNA protecting protein DprA [Propionibacterium acnes HL072PA1] Length = 377 Score = 51.1 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPLG 210 >gi|50842909|ref|YP_056136.1| DNA processing / uptake protein [Propionibacterium acnes KPA171202] gi|50840511|gb|AAT83178.1| DNA processing / uptake protein [Propionibacterium acnes KPA171202] Length = 377 Score = 51.1 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPLG 210 >gi|313794068|gb|EFS42092.1| DNA protecting protein DprA [Propionibacterium acnes HL110PA1] gi|327451913|gb|EGE98567.1| DNA protecting protein DprA [Propionibacterium acnes HL092PA1] Length = 376 Score = 51.1 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPLG 210 >gi|294666269|ref|ZP_06731520.1| DNA processing chain A [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] gi|292603978|gb|EFF47378.1| DNA processing chain A [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] Length = 267 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP ++ L + I + G +SE G Sbjct: 175 GTGVDVAYPERHQGLRDRIAER-GAVVSEYLPG 206 >gi|315125139|ref|YP_004067142.1| hypothetical protein PSM_A0028 [Pseudoalteromonas sp. SM9913] gi|315013652|gb|ADT66990.1| hypothetical protein PSM_A0028 [Pseudoalteromonas sp. SM9913] Length = 363 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP ++ L E++ G+ +SE G Sbjct: 173 LGTGVDVYYPKRHKLLTEQVL-TQGLLVSEFLPG 205 >gi|295130966|ref|YP_003581629.1| DNA protecting protein DprA [Propionibacterium acnes SK137] gi|291376560|gb|ADE00415.1| DNA protecting protein DprA [Propionibacterium acnes SK137] Length = 377 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPLG 210 >gi|238752656|ref|ZP_04614127.1| DNA protecting protein DprA [Yersinia rohdei ATCC 43380] gi|238709083|gb|EEQ01330.1| DNA protecting protein DprA [Yersinia rohdei ATCC 43380] Length = 373 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP + +L EI GG +SE Sbjct: 167 LGSGLENIYPRCHNHLAREIESQGGALVSEF 197 >gi|224369818|ref|YP_002603982.1| DprA [Desulfobacterium autotrophicum HRM2] gi|223692535|gb|ACN15818.1| DprA [Desulfobacterium autotrophicum HRM2] Length = 372 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP EN++L + I G+ ISE Sbjct: 174 LGSGLNWIYPRENQSLFQAIC-QTGVVISEFSP 205 >gi|153802462|ref|ZP_01957048.1| SMF protein [Vibrio cholerae MZO-3] gi|124121981|gb|EAY40724.1| SMF protein [Vibrio cholerae MZO-3] Length = 281 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + LD +P ENR L +EI N + ISE P G Sbjct: 174 LGTPLDQYFPKENRELQDEIAKNH-LLISEYPIG 206 >gi|83945523|ref|ZP_00957870.1| dprA protein [Oceanicaulis alexandrii HTCC2633] gi|83851099|gb|EAP88957.1| dprA protein [Oceanicaulis alexandrii HTCC2633] Length = 372 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGL +YPPE+ L I + G+ +SE P Sbjct: 171 LAGGLTSIYPPEHEALYHAISEQ-GLLVSESPP 202 >gi|327334330|gb|EGE76044.1| DNA processing / uptake protein [Propionibacterium acnes HL097PA1] Length = 377 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPLG 210 >gi|313773612|gb|EFS39578.1| DNA protecting protein DprA [Propionibacterium acnes HL074PA1] Length = 377 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPLG 210 >gi|332139432|ref|YP_004425170.1| DNA protecting protein DprA [Alteromonas macleodii str. 'Deep ecotype'] gi|327549454|gb|AEA96172.1| DNA protecting protein DprA [Alteromonas macleodii str. 'Deep ecotype'] Length = 369 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G D +YP +N L EI D+GG++++E G Sbjct: 174 MGTGPDKIYPAKNSKLYNEIHDSGGVSVTEFFPG 207 >gi|172057898|ref|YP_001814358.1| DNA protecting protein DprA [Exiguobacterium sibiricum 255-15] gi|171990419|gb|ACB61341.1| DNA protecting protein DprA [Exiguobacterium sibiricum 255-15] Length = 275 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +A G D LYP + L + I G+ +SE P Sbjct: 148 LASGFDFLYPARHAPLFQRI-QQDGLLLSEYP 178 >gi|94497602|ref|ZP_01304171.1| DNA processing chain A [Sphingomonas sp. SKA58] gi|94423019|gb|EAT08051.1| DNA processing chain A [Sphingomonas sp. SKA58] Length = 360 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D ++PPENR+L E + + G+ ++E P G Sbjct: 164 IACGIDVVFPPENRDLQEALAER-GLLVTEHPPG 196 >gi|19703906|ref|NP_603468.1| DNA processing chain A [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gi|19714072|gb|AAL94767.1| DNA processing chain A [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] Length = 304 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 1 MAGGLDC-LYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN L E+I +N G +SE+ Sbjct: 183 LGQGLDLAIYPRENIKLAEKILENKGFLLSEL 214 >gi|83719440|ref|YP_440686.1| DNA processing protein DprA [Burkholderia thailandensis E264] gi|83653265|gb|ABC37328.1| DNA processing protein DprA, putative [Burkholderia thailandensis E264] Length = 433 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G + +YP + L EI + G +SE P G Sbjct: 218 IGTGANLVYPACHHALAHEIAER-GALVSEWPLG 250 >gi|320154886|ref|YP_004187265.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio vulnificus MO6-24/O] gi|319930198|gb|ADV85062.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio vulnificus MO6-24/O] Length = 367 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G +YP ++ L E I G +SE Sbjct: 172 LGSGFQHIYPARHKGLAERI-GQQGALVSEF 201 >gi|313901180|ref|ZP_07834668.1| DNA protecting protein DprA [Clostridium sp. HGF2] gi|312954138|gb|EFR35818.1| DNA protecting protein DprA [Clostridium sp. HGF2] Length = 243 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP E+ +L + + ISE P G Sbjct: 128 IGCGLDVVYPKEHASLY-AVMRKKQLIISEYPNG 160 >gi|119960903|ref|YP_948169.1| DNA protecting protein DprA [Arthrobacter aurescens TC1] gi|119947762|gb|ABM06673.1| DNA protecting protein DprA [Arthrobacter aurescens TC1] Length = 411 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D YP N +LL G ISE+P G Sbjct: 214 MAGGVDRFYPSGNEDLLRA-VATQGAVISEVPPG 246 >gi|238924176|ref|YP_002937692.1| DNA protecting protein DprA [Eubacterium rectale ATCC 33656] gi|238875851|gb|ACR75558.1| DNA protecting protein DprA [Eubacterium rectale ATCC 33656] gi|291529046|emb|CBK94632.1| DNA protecting protein DprA [Eubacterium rectale M104/1] Length = 359 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP ENR L ++I +GG ISE+ G Sbjct: 169 LGSGADTCYPKENRFLYDKIKLSGG-IISELMPG 201 >gi|289426516|ref|ZP_06428259.1| DNA protecting protein DprA [Propionibacterium acnes SK187] gi|289153244|gb|EFD01962.1| DNA protecting protein DprA [Propionibacterium acnes SK187] Length = 391 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 192 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPLG 224 >gi|212716957|ref|ZP_03325085.1| hypothetical protein BIFCAT_01903 [Bifidobacterium catenulatum DSM 16992] gi|212660242|gb|EEB20817.1| hypothetical protein BIFCAT_01903 [Bifidobacterium catenulatum DSM 16992] Length = 455 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P N L E I + G ISE+ G Sbjct: 237 AGGLNHIGPKSNERLFETIISHSGALISELCPG 269 >gi|27364482|ref|NP_760010.1| DNA protecting protein DprA [Vibrio vulnificus CMCP6] gi|27360601|gb|AAO09537.1| DNA protecting protein DprA [Vibrio vulnificus CMCP6] Length = 367 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G +YP ++ L E I G +SE Sbjct: 172 LGSGFQHIYPARHKGLAERI-GQQGALVSEF 201 >gi|322382312|ref|ZP_08056219.1| DNA processing Smf single strand binding protein-like protein [Paenibacillus larvae subsp. larvae B-3650] gi|321153665|gb|EFX46040.1| DNA processing Smf single strand binding protein-like protein [Paenibacillus larvae subsp. larvae B-3650] Length = 281 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YPPEN L +I ++ G+ +SE+P G Sbjct: 166 LGGPADKIYPPENGQLYRQIAES-GLILSEVPVG 198 >gi|294791551|ref|ZP_06756708.1| DNA protecting protein DprA [Scardovia inopinata F0304] gi|294458022|gb|EFG26376.1| DNA protecting protein DprA [Scardovia inopinata F0304] Length = 356 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 18/32 (56%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGLD P N L + I ++ G ISE+P Sbjct: 229 AGGLDTCGPHRNARLFQTIENHHGALISELPP 260 >gi|260774552|ref|ZP_05883465.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio metschnikovii CIP 69.14] gi|260610458|gb|EEX35664.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio metschnikovii CIP 69.14] Length = 367 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+C+YP ++ L E I DN G ISE Sbjct: 166 LGSGLNCIYPTRHKTLAERIKDN-GALISEF 195 >gi|257064734|ref|YP_003144406.1| predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Slackia heliotrinireducens DSM 20476] gi|256792387|gb|ACV23057.1| predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Slackia heliotrinireducens DSM 20476] Length = 231 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP +N +L + I GG ++E Sbjct: 102 LGSGLDNPYPSDNIDLFQAIVGGGGCVVTEY 132 >gi|114570266|ref|YP_756946.1| DNA protecting protein DprA [Maricaulis maris MCS10] gi|114340728|gb|ABI66008.1| DNA protecting protein DprA [Maricaulis maris MCS10] Length = 387 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPPE+ L G+ +SE+P G Sbjct: 170 LAGGIDHIYPPEHGELHAR-LGEDGLLLSEVPLG 202 >gi|257091702|ref|YP_003165343.1| DNA protecting protein DprA [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] gi|257044226|gb|ACV33414.1| DNA protecting protein DprA [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] Length = 363 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D +YP N+ L +I G SE P Sbjct: 173 IGTGIDRIYPAANQQLAFDIAAR-GAIASEFPL 204 >gi|254488483|ref|ZP_05101688.1| DNA processing protein [Roseobacter sp. GAI101] gi|214045352|gb|EEB85990.1| DNA processing protein [Roseobacter sp. GAI101] Length = 347 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L +I + G+ +SE P G Sbjct: 147 AGGVDVMYPAENTQLAADIAAS-GLRLSEQPMG 178 >gi|291524905|emb|CBK90492.1| DNA protecting protein DprA [Eubacterium rectale DSM 17629] Length = 359 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP ENR L ++I +GG ISE+ G Sbjct: 169 LGSGADTCYPKENRFLYDKIKVSGG-IISELMPG 201 >gi|257440568|ref|ZP_05616323.1| DNA processing protein DprA [Faecalibacterium prausnitzii A2-165] gi|257196891|gb|EEU95175.1| DNA processing protein DprA [Faecalibacterium prausnitzii A2-165] Length = 381 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + +D YP NR L ++I + G ISE P Sbjct: 190 LGVPIDRTYPASNRELRKKI-EQKGCVISEYPP 221 >gi|77456247|ref|YP_345752.1| SMF protein [Pseudomonas fluorescens Pf0-1] gi|77380250|gb|ABA71763.1| DNA protecting protein DprA [Pseudomonas fluorescens Pf0-1] Length = 366 Score = 51.1 bits (123), Expect = 5e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ YP NR L + + +G +SE P Sbjct: 181 LGTGLENFYPQRNRRLADVMIASGSAVVSEFPL 213 >gi|259418008|ref|ZP_05741927.1| DNA protecting protein DprA [Silicibacter sp. TrichCH4B] gi|259346914|gb|EEW58728.1| DNA protecting protein DprA [Silicibacter sp. TrichCH4B] Length = 382 Score = 51.1 bits (123), Expect = 6e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GG+D +YP EN L + + G+ +SE P G Sbjct: 181 GGGVDIIYPSENARLATALAEQ-GLRLSEQPMG 212 >gi|119773187|ref|YP_925927.1| DNA processing protein DprA [Shewanella amazonensis SB2B] gi|119765687|gb|ABL98257.1| DNA processing protein DprA, putative [Shewanella amazonensis SB2B] Length = 338 Score = 51.1 bits (123), Expect = 6e-05, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP ++ +L +I G +SE G Sbjct: 142 LGTGIDEIYPKKHAHLANDILLR-GCIVSEFWPG 174 >gi|237740066|ref|ZP_04570547.1| DNA processing chain A [Fusobacterium sp. 2_1_31] gi|229422083|gb|EEO37130.1| DNA processing chain A [Fusobacterium sp. 2_1_31] Length = 267 Score = 51.1 bits (123), Expect = 6e-05, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN NL E+I +N G +SE+ Sbjct: 183 LGQGLDLEIYPRENINLAEKILENNGFLLSEL 214 >gi|91781429|ref|YP_556635.1| SMF protein [Burkholderia xenovorans LB400] gi|91685383|gb|ABE28583.1| DNA protecting protein DprA [Burkholderia xenovorans LB400] Length = 421 Score = 51.1 bits (123), Expect = 6e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L +I G +SE P G Sbjct: 180 IGTGADLVYPSAHHALARQIAVQ-GAILSEWPLG 212 >gi|325925738|ref|ZP_08187113.1| putative Rossmann fold nucleotide-binding protein involved in DNA uptake [Xanthomonas perforans 91-118] gi|325543866|gb|EGD15274.1| putative Rossmann fold nucleotide-binding protein involved in DNA uptake [Xanthomonas perforans 91-118] Length = 264 Score = 51.1 bits (123), Expect = 6e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP ++ L + I + G +SE G Sbjct: 58 GTGVDVAYPERHQGLRDRIAER-GAVVSEYLPG 89 >gi|288958693|ref|YP_003449034.1| DNA processing protein [Azospirillum sp. B510] gi|288911001|dbj|BAI72490.1| DNA processing protein [Azospirillum sp. B510] Length = 378 Score = 51.1 bits (123), Expect = 6e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPPEN L +I G+ ++E G Sbjct: 173 LAGGIDVVYPPENEALYRDILAQ-GVIVAESAIG 205 >gi|148272559|ref|YP_001222120.1| hypothetical protein CMM_1379 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|147830489|emb|CAN01424.1| conserved hypothetical protein [Clavibacter michiganensis subsp. michiganensis NCPPB 382] Length = 431 Score = 51.1 bits (123), Expect = 6e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D LYP + L + G +SE+P G Sbjct: 214 LAGGVDRLYPSGHTELFARM-RRDGAVVSELPCG 246 >gi|291302848|ref|YP_003514126.1| SMF family protein [Stackebrandtia nassauensis DSM 44728] gi|290572068|gb|ADD45033.1| SMF family protein [Stackebrandtia nassauensis DSM 44728] Length = 310 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G+D YP +R + + I G+ +S+ P G Sbjct: 184 ACGVDQYYPSGHREVFDRI-AQTGLIVSQFPVG 215 >gi|311898621|dbj|BAJ31029.1| putative DNA processing protein [Kitasatospora setae KM-6054] Length = 429 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP N L+E I G+ +SE+ G Sbjct: 232 LANGVDICYPRGNERLIERI-GQDGLLVSELALG 264 >gi|113952994|ref|YP_729765.1| DNA protecting protein DprA [Synechococcus sp. CC9311] gi|113880345|gb|ABI45303.1| putative DNA protecting protein DprA [Synechococcus sp. CC9311] Length = 368 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + LD +YPPE+ L + ++ G+ +SE P G Sbjct: 177 LGTPLDRVYPPEHEALQAQ-VESAGLLLSEWPRG 209 >gi|206890890|ref|YP_002248891.1| DNA processing protein DprA [Thermodesulfovibrio yellowstonii DSM 11347] gi|206742828|gb|ACI21885.1| DNA processing protein DprA [Thermodesulfovibrio yellowstonii DSM 11347] Length = 368 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+ C+YPPEN+ L E+I N G ISE Sbjct: 174 LGSGVSCIYPPENKMLAEKIIKN-GAIISEFYP 205 >gi|91203661|emb|CAJ71314.1| strongly similar to competence protein DprA [Candidatus Kuenenia stuttgartiensis] Length = 367 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP EN L E I G ISE P Sbjct: 172 LGCGLGTVYPKENTVLSENII-QHGALISEFPI 203 >gi|91225631|ref|ZP_01260705.1| SMF protein [Vibrio alginolyticus 12G01] gi|91189751|gb|EAS76025.1| SMF protein [Vibrio alginolyticus 12G01] Length = 281 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + LD +P ENR L +EI N + +SE P G Sbjct: 174 LGTPLDQYFPKENRELQDEIAKNH-LLVSEYPIG 206 >gi|119492307|ref|ZP_01623654.1| SMF protein [Lyngbya sp. PCC 8106] gi|119453192|gb|EAW34359.1| SMF protein [Lyngbya sp. PCC 8106] Length = 390 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP +NR L E + G+ +SE P G Sbjct: 178 GTGVDIIYPKDNRQLSERVIKQ-GLVMSEHPAG 209 >gi|307297637|ref|ZP_07577443.1| DNA protecting protein DprA [Thermotogales bacterium mesG1.Ag.4.2] gi|306916897|gb|EFN47279.1| DNA protecting protein DprA [Thermotogales bacterium mesG1.Ag.4.2] Length = 339 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP NR L++ G ISE G Sbjct: 159 LGTGIDVAYPASNRTLIKS-VKQKGCVISEFLPG 191 >gi|332991531|gb|AEF01586.1| DNA protecting protein DprA [Alteromonas sp. SN2] Length = 385 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G D +YPP+N +L +I + GG I+E G Sbjct: 190 MGTGPDIVYPPKNVSLHRDIVNAGGACITEFFPG 223 >gi|312869123|ref|ZP_07729297.1| DNA protecting protein DprA [Lactobacillus oris PB013-T2-3] gi|311095369|gb|EFQ53639.1| DNA protecting protein DprA [Lactobacillus oris PB013-T2-3] Length = 286 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GLD +YP ENR L +E G+ +SE Sbjct: 170 GCGLDRVYPTENRQL-QETVAQRGLVLSEY 198 >gi|116872707|ref|YP_849488.1| Smf family DNA processing protein [Listeria welshimeri serovar 6b str. SLCC5334] gi|116741585|emb|CAK20709.1| DNA processing protein, Smf family [Listeria welshimeri serovar 6b str. SLCC5334] Length = 286 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ +YP N L EI ++ G+ ISE Sbjct: 166 LGSGVSNIYPRSNEFLANEIIEH-GLLISEY 195 >gi|294625232|ref|ZP_06703872.1| DNA processing chain A [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122] gi|292600460|gb|EFF44557.1| DNA processing chain A [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122] Length = 381 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP ++ L + I + G +SE G Sbjct: 175 GTGVDVAYPERHQGLRDRIAER-GAVVSEYLPG 206 >gi|258590885|emb|CBE67180.1| DNA processing chain A (DprA/Smf) [NC10 bacterium 'Dutch sediment'] Length = 379 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL YPPE+ L ++I G ISE Sbjct: 179 LGCGLGVTYPPEHAELADQIAVQ-GAVISEF 208 >gi|224023530|ref|ZP_03641896.1| hypothetical protein BACCOPRO_00232 [Bacteroides coprophilus DSM 18228] gi|224016752|gb|EEF74764.1| hypothetical protein BACCOPRO_00232 [Bacteroides coprophilus DSM 18228] Length = 371 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R E+ +GG+ +E P G Sbjct: 177 LAHGLDRIYPAVHRLTAAEMIHHGGLL-TEYPSG 209 >gi|194291229|ref|YP_002007136.1| DNA processing chain a [Cupriavidus taiwanensis LMG 19424] gi|193225064|emb|CAQ71075.1| similar to smf, putative DNA processing chain A (drpA); putative exported protein [Cupriavidus taiwanensis LMG 19424] Length = 400 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D +YPP+N L E+ + G ++E P G Sbjct: 201 GTGADRVYPPDNLALAREVAER-GAVVTEFPLG 232 >gi|187922315|ref|YP_001893957.1| DNA protecting protein DprA [Burkholderia phytofirmans PsJN] gi|187713509|gb|ACD14733.1| DNA protecting protein DprA [Burkholderia phytofirmans PsJN] Length = 422 Score = 50.7 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L +I G +SE P G Sbjct: 180 IGTGADLVYPAAHHALARQIAVQ-GAILSEWPLG 212 >gi|308273580|emb|CBX30182.1| Protein smf [uncultured Desulfobacterium sp.] Length = 373 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +N L I +N G ISE+P Sbjct: 171 LGSGLGRIYPVQNTKLFHMISEN-GAVISELPL 202 >gi|294648883|ref|ZP_06726339.1| smf family protein [Acinetobacter haemolyticus ATCC 19194] gi|292825274|gb|EFF84021.1| smf family protein [Acinetobacter haemolyticus ATCC 19194] Length = 376 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GLD +YP ++ L ++I G ISE Sbjct: 180 GTGLDRVYPTQHVQLAQQI-AQSGAIISEF 208 >gi|209693701|ref|YP_002261629.1| Smf protein [Aliivibrio salmonicida LFI1238] gi|208007652|emb|CAQ77762.1| Smf protein [Aliivibrio salmonicida LFI1238] Length = 369 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP ++R L + + + G +SE Sbjct: 174 LGSGLNKVYPAKHRTLADRVI-HNGALVSEF 203 >gi|78049484|ref|YP_365659.1| DNA processing chain A [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|78037914|emb|CAJ25659.1| DNA processing chain A [Xanthomonas campestris pv. vesicatoria str. 85-10] Length = 381 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP ++ L + I + G +SE G Sbjct: 175 GTGVDVAYPERHQGLRDRIAER-GAVVSEYLPG 206 >gi|148977702|ref|ZP_01814263.1| SMF protein [Vibrionales bacterium SWAT-3] gi|145963070|gb|EDK28339.1| SMF protein [Vibrionales bacterium SWAT-3] Length = 330 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP + +L EI NGG ++E G Sbjct: 188 LGTGIDSNYPRGSEHLRAEIVANGGAIVTEYLIG 221 >gi|297183540|gb|ADI19669.1| predicted rossmann fold nucleotide-binding protein involved in DNA uptake [uncultured Alteromonadales bacterium HF4000_16C08] Length = 373 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G D +YP +N L ++I G I+E G Sbjct: 178 MGTGPDKVYPRKNSALHQDIISANGACITEFFPG 211 >gi|294102506|ref|YP_003554364.1| DNA protecting protein DprA [Aminobacterium colombiense DSM 12261] gi|293617486|gb|ADE57640.1| DNA protecting protein DprA [Aminobacterium colombiense DSM 12261] Length = 368 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G + +YP ++++L +I + G I+E G Sbjct: 170 LAHGHNRIYPRQHKDLFSKIVGS-GALITEYGLG 202 >gi|189183183|ref|YP_001936968.1| DNA processing protein Smf [Orientia tsutsugamushi str. Ikeda] gi|189179954|dbj|BAG39734.1| DNA processing protein Smf [Orientia tsutsugamushi str. Ikeda] Length = 386 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG+D +YP EN NL +I N G+ ++E+P Sbjct: 177 IAGGVDHIYPQENINLYHKI-ANEGLILAELPI 208 >gi|182437376|ref|YP_001825095.1| hypothetical protein SGR_3583 [Streptomyces griseus subsp. griseus NBRC 13350] gi|178465892|dbj|BAG20412.1| hypothetical protein [Streptomyces griseus subsp. griseus NBRC 13350] Length = 342 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 1 MAGGL-DCLYPPENRNLLEEIWDNGGIAISEI 31 M G+ + +YP +N++L I ++GG +S+ Sbjct: 205 MGTGIANKIYPAQNKSLAARIVESGGALVSQF 236 >gi|297559215|ref|YP_003678189.1| DNA protecting protein DprA [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] gi|296843663|gb|ADH65683.1| DNA protecting protein DprA [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] Length = 400 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD YP + L + G+ +SE P G Sbjct: 209 LACGLDVDYPRGHAGLFAD-VARTGVLVSERPVG 241 >gi|282891549|ref|ZP_06300040.1| hypothetical protein pah_c180o027 [Parachlamydia acanthamoebae str. Hall's coccus] gi|281498517|gb|EFB40845.1| hypothetical protein pah_c180o027 [Parachlamydia acanthamoebae str. Hall's coccus] Length = 320 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP ENR+L + + G I+E P Sbjct: 171 IGSGLSHLYPYENRDLA-RLIEREGAVITEYPM 202 >gi|237785755|ref|YP_002906460.1| putative DNA processing protein [Corynebacterium kroppenstedtii DSM 44385] gi|237758667|gb|ACR17917.1| putative DNA processing protein [Corynebacterium kroppenstedtii DSM 44385] Length = 435 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G+D YP +R +I G+ I+E P G Sbjct: 235 AHGIDVTYPAAHRTEFNDI-AREGVVITEYPPG 266 >gi|164688549|ref|ZP_02212577.1| hypothetical protein CLOBAR_02194 [Clostridium bartlettii DSM 16795] gi|164602962|gb|EDQ96427.1| hypothetical protein CLOBAR_02194 [Clostridium bartlettii DSM 16795] Length = 374 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + +D + P NR + ++I +NGGI +SE G Sbjct: 174 LGSPIDNILPSRNRKIADKILENGGIIVSEFFLG 207 >gi|167561028|ref|ZP_02353944.1| DNA protecting protein DprA [Burkholderia oklahomensis EO147] Length = 395 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G D +YP + L EI + G +SE P Sbjct: 180 IGTGADLVYPACHHALAHEIAER-GALVSEWPL 211 >gi|21244527|ref|NP_644109.1| DNA processing chain A [Xanthomonas axonopodis pv. citri str. 306] gi|21110199|gb|AAM38645.1| DNA processing chain A [Xanthomonas axonopodis pv. citri str. 306] Length = 381 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP ++ L + I + G +SE G Sbjct: 175 GTGVDVAYPERHQGLRDRIAER-GAVVSEYLPG 206 >gi|293400521|ref|ZP_06644666.1| DNA protecting protein DprA [Erysipelotrichaceae bacterium 5_2_54FAA] gi|291305547|gb|EFE46791.1| DNA protecting protein DprA [Erysipelotrichaceae bacterium 5_2_54FAA] Length = 245 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GLD YP N ++ ++I + +SE P Sbjct: 132 GCGLDVYYPKVNADI-QQIMAEKQLVLSEYPP 162 >gi|212213457|ref|YP_002304393.1| DNA processing protein [Coxiella burnetii CbuG_Q212] gi|212011867|gb|ACJ19248.1| DNA processing protein [Coxiella burnetii CbuG_Q212] Length = 308 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP + L E+I G +SE Sbjct: 123 LGSGLTNIYPRRHHRLAEQI-SQKGALVSEF 152 >gi|307292856|ref|ZP_07572702.1| DNA protecting protein DprA [Sphingobium chlorophenolicum L-1] gi|306880922|gb|EFN12138.1| DNA protecting protein DprA [Sphingobium chlorophenolicum L-1] Length = 360 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +PPEN +L E+ N G+ ++E P G Sbjct: 164 IACGIDIAFPPENADLQEQ-VANEGLLVTEHPPG 196 >gi|257463052|ref|ZP_05627454.1| DNA processing chain A [Fusobacterium sp. D12] gi|317060656|ref|ZP_07925141.1| SMF family protein [Fusobacterium sp. D12] gi|313686332|gb|EFS23167.1| SMF family protein [Fusobacterium sp. D12] Length = 301 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGL-DCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL + +YP EN L I D GG +SE+P Sbjct: 180 LGQGLANEIYPRENGYLASRILDTGGFLLSELPP 213 >gi|167617457|ref|ZP_02386088.1| DNA processing protein DprA, putative [Burkholderia thailandensis Bt4] gi|257140667|ref|ZP_05588929.1| DNA processing protein DprA, putative [Burkholderia thailandensis E264] Length = 395 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G + +YP + L EI + G +SE P G Sbjct: 180 IGTGANLVYPACHHALAHEIAER-GALVSEWPLG 212 >gi|59713148|ref|YP_205924.1| DNA processing protein DprA [Vibrio fischeri ES114] gi|59481249|gb|AAW87036.1| DNA processing protein DprA (Smf), possibly competence-related [Vibrio fischeri ES114] Length = 369 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP ++R L + + +N G +SE Sbjct: 174 LGSGLEKIYPAKHRALAQRVSEN-GALVSEF 203 >gi|253991649|ref|YP_003043005.1| DNA protecting protein DprA [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] gi|253783099|emb|CAQ86264.1| conserved hypothetical protein [Photorhabdus asymbiotica] Length = 361 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + +L ++I + G +SE Sbjct: 167 LGSGLGHIYPHRHVSLAKQI-EENGALVSEFFP 198 >gi|262067114|ref|ZP_06026726.1| DNA processing chain A [Fusobacterium periodonticum ATCC 33693] gi|291379169|gb|EFE86687.1| DNA processing chain A [Fusobacterium periodonticum ATCC 33693] Length = 304 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN L E+I +N G +SE+ Sbjct: 183 LGQGLDLEVYPKENIKLAEKILENNGFLLSEL 214 >gi|148284625|ref|YP_001248715.1| DNA processing protein [Orientia tsutsugamushi str. Boryong] gi|146740064|emb|CAM80189.1| DNA processing protein [Orientia tsutsugamushi str. Boryong] Length = 386 Score = 50.7 bits (122), Expect = 7e-05, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG+D +YP EN NL +I N G+ ++E+P Sbjct: 177 IAGGVDHIYPQENINLYHKI-ANEGLILAELPI 208 >gi|149279365|ref|ZP_01885496.1| putative DNA processing Smf-like protein [Pedobacter sp. BAL39] gi|149229891|gb|EDM35279.1| putative DNA processing Smf-like protein [Pedobacter sp. BAL39] Length = 365 Score = 50.7 bits (122), Expect = 8e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A GLD +YP + + +++ +GG I+E P Sbjct: 171 LAHGLDRIYPSGHFGVAQKMIADGG-LITEFPL 202 >gi|107024059|ref|YP_622386.1| DNA processing protein DprA [Burkholderia cenocepacia AU 1054] gi|105894248|gb|ABF77413.1| DNA protecting protein DprA [Burkholderia cenocepacia AU 1054] Length = 475 Score = 50.7 bits (122), Expect = 8e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D +YP +R L EI + G + E P G Sbjct: 233 IATGADLVYPARHRALAHEIAAH-GAIVPEWPLG 265 >gi|322831107|ref|YP_004211134.1| DNA protecting protein DprA [Rahnella sp. Y9602] gi|321166308|gb|ADW72007.1| DNA protecting protein DprA [Rahnella sp. Y9602] Length = 389 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 16/30 (53%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL YPP + L + I + GG +SE Sbjct: 167 LGSGLMKRYPPCHLKLADRILEQGGALVSE 196 >gi|296161361|ref|ZP_06844168.1| DNA protecting protein DprA [Burkholderia sp. Ch1-1] gi|295888347|gb|EFG68158.1| DNA protecting protein DprA [Burkholderia sp. Ch1-1] Length = 421 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L +I G +SE P G Sbjct: 180 IGTGADLVYPSAHHALARQIAVQ-GAILSEWPLG 212 >gi|315265384|gb|ADT92237.1| DNA protecting protein DprA [Shewanella baltica OS678] Length = 362 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP ++R L +I G +SE Sbjct: 166 LGTGIETVYPRKHRQLYHDI-QQQGCILSEF 195 >gi|225574889|ref|ZP_03783499.1| hypothetical protein RUMHYD_02967 [Blautia hydrogenotrophica DSM 10507] gi|225037895|gb|EEG48141.1| hypothetical protein RUMHYD_02967 [Blautia hydrogenotrophica DSM 10507] Length = 296 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 6/39 (15%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE-----IPFG 34 + G+D YP ++ +L ++W +GG ISE +P G Sbjct: 104 LGSGVDICYPKQHDSLYRQVWQSGG-LISEKKPGTMPLG 141 >gi|85708361|ref|ZP_01039427.1| DNA processing chain A [Erythrobacter sp. NAP1] gi|85689895|gb|EAQ29898.1| DNA processing chain A [Erythrobacter sp. NAP1] Length = 384 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YPP++ +L E I + I+E P G Sbjct: 177 IASGIDIAYPPQHTDLQERIAA-DCLLIAEQPPG 209 >gi|167568289|ref|ZP_02361163.1| DNA protecting protein DprA [Burkholderia oklahomensis C6786] Length = 395 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G D +YP + L EI + G +SE P Sbjct: 180 IGTGADLVYPACHHALAHEIAER-GALVSEWPL 211 >gi|294782266|ref|ZP_06747592.1| DNA protecting protein DprA [Fusobacterium sp. 1_1_41FAA] gi|294480907|gb|EFG28682.1| DNA protecting protein DprA [Fusobacterium sp. 1_1_41FAA] Length = 284 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP N +L +EI + G+ ++E G Sbjct: 99 IASGLDIIYPASNLSLYKEI-EEKGLILTEYEAG 131 >gi|291544309|emb|CBL17418.1| DNA protecting protein DprA [Ruminococcus sp. 18P13] Length = 408 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G++ YP EN L E++ ++ G+ ++E G Sbjct: 170 LGCGINVNYPKENAELKEQMTES-GLILTEFLPG 202 >gi|300022164|ref|YP_003754775.1| DNA protecting protein DprA [Hyphomicrobium denitrificans ATCC 51888] gi|299523985|gb|ADJ22454.1| DNA protecting protein DprA [Hyphomicrobium denitrificans ATCC 51888] Length = 399 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD +YP E+ +L + + G +++ P G Sbjct: 182 LAGGLDWIYPREHADL-QRVIGEQGCLLTDRPPG 214 >gi|167579357|ref|ZP_02372231.1| DNA processing protein DprA, putative [Burkholderia thailandensis TXDOH] Length = 395 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G + +YP + L EI + G +SE P G Sbjct: 180 IGTGANLVYPACHHALAHEIAER-GALVSEWPLG 212 >gi|294638019|ref|ZP_06716279.1| DNA protecting protein DprA [Edwardsiella tarda ATCC 23685] gi|291088811|gb|EFE21372.1| DNA protecting protein DprA [Edwardsiella tarda ATCC 23685] Length = 370 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D + P +R L + I GG ISE G Sbjct: 164 LGSGPDIITPMAHRGLAQTILAAGGTVISEFFPG 197 >gi|261337239|ref|ZP_05965123.1| DNA protecting protein DprA [Bifidobacterium gallicum DSM 20093] gi|270277595|gb|EFA23449.1| DNA protecting protein DprA [Bifidobacterium gallicum DSM 20093] Length = 481 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 17/32 (53%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL+ + P N L E I G ISE+P Sbjct: 275 AGGLNHIGPSTNARLFEHIQTWHGALISEMPP 306 >gi|257456000|ref|ZP_05621209.1| DNA protecting protein DprA [Enhydrobacter aerosaccus SK60] gi|257446589|gb|EEV21623.1| DNA protecting protein DprA [Enhydrobacter aerosaccus SK60] Length = 409 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 16/31 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ YP + +L I +GG ISE+ Sbjct: 188 LGNGIKHCYPKNHASLKAHIIASGGCVISEL 218 >gi|157959863|ref|YP_001499897.1| DNA protecting protein DprA [Shewanella pealeana ATCC 700345] gi|157844863|gb|ABV85362.1| DNA protecting protein DprA [Shewanella pealeana ATCC 700345] Length = 339 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP +R++ I + G +SE Sbjct: 143 LGTGVDVIYPKRHRDIYNGIQE-DGCVLSEF 172 >gi|37681407|ref|NP_936016.1| Smf protein [Vibrio vulnificus YJ016] gi|37200159|dbj|BAC95987.1| Smf protein [Vibrio vulnificus YJ016] Length = 367 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G +YP ++ L I G +SE Sbjct: 172 LGSGFQHIYPARHKGLAARIC-QQGALVSEF 201 >gi|289523584|ref|ZP_06440438.1| smf protein [Anaerobaculum hydrogeniformans ATCC BAA-1850] gi|289503276|gb|EFD24440.1| smf protein [Anaerobaculum hydrogeniformans ATCC BAA-1850] Length = 374 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP +N L E G ISE P G Sbjct: 173 GTGVDVFYPAKNETLFEG-LKERGALISEYPLG 204 >gi|315651748|ref|ZP_07904753.1| DNA protecting protein DprA [Eubacterium saburreum DSM 3986] gi|315486003|gb|EFU76380.1| DNA protecting protein DprA [Eubacterium saburreum DSM 3986] Length = 371 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNG-GIAISEIPFG 34 + G++ YP N NL ++ + G ISE P G Sbjct: 177 LGTGVNICYPESNFNLYNKLCEKDCGGVISEFPLG 211 >gi|126172290|ref|YP_001048439.1| DNA protecting protein DprA [Shewanella baltica OS155] gi|152998584|ref|YP_001364265.1| DNA protecting protein DprA [Shewanella baltica OS185] gi|125995495|gb|ABN59570.1| DNA protecting protein DprA [Shewanella baltica OS155] gi|151363202|gb|ABS06202.1| DNA protecting protein DprA [Shewanella baltica OS185] Length = 338 Score = 50.3 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP ++R L +I G +SE Sbjct: 142 LGTGIETVYPRKHRQLYHDI-QQQGCILSEF 171 >gi|304412737|ref|ZP_07394340.1| DNA protecting protein DprA [Shewanella baltica OS183] gi|307305798|ref|ZP_07585544.1| DNA protecting protein DprA [Shewanella baltica BA175] gi|304348947|gb|EFM13362.1| DNA protecting protein DprA [Shewanella baltica OS183] gi|306911291|gb|EFN41717.1| DNA protecting protein DprA [Shewanella baltica BA175] Length = 338 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP ++R L +I G +SE Sbjct: 142 LGTGIETVYPRKHRQLYHDI-QQQGCILSEF 171 >gi|262067707|ref|ZP_06027319.1| DNA protecting protein DprA [Fusobacterium periodonticum ATCC 33693] gi|291378432|gb|EFE85950.1| DNA protecting protein DprA [Fusobacterium periodonticum ATCC 33693] Length = 284 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP N +L EI + G+ ++E G Sbjct: 99 IASGLDIVYPASNFSLYREI-EEKGLILTEYEAG 131 >gi|134102480|ref|YP_001108141.1| DNA processing chain A [Saccharopolyspora erythraea NRRL 2338] gi|291004129|ref|ZP_06562102.1| DNA processing chain A [Saccharopolyspora erythraea NRRL 2338] gi|133915103|emb|CAM05216.1| DNA processing chain A [Saccharopolyspora erythraea NRRL 2338] Length = 389 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D YP + LL I + G +SE G Sbjct: 194 LACGADIDYPSGHSMLLRAIGEQ-GAVVSEYAPG 226 >gi|160873159|ref|YP_001552475.1| DNA protecting protein DprA [Shewanella baltica OS195] gi|160858681|gb|ABX47215.1| DNA protecting protein DprA [Shewanella baltica OS195] Length = 338 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP ++R L +I G +SE Sbjct: 142 LGTGIETVYPRKHRQLYHDI-QQQGCILSEF 171 >gi|118617634|ref|YP_905966.1| hypothetical protein MUL_2062 [Mycobacterium ulcerans Agy99] gi|118569744|gb|ABL04495.1| conserved hypothetical membrane protein [Mycobacterium ulcerans Agy99] Length = 391 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + LL I G+ ++E P G Sbjct: 183 LAGGIDIPYPTGHSALLHWI-GQHGLLVTEYPPG 215 >gi|84498371|ref|ZP_00997168.1| SMF protein [Janibacter sp. HTCC2649] gi|84381871|gb|EAP97754.1| SMF protein [Janibacter sp. HTCC2649] Length = 390 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD YP + LL EI D G+ +SE+P G Sbjct: 192 LARGLDRAYPQAHEGLLREIAD-IGVVVSELPLG 224 >gi|160945997|ref|ZP_02093223.1| hypothetical protein FAEPRAM212_03530 [Faecalibacterium prausnitzii M21/2] gi|158443728|gb|EDP20733.1| hypothetical protein FAEPRAM212_03530 [Faecalibacterium prausnitzii M21/2] Length = 375 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M +D YP N L ++I + G ISE P Sbjct: 184 MGVPIDRTYPAANAALRQQI-ERKGCVISEYPP 215 >gi|317486705|ref|ZP_07945522.1| DNA protecting protein DprA [Bilophila wadsworthia 3_1_6] gi|316922088|gb|EFV43357.1| DNA protecting protein DprA [Bilophila wadsworthia 3_1_6] Length = 429 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP EN L I G+ ISE G Sbjct: 216 LGAGSDVCYPKENDGLRRSII-QRGLLISEYAPG 248 >gi|229496478|ref|ZP_04390192.1| Smf protein DNA processing chain A [Porphyromonas endodontalis ATCC 35406] gi|229316375|gb|EEN82294.1| Smf protein DNA processing chain A [Porphyromonas endodontalis ATCC 35406] Length = 368 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +RN+ E+ GG+ SE +G Sbjct: 175 LAHGLDRIYPAAHRNIAIEMVKKGGLL-SEYSWG 207 >gi|217971249|ref|YP_002356000.1| DNA protecting protein DprA [Shewanella baltica OS223] gi|217496384|gb|ACK44577.1| DNA protecting protein DprA [Shewanella baltica OS223] Length = 338 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP ++R L +I G +SE Sbjct: 142 LGTGIETVYPRKHRQLYHDI-QQQGCILSEF 171 >gi|331674793|ref|ZP_08375550.1| protein smf [Escherichia coli TA280] gi|331067702|gb|EGI39100.1| protein smf [Escherichia coli TA280] Length = 374 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ ++P + L + ++GG +SE Sbjct: 167 LGNGLNTIHPRRHARLATSLLEHGGALVSEF 197 >gi|161506041|ref|YP_001573153.1| DNA protecting protein DprA [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|160867388|gb|ABX24011.1| hypothetical protein SARI_04222 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] Length = 364 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP + L E + GG +SE Sbjct: 157 LGNGLAKIYPRRHATLAENLIAAGGAVVSEF 187 >gi|163816842|ref|ZP_02208205.1| hypothetical protein COPEUT_03032 [Coprococcus eutactus ATCC 27759] gi|158448099|gb|EDP25094.1| hypothetical protein COPEUT_03032 [Coprococcus eutactus ATCC 27759] Length = 360 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + G++ YP EN ++ I + GG+ +SE Sbjct: 173 LGSGINVPYPRENYDIYRSIVNGGGVVVSE 202 >gi|298385823|ref|ZP_06995380.1| DNA processing protein DprA [Bacteroides sp. 1_1_14] gi|298261051|gb|EFI03918.1| DNA processing protein DprA [Bacteroides sp. 1_1_14] Length = 373 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R E+ D GG+ +E P G Sbjct: 178 LAHGLDRIYPSLHRKTAVEMLDKGGLL-TEFPVG 210 >gi|253569154|ref|ZP_04846564.1| smf protein DNA processing chain A [Bacteroides sp. 1_1_6] gi|251841173|gb|EES69254.1| smf protein DNA processing chain A [Bacteroides sp. 1_1_6] Length = 373 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R E+ D GG+ +E P G Sbjct: 178 LAHGLDRIYPSLHRKTAVEMLDKGGLL-TEFPVG 210 >gi|29348479|ref|NP_811982.1| Smf protein DNA processing chain A [Bacteroides thetaiotaomicron VPI-5482] gi|29340383|gb|AAO78176.1| Smf protein DNA processing chain A [Bacteroides thetaiotaomicron VPI-5482] Length = 358 Score = 50.3 bits (121), Expect = 9e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R E+ D GG+ +E P G Sbjct: 163 LAHGLDRIYPSLHRKTAVEMLDKGGLL-TEFPVG 195 >gi|223937270|ref|ZP_03629176.1| SMF family protein [bacterium Ellin514] gi|223894055|gb|EEF60510.1| SMF family protein [bacterium Ellin514] Length = 252 Score = 50.3 bits (121), Expect = 1e-04, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ ++PPEN +L E I N G +S+ PF Sbjct: 56 LGTGINLVFPPENADLFERIAAN-GAVLSQFPF 87 >gi|229817793|ref|ZP_04448075.1| hypothetical protein BIFANG_03065 [Bifidobacterium angulatum DSM 20098] gi|229785582|gb|EEP21696.1| hypothetical protein BIFANG_03065 [Bifidobacterium angulatum DSM 20098] Length = 461 Score = 50.3 bits (121), Expect = 1e-04, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 18/32 (56%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL+ + P N L E I NGG +SE+ Sbjct: 221 AGGLNHIGPSSNLRLFEAIRANGGALVSEMCP 252 >gi|25169184|emb|CAD48020.1| putative smf family protein [Arthrobacter nicotinovorans] Length = 302 Score = 50.3 bits (121), Expect = 1e-04, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGLD YP N +L I G+ +SE P Sbjct: 185 AGGLDRDYPAGNADLAAAIRAR-GLIVSEQPP 215 >gi|294011703|ref|YP_003545163.1| DNA processing protein [Sphingobium japonicum UT26S] gi|292675033|dbj|BAI96551.1| DNA processing protein [Sphingobium japonicum UT26S] Length = 360 Score = 50.3 bits (121), Expect = 1e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +PPEN L E + + G+ ++E P G Sbjct: 164 IACGIDIAFPPENAELQERLAEQ-GLLVTEHPPG 196 >gi|302525184|ref|ZP_07277526.1| DNA processing chain A [Streptomyces sp. AA4] gi|302434079|gb|EFL05895.1| DNA processing chain A [Streptomyces sp. AA4] Length = 390 Score = 50.3 bits (121), Expect = 1e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + +D YP N LL+ I GG +SE Sbjct: 191 LGCAVDYSYPVGNSGLLDRIVAEGGAIVSEYAP 223 >gi|114327469|ref|YP_744626.1| DNA processing protein [Granulibacter bethesdensis CGDNIH1] gi|114315643|gb|ABI61703.1| DNA processing protein [Granulibacter bethesdensis CGDNIH1] Length = 378 Score = 50.3 bits (121), Expect = 1e-04, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGLDC YP EN L + + G ISE+P G Sbjct: 164 AGGLDCPYPRENIRL-QSVIAKRGAVISELPLG 195 >gi|116747661|ref|YP_844348.1| DNA protecting protein DprA [Syntrophobacter fumaroxidans MPOB] gi|116696725|gb|ABK15913.1| DNA protecting protein DprA [Syntrophobacter fumaroxidans MPOB] Length = 386 Score = 50.3 bits (121), Expect = 1e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP L +EI + G ++E P G Sbjct: 182 LGCGLDIDYPYGQGGLRDEIAAS-GALVTEFPLG 214 >gi|300813844|ref|ZP_07094149.1| DNA protecting protein DprA [Peptoniphilus sp. oral taxon 836 str. F0141] gi|300512031|gb|EFK39226.1| DNA protecting protein DprA [Peptoniphilus sp. oral taxon 836 str. F0141] Length = 360 Score = 50.3 bits (121), Expect = 1e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N NL + D +SE PFG Sbjct: 173 LGNGIDIIYPKANTNLYMNLLDKA-TIVSEYPFG 205 >gi|282883340|ref|ZP_06291934.1| DNA protecting protein DprA [Peptoniphilus lacrimalis 315-B] gi|281296844|gb|EFA89346.1| DNA protecting protein DprA [Peptoniphilus lacrimalis 315-B] Length = 360 Score = 50.3 bits (121), Expect = 1e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N NL + D +SE PFG Sbjct: 173 LGNGIDIIYPKANTNLYMNLLDKA-TIVSEYPFG 205 >gi|259503395|ref|ZP_05746297.1| DNA protecting protein DprA [Lactobacillus antri DSM 16041] gi|259168640|gb|EEW53135.1| DNA protecting protein DprA [Lactobacillus antri DSM 16041] Length = 285 Score = 50.3 bits (121), Expect = 1e-04, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GLD YPPENR L E + D G+ +SE Sbjct: 169 GCGLDRAYPPENRQLQEAVADR-GLVLSEY 197 >gi|311747458|ref|ZP_07721243.1| putative DNA processing protein DprA [Algoriphagus sp. PR1] gi|311302664|gb|EAZ79188.2| putative DNA processing protein DprA [Algoriphagus sp. PR1] Length = 373 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M + +YP +R E + N G ISE P G Sbjct: 178 MGSPIGQIYPSVHRKTAESMLLNKGGLISEYPPG 211 >gi|171913964|ref|ZP_02929434.1| putative protein required for chromosomal DNA transformation [Verrucomicrobium spinosum DSM 4136] Length = 367 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G LYPPEN+ L E+I +N G ISE P Sbjct: 172 IGSGHGKLYPPENKALAEKIAEN-GAVISEFP 202 >gi|327403562|ref|YP_004344400.1| DNA protecting protein DprA [Fluviicola taffensis DSM 16823] gi|327319070|gb|AEA43562.1| DNA protecting protein DprA [Fluviicola taffensis DSM 16823] Length = 367 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP E+R + E + +NGG ISE Sbjct: 174 LGHGLAKMYPSEHRKIAERMLENGG-LISEF 203 >gi|289209435|ref|YP_003461501.1| DNA protecting protein DprA [Thioalkalivibrio sp. K90mix] gi|288945066|gb|ADC72765.1| DNA protecting protein DprA [Thioalkalivibrio sp. K90mix] Length = 377 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G D +YP ++R L I D+ G+ +S P G Sbjct: 177 ATGPDRIYPAQHRRLAHRIADH-GLVVSLWPTG 208 >gi|56697910|ref|YP_168281.1| DNA processing protein DprA, putative [Ruegeria pomeroyi DSS-3] gi|56679647|gb|AAV96313.1| DNA processing protein DprA, putative [Ruegeria pomeroyi DSS-3] Length = 382 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MAGG+D +YP EN +L +I G+ +SE P Sbjct: 180 MAGGVDTVYPAENTHLAADI-AQHGLRLSEQPM 211 >gi|332884289|gb|EGK04557.1| hypothetical protein HMPREF9456_00884 [Dysgonomonas mossii DSM 22836] Length = 373 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP ++ + E+ GG+ SE Sbjct: 178 LAHGLDRIYPHVHKQIAREMVAKGGLL-SEF 207 >gi|332704254|ref|ZP_08424342.1| DNA protecting protein DprA [Desulfovibrio africanus str. Walvis Bay] gi|332554403|gb|EGJ51447.1| DNA protecting protein DprA [Desulfovibrio africanus str. Walvis Bay] Length = 427 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP N ++ EE G+ ++E P Sbjct: 192 LGTGLDRIYPEANADIWEE-LRTRGLIVTEFPP 223 >gi|183600718|ref|ZP_02962211.1| hypothetical protein PROSTU_04314 [Providencia stuartii ATCC 25827] gi|188019698|gb|EDU57738.1| hypothetical protein PROSTU_04314 [Providencia stuartii ATCC 25827] Length = 359 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP ++ L E+I G+ ISE Sbjct: 167 LGSGLANIYPRQHTALAEQI-KQEGVLISEF 196 >gi|227529209|ref|ZP_03959258.1| DNA protecting protein DprA [Lactobacillus vaginalis ATCC 49540] gi|227350884|gb|EEJ41175.1| DNA protecting protein DprA [Lactobacillus vaginalis ATCC 49540] Length = 288 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP ++ L + + G+ ISE G Sbjct: 169 IGSGIDQVYPRNHQYLQRAVAEQ-GLVISEYGLG 201 >gi|325963549|ref|YP_004241455.1| DNA protecting protein DprA [Arthrobacter phenanthrenivorans Sphe3] gi|323469636|gb|ADX73321.1| DNA protecting protein DprA [Arthrobacter phenanthrenivorans Sphe3] Length = 343 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MA G+D YP +R LLE + D G+ +SE+P G Sbjct: 185 MANGVDRPYPMGHRELLERVAD-LGLMVSEVPPG 217 >gi|119717470|ref|YP_924435.1| DNA protecting protein DprA [Nocardioides sp. JS614] gi|119538131|gb|ABL82748.1| DNA protecting protein DprA [Nocardioides sp. JS614] Length = 378 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D YP +R L+E I + G +SE G Sbjct: 180 LACGADRCYPAAHRELIEYIAGH-GAVVSEALPG 212 >gi|237724431|ref|ZP_04554912.1| smf protein DNA processing chain A [Bacteroides sp. D4] gi|229437300|gb|EEO47377.1| smf protein DNA processing chain A [Bacteroides dorei 5_1_36/D4] Length = 371 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP E+R + + GG+ +E G Sbjct: 176 LAHGLDRIYPAEHRKTAISMLEQGGLL-TEFTSG 208 >gi|197333945|ref|YP_002157324.1| protein smf (DNA-processing chain A) [Vibrio fischeri MJ11] gi|197315435|gb|ACH64882.1| protein smf (DNA-processing chain A) [Vibrio fischeri MJ11] Length = 345 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP ++R+L + + +N G +SE Sbjct: 150 LGSGLEKIYPAKHRSLAQRVSEN-GALVSEF 179 >gi|282600504|ref|ZP_05974544.2| DNA protecting protein DprA [Providencia rustigianii DSM 4541] gi|282564967|gb|EFB70502.1| DNA protecting protein DprA [Providencia rustigianii DSM 4541] Length = 373 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP ++ NL +EI +N G+ +SE Sbjct: 181 LGSGLANVYPKQHYNLADEIKEN-GLLVSEY 210 >gi|302386227|ref|YP_003822049.1| DNA protecting protein DprA [Clostridium saccharolyticum WM1] gi|302196855|gb|ADL04426.1| DNA protecting protein DprA [Clostridium saccharolyticum WM1] Length = 366 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ YP EN L + + D GG I+E Sbjct: 176 LGCGINLCYPKENFGLYQRMVDQGG-IITEF 205 >gi|254880958|ref|ZP_05253668.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA] gi|319639966|ref|ZP_07994693.1| DNA processing Smf-like protein [Bacteroides sp. 3_1_40A] gi|254833751|gb|EET14060.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA] gi|317388244|gb|EFV69096.1| DNA processing Smf-like protein [Bacteroides sp. 3_1_40A] Length = 371 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP E+R + + GG+ +E G Sbjct: 176 LAHGLDRIYPAEHRKTAVSMLEQGGLL-TEFTSG 208 >gi|167621970|ref|YP_001672264.1| DNA protecting protein DprA [Shewanella halifaxensis HAW-EB4] gi|167351992|gb|ABZ74605.1| DNA protecting protein DprA [Shewanella halifaxensis HAW-EB4] Length = 339 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G D +YP +R++ +I G +SE Sbjct: 143 LGTGADVIYPKRHRSIYHDI-QKDGCILSEF 172 >gi|150003815|ref|YP_001298559.1| putative DNA processing Smf-like protein [Bacteroides vulgatus ATCC 8482] gi|149932239|gb|ABR38937.1| putative DNA processing Smf-like protein [Bacteroides vulgatus ATCC 8482] Length = 371 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP E+R + + GG+ +E G Sbjct: 176 LAHGLDRIYPAEHRKTAVSMLEQGGLL-TEFTSG 208 >gi|38234090|ref|NP_939857.1| hypothetical protein DIP1511 [Corynebacterium diphtheriae NCTC 13129] gi|38200352|emb|CAE50038.1| Conserved hypothetical protein [Corynebacterium diphtheriae] Length = 383 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP +N LL I + G +SE G Sbjct: 189 ARGLDAPYPRKNAELLRSIVET-GCLVSEYAPG 220 >gi|294777365|ref|ZP_06742816.1| DNA protecting protein DprA [Bacteroides vulgatus PC510] gi|294448433|gb|EFG16982.1| DNA protecting protein DprA [Bacteroides vulgatus PC510] Length = 371 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP E+R + + GG+ +E G Sbjct: 176 LAHGLDRIYPAEHRKTAVSMLEQGGLL-TEFTSG 208 >gi|319441370|ref|ZP_07990526.1| putative DNA processing protein [Corynebacterium variabile DSM 44702] Length = 424 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G +YP N +L I G+ ++E P Sbjct: 225 ASGPGEIYPRSNEDLFRRI-AQTGLVVTEYPP 255 >gi|149190433|ref|ZP_01868704.1| Smf protein [Vibrio shilonii AK1] gi|148835687|gb|EDL52653.1| Smf protein [Vibrio shilonii AK1] Length = 366 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL +YP +++L I ++ G +SE Sbjct: 171 LGSGLSQIYPARHKSLASRIAEH-GALVSE 199 >gi|87307031|ref|ZP_01089177.1| DNA processing chain A [Blastopirellula marina DSM 3645] gi|87290404|gb|EAQ82292.1| DNA processing chain A [Blastopirellula marina DSM 3645] Length = 407 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A GL +YPPE+ L +E+ + G +SE P Sbjct: 211 LASGLRSIYPPEHETLADEVAEQ-GALLSESPP 242 >gi|282900736|ref|ZP_06308678.1| SMF protein [Cylindrospermopsis raciborskii CS-505] gi|281194536|gb|EFA69491.1| SMF protein [Cylindrospermopsis raciborskii CS-505] Length = 375 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 G+D +YP N++L +EI + GI ISE P Sbjct: 181 GTGVDVIYPYSNKDLYKEILKS-GIVISEHP 210 >gi|254820364|ref|ZP_05225365.1| smf family protein [Mycobacterium intracellulare ATCC 13950] Length = 267 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP + LL I G+ +E G Sbjct: 62 LAGGLDVPYPAGHTALLHRI-GQHGLLFTEYAPG 94 >gi|120602206|ref|YP_966606.1| DNA protecting protein DprA [Desulfovibrio vulgaris DP4] gi|120562435|gb|ABM28179.1| DNA protecting protein DprA [Desulfovibrio vulgaris DP4] Length = 668 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP +N +L E + + G+ ++E G Sbjct: 202 LGTGIDIRYPYDNEDLFERM-ASEGLLVTEFAPG 234 >gi|254776194|ref|ZP_05217710.1| smf family protein [Mycobacterium avium subsp. avium ATCC 25291] Length = 275 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP + LL I G+ +E G Sbjct: 186 LAGGLDVAYPSGHSALLHRI-GQHGLLFTEYAPG 218 >gi|330994161|ref|ZP_08318089.1| Protein smf [Gluconacetobacter sp. SXCC-1] gi|329758628|gb|EGG75144.1| Protein smf [Gluconacetobacter sp. SXCC-1] Length = 390 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLDC YPPE+ +L I G ++E P G Sbjct: 168 IAGGLDCPYPPEHADLQARIAGT-GAVVTEAPLG 200 >gi|212692602|ref|ZP_03300730.1| hypothetical protein BACDOR_02099 [Bacteroides dorei DSM 17855] gi|237709086|ref|ZP_04539567.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA] gi|265752610|ref|ZP_06088179.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA] gi|212664887|gb|EEB25459.1| hypothetical protein BACDOR_02099 [Bacteroides dorei DSM 17855] gi|229456782|gb|EEO62503.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA] gi|263235796|gb|EEZ21291.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA] Length = 371 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP E+R + + GG+ +E G Sbjct: 176 LAHGLDRIYPAEHRKTAVSMLEQGGLL-TEFTSG 208 >gi|323359718|ref|YP_004226114.1| Rossmann fold nucleotide-binding protein [Microbacterium testaceum StLB037] gi|323276089|dbj|BAJ76234.1| predicted Rossmann fold nucleotide-binding protein [Microbacterium testaceum StLB037] Length = 387 Score = 50.0 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + LL+ I D G SE P G Sbjct: 194 LAGGVDRAYPRGHEGLLDRIADT-GAVWSETPCG 226 >gi|159901058|ref|YP_001547305.1| DNA protecting protein DprA [Herpetosiphon aurantiacus ATCC 23779] gi|159894097|gb|ABX07177.1| DNA protecting protein DprA [Herpetosiphon aurantiacus ATCC 23779] Length = 369 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ++R L + G +SE Sbjct: 171 LGSGLQQIYPSQHRQLAAD-VSQQGALLSEYAP 202 >gi|170783575|ref|YP_001740092.1| putative smf family protein [Arthrobacter sp. Chr15] gi|150035083|gb|ABR67079.1| putative smf family protein [Arthrobacter sp. Chr15] Length = 302 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP N +L I N G+ +SE+P G Sbjct: 184 LAGGLDRDYPSGNADLAAAIRGN-GLTLSELPPG 216 >gi|326791406|ref|YP_004309227.1| DNA protecting protein DprA [Clostridium lentocellum DSM 5427] gi|326542170|gb|ADZ84029.1| DNA protecting protein DprA [Clostridium lentocellum DSM 5427] Length = 362 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP N+ + EEI + G ISE Sbjct: 169 LGNGLNICYPACNQRIYEEIL-SKGCIISEY 198 >gi|261368262|ref|ZP_05981145.1| DNA protecting protein DprA [Subdoligranulum variabile DSM 15176] gi|282569777|gb|EFB75312.1| DNA protecting protein DprA [Subdoligranulum variabile DSM 15176] Length = 366 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + +D YP N L +I + GG SE P Sbjct: 173 LGTAIDKTYPAANGPLRRQIEEGGGAVCSEYPP 205 >gi|284045125|ref|YP_003395465.1| DNA protecting protein DprA [Conexibacter woesei DSM 14684] gi|283949346|gb|ADB52090.1| DNA protecting protein DprA [Conexibacter woesei DSM 14684] Length = 366 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG + YP R L E I + G+ +SE+P G Sbjct: 178 LAGGAERAYPASKRRLHERIAAS-GVVVSEMPPG 210 >gi|255993974|ref|ZP_05427109.1| DNA protecting protein DprA [Eubacterium saphenum ATCC 49989] gi|255993642|gb|EEU03731.1| DNA protecting protein DprA [Eubacterium saphenum ATCC 49989] Length = 286 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 M G+D YP N+ L I + G+ ISE Sbjct: 100 MGTGIDGCYPARNKALKRRI-EQDGLVISE 128 >gi|320449720|ref|YP_004201816.1| competence protein DprA [Thermus scotoductus SA-01] gi|320149889|gb|ADW21267.1| competence protein DprA [Thermus scotoductus SA-01] Length = 333 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 5/34 (14%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + LD +YPPE+R L ++ +SE PFG Sbjct: 154 LGSALDRIYPPEHRELARKV-----ALVSEFPFG 182 >gi|50955103|ref|YP_062391.1| DNA processing factor [Leifsonia xyli subsp. xyli str. CTCB07] gi|50951585|gb|AAT89286.1| DNA processing factor [Leifsonia xyli subsp. xyli str. CTCB07] Length = 411 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG D LYP N LL I + G+ ++E+P G Sbjct: 225 LAGGADRLYPAANTELLTRILAS-GLILAELPPG 257 >gi|294785795|ref|ZP_06751083.1| DNA processing chain A [Fusobacterium sp. 3_1_27] gi|294487509|gb|EFG34871.1| DNA processing chain A [Fusobacterium sp. 3_1_27] Length = 304 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN L E I +N G +SE+ Sbjct: 183 LGQGLDLEIYPRENIKLAEMILENNGFLLSEL 214 >gi|260494759|ref|ZP_05814889.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_33] gi|260197921|gb|EEW95438.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_33] Length = 304 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN L E I +N G +SE+ Sbjct: 183 LGQGLDLEIYPRENIKLAEMILENNGFLLSEL 214 >gi|237744977|ref|ZP_04575458.1| DNA processing chain A [Fusobacterium sp. 7_1] gi|229432206|gb|EEO42418.1| DNA processing chain A [Fusobacterium sp. 7_1] Length = 314 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN L E I +N G +SE+ Sbjct: 193 LGQGLDLEIYPRENIKLAEMILENNGFLLSEL 224 >gi|237741597|ref|ZP_04572078.1| DNA processing chain A [Fusobacterium sp. 4_1_13] gi|229429245|gb|EEO39457.1| DNA processing chain A [Fusobacterium sp. 4_1_13] Length = 314 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN L E I +N G +SE+ Sbjct: 193 LGQGLDLEIYPRENIKLAEMILENNGFLLSEL 224 >gi|34762624|ref|ZP_00143617.1| DNA processing chain A [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gi|27887704|gb|EAA24780.1| DNA processing chain A [Fusobacterium nucleatum subsp. vincentii ATCC 49256] Length = 304 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN L E I +N G +SE+ Sbjct: 183 LGQGLDLEIYPRENIKLAEMILENNGFLLSEL 214 >gi|300173383|ref|YP_003772549.1| DNA processing protein [Leuconostoc gasicomitatum LMG 18811] gi|299887762|emb|CBL91730.1| DNA processing protein [Leuconostoc gasicomitatum LMG 18811] Length = 288 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP N +L ++I G+ +SE G Sbjct: 167 IGTGTDVAYPRRNTSLQKQI-AQQGLVVSEYGPG 199 >gi|167645473|ref|YP_001683136.1| DNA protecting protein DprA [Caulobacter sp. K31] gi|167347903|gb|ABZ70638.1| DNA protecting protein DprA [Caulobacter sp. K31] Length = 366 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG+ +YPPE+ L I GG +SE Sbjct: 170 LGGGVCDIYPPEHAALHARIAGEGGCIVSESAP 202 >gi|288553075|ref|YP_003425010.1| DNA protecting protein DprA [Bacillus pseudofirmus OF4] gi|288544235|gb|ADC48118.1| DNA protecting protein DprA [Bacillus pseudofirmus OF4] Length = 290 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G YP EN+NL + + + ISE P Sbjct: 174 LGSGFHHFYPKENKNLFTYMAAHQ-LVISEYPP 205 >gi|52785590|ref|YP_091419.1| hypothetical protein BLi01831 [Bacillus licheniformis ATCC 14580] gi|163119434|ref|YP_079004.2| DNA processing Smf protein [Bacillus licheniformis ATCC 14580] gi|319646008|ref|ZP_08000238.1| smf protein [Bacillus sp. BT1B_CT2] gi|52348092|gb|AAU40726.1| Smf [Bacillus licheniformis ATCC 14580] gi|145902941|gb|AAU23366.2| DNA processing Smf protein homolog [Bacillus licheniformis ATCC 14580] gi|317391758|gb|EFV72555.1| smf protein [Bacillus sp. BT1B_CT2] Length = 300 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG + +YP E+R L ++ ++ + +SE P Sbjct: 174 IAGGFNSIYPREHRQLAGQMAESH-LLVSEHPP 205 >gi|119714094|ref|YP_919236.1| SMF family protein [Nocardioides sp. JS614] gi|119526003|gb|ABL79373.1| SMF family protein [Nocardioides sp. JS614] Length = 252 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP + LL+ I G+ +SE P G Sbjct: 187 LPCGADRAYPAAHAQLLDTI-AQRGLVVSEGPPG 219 >gi|311744113|ref|ZP_07717919.1| DNA protecting protein DprA [Aeromicrobium marinum DSM 15272] gi|311313243|gb|EFQ83154.1| DNA protecting protein DprA [Aeromicrobium marinum DSM 15272] Length = 289 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG D YP + LL I + G+ +SE P Sbjct: 164 LAGGADVDYPRAHAVLLGRIAET-GLVVSEQPP 195 >gi|304404235|ref|ZP_07385897.1| DNA protecting protein DprA [Paenibacillus curdlanolyticus YK9] gi|304347213|gb|EFM13045.1| DNA protecting protein DprA [Paenibacillus curdlanolyticus YK9] Length = 370 Score = 49.6 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + ++ +YPP++ +L I G+ ++E P G Sbjct: 175 LGTPIERIYPPQHASLFRRIAKQ-GLLLTEAPIG 207 >gi|328948449|ref|YP_004365786.1| SMF family protein [Treponema succinifaciens DSM 2489] gi|328448773|gb|AEB14489.1| SMF family protein [Treponema succinifaciens DSM 2489] Length = 318 Score = 49.6 bits (119), Expect = 2e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D + P NR+L ++I NGG SE G Sbjct: 171 LPCGIDTVVPYGNRSLAQQIVKNGGFIASEYVPG 204 >gi|307728141|ref|YP_003905365.1| DNA protecting protein DprA [Burkholderia sp. CCGE1003] gi|307582676|gb|ADN56074.1| DNA protecting protein DprA [Burkholderia sp. CCGE1003] Length = 433 Score = 49.6 bits (119), Expect = 2e-04, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + L +I G+ +SE P G Sbjct: 180 IGTGADLVYPSAHHALARQIAVQ-GVILSEWPLG 212 >gi|269103774|ref|ZP_06156471.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Photobacterium damselae subsp. damselae CIP 102761] gi|268163672|gb|EEZ42168.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Photobacterium damselae subsp. damselae CIP 102761] Length = 364 Score = 49.6 bits (119), Expect = 2e-04, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP +++L I + G +SE Sbjct: 169 LGSGLEQIYPACHKSLAASIVEQ-GALVSEF 198 >gi|225027213|ref|ZP_03716405.1| hypothetical protein EUBHAL_01469 [Eubacterium hallii DSM 3353] gi|224955442|gb|EEG36651.1| hypothetical protein EUBHAL_01469 [Eubacterium hallii DSM 3353] Length = 373 Score = 49.6 bits (119), Expect = 2e-04, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG+D +YP EN NL ++++ GG +SE G Sbjct: 171 LGGGIDTIYPVENFNLYQQVYQMGG-VLSEYNMG 203 >gi|291327311|ref|ZP_06127796.2| DNA protecting protein DprA [Providencia rettgeri DSM 1131] gi|291310852|gb|EFE51305.1| DNA protecting protein DprA [Providencia rettgeri DSM 1131] Length = 361 Score = 49.6 bits (119), Expect = 2e-04, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP ++ L E+I N G ISE Sbjct: 170 LGSGLANIYPRQHTELAEKI-KNYGALISEY 199 >gi|167756892|ref|ZP_02429019.1| hypothetical protein CLORAM_02441 [Clostridium ramosum DSM 1402] gi|167703067|gb|EDS17646.1| hypothetical protein CLORAM_02441 [Clostridium ramosum DSM 1402] Length = 250 Score = 49.6 bits (119), Expect = 2e-04, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D YP N+ L ++ + + ISE P Sbjct: 138 LGSGIDYCYPHRNQQLY-QVLKDHHLVISEYP 168 >gi|33867059|ref|NP_898617.1| putative DNA uptake protein [Rhodococcus erythropolis] gi|33668893|gb|AAP73887.1| putative DNA uptake protein [Rhodococcus erythropolis] Length = 307 Score = 49.6 bits (119), Expect = 2e-04, Method: Composition-based stats. Identities = 8/29 (27%), Positives = 17/29 (58%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +D +P + + +I ++GG+ +SE P Sbjct: 192 IDRAHPATHERMFRDISEHGGLVVSEYPP 220 >gi|269127621|ref|YP_003300991.1| DNA protecting protein DprA [Thermomonospora curvata DSM 43183] gi|268312579|gb|ACY98953.1| DNA protecting protein DprA [Thermomonospora curvata DSM 43183] Length = 387 Score = 49.6 bits (119), Expect = 2e-04, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP N L E+ + G+ +SE P G Sbjct: 184 ANGLDRFYPAGNEALFVEML-HKGLLVSESPPG 215 >gi|255655285|ref|ZP_05400694.1| putative competence protein [Clostridium difficile QCD-23m63] gi|296451269|ref|ZP_06893009.1| SMF family DNA processing protein [Clostridium difficile NAP08] gi|296880379|ref|ZP_06904342.1| SMF family DNA processing protein [Clostridium difficile NAP07] gi|296259875|gb|EFH06730.1| SMF family DNA processing protein [Clostridium difficile NAP08] gi|296428620|gb|EFH14504.1| SMF family DNA processing protein [Clostridium difficile NAP07] Length = 366 Score = 49.6 bits (119), Expect = 2e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D P +N +L +I +NGG+ +SE Sbjct: 173 LGSGVDNPLPKQNLHLSNKILENGGLLLSEY 203 >gi|315104185|gb|EFT76161.1| DNA protecting protein DprA [Propionibacterium acnes HL050PA2] Length = 377 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPTG 210 >gi|300721399|ref|YP_003710670.1| protein smf [Xenorhabdus nematophila ATCC 19061] gi|297627887|emb|CBJ88433.1| Protein smf [Xenorhabdus nematophila ATCC 19061] Length = 362 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP ++ L + I +N G +SE Sbjct: 167 LGSGLENIYPTRHQPLAQRIKEN-GTLVSEFFP 198 >gi|314923937|gb|EFS87768.1| DNA protecting protein DprA [Propionibacterium acnes HL001PA1] gi|314966118|gb|EFT10217.1| DNA protecting protein DprA [Propionibacterium acnes HL082PA2] gi|315094913|gb|EFT66889.1| DNA protecting protein DprA [Propionibacterium acnes HL060PA1] gi|327328005|gb|EGE69774.1| DNA processing / uptake protein [Propionibacterium acnes HL103PA1] Length = 377 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQIAGT-GALVSELPTG 210 >gi|300871631|ref|YP_003786504.1| DNA protecting protein DprA [Brachyspira pilosicoli 95/1000] gi|300689332|gb|ADK32003.1| DNA protecting protein, DprA [Brachyspira pilosicoli 95/1000] Length = 401 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN + ++ + G+ ISE G Sbjct: 164 LGCGIDNVYPSENLKVYNKLIE-KGLIISEFEVG 196 >gi|212632968|ref|YP_002309493.1| DNA processing protein DprA [Shewanella piezotolerans WP3] gi|212554452|gb|ACJ26906.1| DNA processing protein DprA, putative [Shewanella piezotolerans WP3] Length = 366 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP +R++ +I + G +SE Sbjct: 170 LGTGVEVIYPKRHRSIYHDI-QHEGCVLSEF 199 >gi|126698870|ref|YP_001087767.1| putative competence protein [Clostridium difficile 630] gi|115250307|emb|CAJ68129.1| putative DNA processing Smf single strand binding protein [Clostridium difficile] Length = 369 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D P +N +L +I +NGG+ +SE Sbjct: 176 LGSGVDNPLPKQNLHLSNKILENGGLLLSEY 206 >gi|325109981|ref|YP_004271049.1| DNA protecting protein DprA [Planctomyces brasiliensis DSM 5305] gi|324970249|gb|ADY61027.1| DNA protecting protein DprA [Planctomyces brasiliensis DSM 5305] Length = 389 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A GL +YPPE+ NL EEI G +SE P Sbjct: 178 ASGLRTVYPPEHANLAEEIAAQ-GALLSESPL 208 >gi|255100291|ref|ZP_05329268.1| putative competence protein [Clostridium difficile QCD-63q42] gi|255306230|ref|ZP_05350402.1| putative competence protein [Clostridium difficile ATCC 43255] Length = 366 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D P +N +L +I +NGG+ +SE Sbjct: 173 LGSGVDNPLPKQNLHLSNKILENGGLLLSEY 203 >gi|171743302|ref|ZP_02919109.1| hypothetical protein BIFDEN_02431 [Bifidobacterium dentium ATCC 27678] gi|306823247|ref|ZP_07456623.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679] gi|309801593|ref|ZP_07695714.1| DNA protecting protein DprA [Bifidobacterium dentium JCVIHMP022] gi|171278916|gb|EDT46577.1| hypothetical protein BIFDEN_02431 [Bifidobacterium dentium ATCC 27678] gi|304553879|gb|EFM41790.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679] gi|308221725|gb|EFO78016.1| DNA protecting protein DprA [Bifidobacterium dentium JCVIHMP022] Length = 449 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 17/32 (53%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL+ + P N L E I D G +SE+ Sbjct: 231 AGGLNHIGPKSNARLFERIVDGKGALVSELCP 262 >gi|227510329|ref|ZP_03940378.1| DNA protecting protein DprA [Lactobacillus brevis subsp. gravesensis ATCC 27305] gi|227189981|gb|EEI70048.1| DNA protecting protein DprA [Lactobacillus brevis subsp. gravesensis ATCC 27305] Length = 292 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GL+ YP N+ L ++I + + +SE P G Sbjct: 175 IGTGLNIAYPSMNQQLQQQIAEEQ-LLLSEYPNG 207 >gi|254974818|ref|ZP_05271290.1| putative competence protein [Clostridium difficile QCD-66c26] gi|255092206|ref|ZP_05321684.1| putative competence protein [Clostridium difficile CIP 107932] gi|255313945|ref|ZP_05355528.1| putative competence protein [Clostridium difficile QCD-76w55] gi|255516625|ref|ZP_05384301.1| putative competence protein [Clostridium difficile QCD-97b34] gi|255649725|ref|ZP_05396627.1| putative competence protein [Clostridium difficile QCD-37x79] gi|260682880|ref|YP_003214165.1| putative competence protein [Clostridium difficile CD196] gi|260686478|ref|YP_003217611.1| putative competence protein [Clostridium difficile R20291] gi|306519835|ref|ZP_07406182.1| putative competence protein [Clostridium difficile QCD-32g58] gi|260209043|emb|CBA62158.1| putative competence protein [Clostridium difficile CD196] gi|260212494|emb|CBE03417.1| putative competence protein [Clostridium difficile R20291] Length = 366 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D P +N +L +I +NGG+ +SE Sbjct: 173 LGSGVDNPLPKQNLHLSNKILENGGLLLSEY 203 >gi|219683464|ref|YP_002469847.1| DNA protecting protein DprA [Bifidobacterium animalis subsp. lactis AD011] gi|219621114|gb|ACL29271.1| DNA protecting protein DprA [Bifidobacterium animalis subsp. lactis AD011] Length = 361 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 15/29 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 AGGLD P N L E+I G +SE Sbjct: 235 AGGLDHCGPTTNMRLFEQICAQHGALVSE 263 >gi|183601407|ref|ZP_02962777.1| hypothetical protein BIFLAC_02087 [Bifidobacterium animalis subsp. lactis HN019] gi|241191093|ref|YP_002968487.1| hypothetical protein Balac_1067 [Bifidobacterium animalis subsp. lactis Bl-04] gi|241196499|ref|YP_002970054.1| hypothetical protein Balat_1067 [Bifidobacterium animalis subsp. lactis DSM 10140] gi|183219013|gb|EDT89654.1| hypothetical protein BIFLAC_02087 [Bifidobacterium animalis subsp. lactis HN019] gi|240249485|gb|ACS46425.1| hypothetical protein Balac_1067 [Bifidobacterium animalis subsp. lactis Bl-04] gi|240251053|gb|ACS47992.1| hypothetical protein Balat_1067 [Bifidobacterium animalis subsp. lactis DSM 10140] gi|289178837|gb|ADC86083.1| Smf protein [Bifidobacterium animalis subsp. lactis BB-12] gi|295794082|gb|ADG33617.1| hypothetical protein BalV_1029 [Bifidobacterium animalis subsp. lactis V9] Length = 381 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 15/29 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 AGGLD P N L E+I G +SE Sbjct: 255 AGGLDHCGPTTNMRLFEQICAQHGALVSE 283 >gi|256028443|ref|ZP_05442277.1| DNA processing chain A [Fusobacterium sp. D11] gi|289766366|ref|ZP_06525744.1| DNA processing chain A [Fusobacterium sp. D11] gi|289717921|gb|EFD81933.1| DNA processing chain A [Fusobacterium sp. D11] Length = 233 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN L E I +N G +SE+ Sbjct: 112 LGQGLDLEIYPRENIKLAEMILENNGFLLSEL 143 >gi|189502567|ref|YP_001958284.1| hypothetical protein Aasi_1230 [Candidatus Amoebophilus asiaticus 5a2] gi|189498008|gb|ACE06555.1| hypothetical protein Aasi_1230 [Candidatus Amoebophilus asiaticus 5a2] Length = 374 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD +YP ++ + ++ +GG +SEIP G Sbjct: 176 LAGGLDKIYPTAHKKVALDMLADGG-LVSEIPIG 208 >gi|254304216|ref|ZP_04971574.1| possible SMF family Rossmann fold nucleotide-binding protein [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] gi|148324408|gb|EDK89658.1| possible SMF family Rossmann fold nucleotide-binding protein [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] Length = 304 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN L E I +N G +SE+ Sbjct: 183 LGQGLDLEIYPRENVKLAEMILENNGFLLSEL 214 >gi|227354902|ref|ZP_03839316.1| SMF family Rossmann fold nucleotide-binding protein [Proteus mirabilis ATCC 29906] gi|227164984|gb|EEI49823.1| SMF family Rossmann fold nucleotide-binding protein [Proteus mirabilis ATCC 29906] Length = 385 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE-IPF 33 + GL+ +YP +R L E+I ++ G+ +SE +P Sbjct: 167 LGSGLEQIYPSFHRRLAEQIKES-GVLVSEHLPM 199 >gi|227513337|ref|ZP_03943386.1| DNA protecting protein DprA [Lactobacillus buchneri ATCC 11577] gi|227524480|ref|ZP_03954529.1| DNA protecting protein DprA [Lactobacillus hilgardii ATCC 8290] gi|227083210|gb|EEI18522.1| DNA protecting protein DprA [Lactobacillus buchneri ATCC 11577] gi|227088350|gb|EEI23662.1| DNA protecting protein DprA [Lactobacillus hilgardii ATCC 8290] Length = 292 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GL+ YP N+ L ++I + + +SE P G Sbjct: 175 IGTGLNIAYPSMNQQLQQQIAEEQ-LLLSEYPNG 207 >gi|254483307|ref|ZP_05096538.1| DNA protecting protein DprA [marine gamma proteobacterium HTCC2148] gi|214036402|gb|EEB77078.1| DNA protecting protein DprA [marine gamma proteobacterium HTCC2148] Length = 301 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MA G++ +YP + L +EI + G ++E P G Sbjct: 108 MATGIETIYPHRHEPLGQEI-ASSGCLVTEFPPG 140 >gi|197287102|ref|YP_002152974.1| hypothetical protein PMI3289 [Proteus mirabilis HI4320] gi|194684589|emb|CAR46448.1| conserved hypothetical protein [Proteus mirabilis HI4320] Length = 386 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE-IPF 33 + GL+ +YP +R L E+I ++ G+ +SE +P Sbjct: 167 LGSGLEQIYPSFHRRLAEQIKES-GVLVSEHLPM 199 >gi|238853071|ref|ZP_04643463.1| DNA protecting protein DprA [Lactobacillus gasseri 202-4] gi|238834319|gb|EEQ26564.1| DNA protecting protein DprA [Lactobacillus gasseri 202-4] Length = 281 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GL+ YP EN+ L EEI G+ ISE Sbjct: 168 GNGLNHFYPQENKELQEEIVA-KGLLISEY 196 >gi|295093364|emb|CBK82455.1| DNA protecting protein DprA [Coprococcus sp. ART55/1] Length = 359 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + G++ YP EN ++ +I + GG+ +SE Sbjct: 172 LGSGINVPYPRENYDIYHDIRNGGGVVLSE 201 >gi|332295816|ref|YP_004437739.1| DNA protecting protein DprA [Thermodesulfobium narugense DSM 14796] gi|332178919|gb|AEE14608.1| DNA protecting protein DprA [Thermodesulfobium narugense DSM 14796] Length = 346 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP ENR L EI + G+ +SE Sbjct: 157 LGNGLDIFYPIENRELQIEISET-GLLVSEY 186 >gi|333029584|ref|ZP_08457645.1| DNA protecting protein DprA [Bacteroides coprosuis DSM 18011] gi|332740181|gb|EGJ70663.1| DNA protecting protein DprA [Bacteroides coprosuis DSM 18011] Length = 372 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A GLD LYP +R++ ++ GG+ +E P Sbjct: 175 LAHGLDILYPAAHRSVANQMVHQGGLL-TEFPI 206 >gi|283455725|ref|YP_003360289.1| Smf protein [Bifidobacterium dentium Bd1] gi|283102359|gb|ADB09465.1| Smf protein [Bifidobacterium dentium Bd1] Length = 422 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 17/32 (53%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL+ + P N L E I D G +SE+ Sbjct: 204 AGGLNHIGPKSNARLFERIVDGKGALVSELCP 235 >gi|300361597|ref|ZP_07057774.1| DNA protecting protein DprA [Lactobacillus gasseri JV-V03] gi|300354216|gb|EFJ70087.1| DNA protecting protein DprA [Lactobacillus gasseri JV-V03] Length = 281 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GL+ YP EN+ L EEI G+ ISE Sbjct: 168 GNGLNHFYPQENKELQEEIVA-KGLLISEY 196 >gi|195941055|ref|ZP_03086437.1| hypothetical protein EscherichcoliO157_32466 [Escherichia coli O157:H7 str. EC4024] Length = 246 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 16/31 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP + L E++ + G +SE Sbjct: 39 LGNGLFSIYPRRHHILAEQLIASEGAIVSEF 69 >gi|170783523|ref|YP_001742016.1| putative smf family protein [Arthrobacter sp. AK-1] gi|150035010|gb|ABR67021.1| putative smf family protein [Arthrobacter sp. AK-1] Length = 302 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP N +L I G+ +SE+P G Sbjct: 184 LAGGLDRDYPSGNADLAAAIRGT-GLTLSELPPG 216 >gi|293374716|ref|ZP_06621024.1| putative DNA protecting protein DprA [Turicibacter sanguinis PC909] gi|325840611|ref|ZP_08167092.1| putative DNA protecting protein DprA [Turicibacter sp. HGF1] gi|292646630|gb|EFF64632.1| putative DNA protecting protein DprA [Turicibacter sanguinis PC909] gi|325490260|gb|EGC92593.1| putative DNA protecting protein DprA [Turicibacter sp. HGF1] Length = 264 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G +YP EN L ++ G + ISE P Sbjct: 143 LASGFSRIYPSENYQLY-QLMAKGHLVISEFPP 174 >gi|288870966|ref|ZP_06115945.2| DNA processing protein DprA [Clostridium hathewayi DSM 13479] gi|288865235|gb|EFC97533.1| DNA processing protein DprA [Clostridium hathewayi DSM 13479] Length = 367 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+ YP EN L E + GG +SE Sbjct: 177 LGCGIKICYPRENYGLYERMCRQGG-VLSEWMP 208 >gi|257466124|ref|ZP_05630435.1| DNA processing chain A [Fusobacterium gonidiaformans ATCC 25563] gi|315917281|ref|ZP_07913521.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC 25563] gi|313691156|gb|EFS27991.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC 25563] Length = 309 Score = 49.2 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDC-LYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP EN+ L I + GG +SE+P Sbjct: 188 LGQGLAREIYPRENQILASRILNMGGFLLSELPP 221 >gi|116629570|ref|YP_814742.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus gasseri ATCC 33323] gi|282852051|ref|ZP_06261409.1| DNA protecting protein DprA [Lactobacillus gasseri 224-1] gi|311110786|ref|ZP_07712183.1| DNA protecting protein DprA [Lactobacillus gasseri MV-22] gi|116095152|gb|ABJ60304.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus gasseri ATCC 33323] gi|282556811|gb|EFB62415.1| DNA protecting protein DprA [Lactobacillus gasseri 224-1] gi|311065940|gb|EFQ46280.1| DNA protecting protein DprA [Lactobacillus gasseri MV-22] Length = 281 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GL+ YP EN+ L EEI G+ ISE Sbjct: 168 GNGLNHFYPQENKELQEEIVA-KGLLISEY 196 >gi|269215607|ref|ZP_06159461.1| DNA processing protein DprA [Slackia exigua ATCC 700122] gi|269131094|gb|EEZ62169.1| DNA processing protein DprA [Slackia exigua ATCC 700122] Length = 311 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG+ YP +N L + I D GG SE P+ Sbjct: 106 LGGGIARPYPADNVPLFQRIVDGGGALASEHPW 138 >gi|227497528|ref|ZP_03927756.1| DNA protecting protein DprA [Actinomyces urogenitalis DSM 15434] gi|226833009|gb|EEH65392.1| DNA protecting protein DprA [Actinomyces urogenitalis DSM 15434] Length = 437 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYP N LL+E+ ++ G ++E+P G Sbjct: 232 AGGVDRLYPAGNATLLQEVIEH-GALVAEVPPG 263 >gi|254382041|ref|ZP_04997403.1| DNA processing Smf-protein [Streptomyces sp. Mg1] gi|194340948|gb|EDX21914.1| DNA processing Smf-protein [Streptomyces sp. Mg1] Length = 265 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + LL I G+ + E+P G Sbjct: 56 LACGVDVAYPRGHAGLLGRIAGQ-GLVMGELPPG 88 >gi|58039717|ref|YP_191681.1| DNA processing chain A [Gluconobacter oxydans 621H] gi|58002131|gb|AAW61025.1| DNA processing chain A [Gluconobacter oxydans 621H] Length = 394 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD +YPP N +L ++I + G ++E G Sbjct: 177 IAGGLDHVYPPANASLQQQIAER-GCLVTEALLG 209 >gi|118463022|ref|YP_882921.1| smf family protein [Mycobacterium avium 104] gi|118164309|gb|ABK65206.1| smf family protein [Mycobacterium avium 104] Length = 388 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP + LL I G+ +E G Sbjct: 186 LAGGLDVAYPSGHSALLHRI-GQHGLLFTEYAPG 218 >gi|225352788|ref|ZP_03743811.1| hypothetical protein BIFPSEUDO_04420 [Bifidobacterium pseudocatenulatum DSM 20438] gi|225156395|gb|EEG69964.1| hypothetical protein BIFPSEUDO_04420 [Bifidobacterium pseudocatenulatum DSM 20438] Length = 456 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P N L E I ++ G ISE+ G Sbjct: 239 AGGLNYIGPKSNERLFETIINHSGALISELCPG 271 >gi|302671367|ref|YP_003831327.1| DNA protecting protein DprA [Butyrivibrio proteoclasticus B316] gi|302395840|gb|ADL34745.1| DNA protecting protein DprA [Butyrivibrio proteoclasticus B316] Length = 391 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP +N + + + GG ISE P G Sbjct: 180 GSGVDICYPEDNLEIYNNLCEMGG-VISEFPPG 211 >gi|182435660|ref|YP_001823379.1| putative DNA processing Smf-family protein [Streptomyces griseus subsp. griseus NBRC 13350] gi|178464176|dbj|BAG18696.1| putative DNA processing Smf-family protein [Streptomyces griseus subsp. griseus NBRC 13350] Length = 438 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G+D YP + LL G+ ++E+P Sbjct: 233 LACGVDVAYPRGHAELLGR-LAQQGLIVAELPP 264 >gi|157148860|ref|YP_001456179.1| DNA protecting protein DprA [Citrobacter koseri ATCC BAA-895] gi|157086065|gb|ABV15743.1| hypothetical protein CKO_04698 [Citrobacter koseri ATCC BAA-895] Length = 364 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL ++P + L E + D GG +SE P Sbjct: 157 LGNGLGSIHPRRHTRLAEGLIDAGGALVSEFPL 189 >gi|313609079|gb|EFR84791.1| Smf family protein [Listeria monocytogenes FSL F2-208] Length = 308 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP +N L +EI G+ +SE Sbjct: 188 LGSGVNKIYPKKNELLAKEIVKE-GLLLSEY 217 >gi|290894533|ref|ZP_06557483.1| smf family protein [Listeria monocytogenes FSL J2-071] gi|290555914|gb|EFD89478.1| smf family protein [Listeria monocytogenes FSL J2-071] Length = 286 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP +N L +EI G+ +SE Sbjct: 166 LGSGVNKIYPKKNELLAKEIVKE-GLLLSEY 195 >gi|226223877|ref|YP_002757984.1| polypeptide deformylase [Listeria monocytogenes Clip81459] gi|225876339|emb|CAS05048.1| Putative polypeptide deformylase [Listeria monocytogenes serotype 4b str. CLIP 80459] Length = 286 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP +N L +EI G+ +SE Sbjct: 166 LGSGVNKIYPKKNELLAKEIVKE-GLLLSEY 195 >gi|217979954|ref|YP_002364101.1| DNA protecting protein DprA [Methylocella silvestris BL2] gi|217505330|gb|ACK52739.1| DNA protecting protein DprA [Methylocella silvestris BL2] Length = 422 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGL +YP + L+E + + G A+SE+PFG Sbjct: 172 LAGGLGNIYPAAHAELVERLIET-GAAVSEMPFG 204 >gi|217964583|ref|YP_002350261.1| DNA protecting protein DprA [Listeria monocytogenes HCC23] gi|217333853|gb|ACK39647.1| DNA protecting protein DprA [Listeria monocytogenes HCC23] gi|307570853|emb|CAR84032.1| smf family protein [Listeria monocytogenes L99] Length = 286 Score = 48.8 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP +N L +EI G+ +SE Sbjct: 166 LGSGVNKIYPKKNELLAKEIVKE-GLLLSEY 195 >gi|293393277|ref|ZP_06637591.1| DNA protecting protein DprA [Serratia odorifera DSM 4582] gi|291424187|gb|EFE97402.1| DNA protecting protein DprA [Serratia odorifera DSM 4582] Length = 373 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 15/30 (50%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL + P +R L I + GG +SE Sbjct: 167 LGSGLANVSPRCHRRLARRIVEQGGALLSE 196 >gi|302537202|ref|ZP_07289544.1| DNA processing Smf-family protein [Streptomyces sp. C] gi|302446097|gb|EFL17913.1| DNA processing Smf-family protein [Streptomyces sp. C] Length = 393 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +YP + LL I G+ + E+P G Sbjct: 184 LACGVDTVYPRGHAGLLGRIT-RQGLVLGELPPG 216 >gi|37528511|ref|NP_931856.1| hypothetical protein plu4694 [Photorhabdus luminescens subsp. laumondii TTO1] gi|36787949|emb|CAE17066.1| Smf protein [Photorhabdus luminescens subsp. laumondii TTO1] Length = 361 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L ++I + G +SE Sbjct: 167 LGSGLGQIYPHRHGLLAKQI-EENGALVSEFFP 198 >gi|331701420|ref|YP_004398379.1| DNA protecting protein DprA [Lactobacillus buchneri NRRL B-30929] gi|329128763|gb|AEB73316.1| DNA protecting protein DprA [Lactobacillus buchneri NRRL B-30929] Length = 294 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + GLD YP N+ L I + + ISE P Sbjct: 174 IGTGLDVCYPYTNQELQATIAADH-LLISEYP 204 >gi|228476756|ref|ZP_04061422.1| DNA protecting protein DprA [Streptococcus salivarius SK126] gi|228251627|gb|EEK10728.1| DNA protecting protein DprA [Streptococcus salivarius SK126] Length = 279 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN+ L + + N + +SE G Sbjct: 163 IGTGLDVYYPKENKALQDYMAKNH-LVLSEYGPG 195 >gi|254828637|ref|ZP_05233324.1| smf family protein [Listeria monocytogenes FSL N3-165] gi|258601036|gb|EEW14361.1| smf family protein [Listeria monocytogenes FSL N3-165] Length = 286 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP +N L +EI G+ +SE Sbjct: 166 LGSGVNKIYPKKNEFLAKEIAKE-GLLLSEY 195 >gi|41409059|ref|NP_961895.1| hypothetical protein MAP2961c [Mycobacterium avium subsp. paratuberculosis K-10] gi|41397418|gb|AAS05278.1| hypothetical protein MAP_2961c [Mycobacterium avium subsp. paratuberculosis K-10] Length = 388 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YP + LL I G+ +E G Sbjct: 186 LAGGLDVAYPSGHSALLHRI-GQHGLLFTEYAPG 218 >gi|16803314|ref|NP_464799.1| hypothetical protein lmo1274 [Listeria monocytogenes EGD-e] gi|224501781|ref|ZP_03670088.1| hypothetical protein LmonFR_04582 [Listeria monocytogenes FSL R2-561] gi|16410690|emb|CAC99352.1| lmo1274 [Listeria monocytogenes EGD-e] Length = 286 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP +N L +EI G+ +SE Sbjct: 166 LGSGVNKIYPKKNEFLAKEIAKE-GLLLSEY 195 >gi|47097417|ref|ZP_00234966.1| DNA processing protein DprA, putative [Listeria monocytogenes str. 1/2a F6854] gi|224499055|ref|ZP_03667404.1| hypothetical protein LmonF1_04860 [Listeria monocytogenes Finland 1988] gi|254829969|ref|ZP_05234624.1| hypothetical protein Lmon1_01370 [Listeria monocytogenes 10403S] gi|254898561|ref|ZP_05258485.1| hypothetical protein LmonJ_02060 [Listeria monocytogenes J0161] gi|254911949|ref|ZP_05261961.1| conserved hypothetical protein [Listeria monocytogenes J2818] gi|254936275|ref|ZP_05267972.1| smf family protein [Listeria monocytogenes F6900] gi|255025706|ref|ZP_05297692.1| hypothetical protein LmonocytFSL_04035 [Listeria monocytogenes FSL J2-003] gi|284801659|ref|YP_003413524.1| hypothetical protein LM5578_1412 [Listeria monocytogenes 08-5578] gi|284994801|ref|YP_003416569.1| hypothetical protein LM5923_1365 [Listeria monocytogenes 08-5923] gi|47014216|gb|EAL05200.1| DNA processing protein DprA, putative [Listeria monocytogenes str. 1/2a F6854] gi|258608864|gb|EEW21472.1| smf family protein [Listeria monocytogenes F6900] gi|284057221|gb|ADB68162.1| hypothetical protein LM5578_1412 [Listeria monocytogenes 08-5578] gi|284060268|gb|ADB71207.1| hypothetical protein LM5923_1365 [Listeria monocytogenes 08-5923] gi|293589910|gb|EFF98244.1| conserved hypothetical protein [Listeria monocytogenes J2818] Length = 286 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP +N L +EI G+ +SE Sbjct: 166 LGSGVNKIYPKKNEFLAKEIAKE-GLLLSEY 195 >gi|218258323|ref|ZP_03474725.1| hypothetical protein PRABACTJOHN_00380 [Parabacteroides johnsonii DSM 18315] gi|218225563|gb|EEC98213.1| hypothetical protein PRABACTJOHN_00380 [Parabacteroides johnsonii DSM 18315] Length = 371 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +RN E+ ++GG+ ++ P G Sbjct: 175 LAHGLDRIYPSSHRNTAVEMLESGGLL-TDFPSG 207 >gi|289644811|ref|ZP_06476864.1| DNA protecting protein DprA [Frankia symbiont of Datisca glomerata] gi|289505367|gb|EFD26413.1| DNA protecting protein DprA [Frankia symbiont of Datisca glomerata] Length = 388 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + LL I DN G+ +SE G Sbjct: 169 LAGGVDIAYPRAHTELLARIRDN-GLVVSEAAPG 201 >gi|300858734|ref|YP_003783717.1| hypothetical protein cpfrc_01317 [Corynebacterium pseudotuberculosis FRC41] gi|300686188|gb|ADK29110.1| hypothetical protein cpfrc_01317 [Corynebacterium pseudotuberculosis FRC41] gi|302206441|gb|ADL10783.1| SMF DNA recombination-mediator protein A [Corynebacterium pseudotuberculosis C231] gi|302330997|gb|ADL21191.1| Rossmann-fold nucleotide-binding protein/SMF [Corynebacterium pseudotuberculosis 1002] gi|308276683|gb|ADO26582.1| Rossmann-fold nucleotide-binding protein/SMF [Corynebacterium pseudotuberculosis I19] Length = 391 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP N L + G +SE G Sbjct: 191 ARGLDKAYPSSNAGLFRAVM-QRGCIVSEYAPG 222 >gi|326776294|ref|ZP_08235559.1| DNA protecting protein DprA [Streptomyces cf. griseus XylebKG-1] gi|326656627|gb|EGE41473.1| DNA protecting protein DprA [Streptomyces cf. griseus XylebKG-1] Length = 442 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G+D YP + LL G+ ++E+P Sbjct: 237 LACGVDVAYPRGHAELLGR-LAQQGLIVAELPP 268 >gi|15805160|ref|NP_293846.1| smf protein [Deinococcus radiodurans R1] gi|6457785|gb|AAF09710.1|AE001874_7 smf protein [Deinococcus radiodurans R1] Length = 370 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + +D +YP EN +L + +SE P G Sbjct: 193 LGSAVDVIYPRENHDLAGRMV-----VVSEYPLG 221 >gi|296283690|ref|ZP_06861688.1| DNA processing chain A [Citromicrobium bathyomarinum JL354] Length = 363 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G++ YPP++ L + I + G+ I+E P G Sbjct: 166 IASGIEIAYPPQHAELQKRI-ASEGLLIAEQPPG 198 >gi|163839842|ref|YP_001624247.1| SMF family protein [Renibacterium salmoninarum ATCC 33209] gi|162953318|gb|ABY22833.1| SMF family protein [Renibacterium salmoninarum ATCC 33209] Length = 323 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGGLD YP N LL EI G+ ++E+P G Sbjct: 126 MAGGLDRFYPAGNELLLREI-SQSGLLLAEVPPG 158 >gi|260907247|ref|ZP_05915569.1| DNA protecting protein DprA [Brevibacterium linens BL2] Length = 404 Score = 48.8 bits (117), Expect = 3e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D YP N L +++ + G +SE G Sbjct: 199 MAGGVDRFYPVANTELFQQVLE-DGAIVSETAPG 231 >gi|257452077|ref|ZP_05617376.1| DNA processing chain A [Fusobacterium sp. 3_1_5R] gi|317058626|ref|ZP_07923111.1| protein smf [Fusobacterium sp. 3_1_5R] gi|313684302|gb|EFS21137.1| protein smf [Fusobacterium sp. 3_1_5R] Length = 309 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDC-LYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP EN+ L I + GG +SE+P Sbjct: 188 LGQGLAREIYPRENQILASRILNMGGFLLSELPP 221 >gi|256838472|ref|ZP_05543982.1| conserved hypothetical protein [Parabacteroides sp. D13] gi|256739391|gb|EEU52715.1| conserved hypothetical protein [Parabacteroides sp. D13] Length = 372 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YPP +R+ E+ + GG+ ++ P G Sbjct: 175 LAHGLDRIYPPVHRSTAVEMLERGGLL-TDFPSG 207 >gi|226942058|ref|YP_002797132.1| Rossmann fold nucleotide-binding protein involved in DNA uptake [Laribacter hongkongensis HLHK9] gi|226716986|gb|ACO76124.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Laribacter hongkongensis HLHK9] Length = 383 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 6 DCLYPPENRNLLEEIWDNGGIAISEIPFG 34 D +YP NR+L + G+ +SE+P G Sbjct: 199 DRIYPAANRDLAYRMAAE-GLLVSELPLG 226 >gi|325913840|ref|ZP_08176199.1| DNA protecting protein DprA [Xanthomonas vesicatoria ATCC 35937] gi|325539915|gb|EGD11552.1| DNA protecting protein DprA [Xanthomonas vesicatoria ATCC 35937] Length = 378 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D YP +R L + I G +SE G Sbjct: 175 GTGADLAYPAHHRALRDRIAAR-GAVVSEYLPG 206 >gi|150009778|ref|YP_001304521.1| putative DNA processing Smf-like protein [Parabacteroides distasonis ATCC 8503] gi|149938202|gb|ABR44899.1| putative DNA processing Smf-like protein [Parabacteroides distasonis ATCC 8503] Length = 372 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YPP +R+ E+ + GG+ ++ P G Sbjct: 175 LAHGLDRIYPPVHRSTAVEMLERGGLL-TDFPSG 207 >gi|317129219|ref|YP_004095501.1| DNA protecting protein DprA [Bacillus cellulosilyticus DSM 2522] gi|315474167|gb|ADU30770.1| DNA protecting protein DprA [Bacillus cellulosilyticus DSM 2522] Length = 289 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP N LL +I + + ++E P Sbjct: 173 LGYGLDWVYPKSNEQLLNDI-KHQHLVLTEYPP 204 >gi|298374172|ref|ZP_06984130.1| DNA processing protein DprA [Bacteroides sp. 3_1_19] gi|301312346|ref|ZP_07218263.1| putative DNA processing protein DprA [Bacteroides sp. 20_3] gi|298268540|gb|EFI10195.1| DNA processing protein DprA [Bacteroides sp. 3_1_19] gi|300829768|gb|EFK60421.1| putative DNA processing protein DprA [Bacteroides sp. 20_3] Length = 372 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YPP +R+ E+ + GG+ ++ P G Sbjct: 175 LAHGLDRIYPPVHRSTAVEMLERGGLL-TDFPSG 207 >gi|294782849|ref|ZP_06748175.1| DNA processing chain A [Fusobacterium sp. 1_1_41FAA] gi|294481490|gb|EFG29265.1| DNA processing chain A [Fusobacterium sp. 1_1_41FAA] Length = 304 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN NL++ I +N G +SE+ Sbjct: 183 LGQGLDLEIYPRENINLVDRILENNGFLLSEL 214 >gi|86742265|ref|YP_482665.1| DNA processing protein DprA [Frankia sp. CcI3] gi|86569127|gb|ABD12936.1| DNA protecting protein DprA [Frankia sp. CcI3] Length = 446 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + LLEEI G +SE+ G Sbjct: 195 LAGGVDVPYPTAHVELLEEI-ARTGAVVSEVSPG 227 >gi|84501686|ref|ZP_00999858.1| DNA processing protein DprA, putative [Oceanicola batsensis HTCC2597] gi|84390307|gb|EAQ02866.1| DNA processing protein DprA, putative [Oceanicola batsensis HTCC2597] Length = 372 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D LYPPEN L + I G +SE+P G Sbjct: 153 MAGGVDALYPPENATLADAIPGT-GARLSEMPMG 185 >gi|289768831|ref|ZP_06528209.1| DNA processing Smf-family protein [Streptomyces lividans TK24] gi|289699030|gb|EFD66459.1| DNA processing Smf-family protein [Streptomyces lividans TK24] Length = 413 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YPP + L+ I + G+ + E+P G Sbjct: 210 CGVDRPYPPGHTALITRIAEQ-GLVVGELPPG 240 >gi|315302909|ref|ZP_07873645.1| DNA protecting protein DprA [Listeria ivanovii FSL F6-596] gi|313628723|gb|EFR97120.1| DNA protecting protein DprA [Listeria ivanovii FSL F6-596] Length = 286 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ +YP +N L EEI G+ ISE Sbjct: 166 LGSGIKNIYPKKNTLLAEEI-SQKGLLISEY 195 >gi|289667881|ref|ZP_06488956.1| DNA processing chain A [Xanthomonas campestris pv. musacearum NCPPB4381] Length = 251 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D YP ++ L + I + G +SE G Sbjct: 45 GTGTDVAYPERHQGLRDRIAER-GAVVSEYLPG 76 >gi|256784938|ref|ZP_05523369.1| DNA processing Smf-family protein [Streptomyces lividans TK24] Length = 432 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YPP + L+ I + G+ + E+P G Sbjct: 229 CGVDRPYPPGHTALITRIAEQ-GLVVGELPPG 259 >gi|254365536|ref|ZP_04981581.1| conserved hypothetical protein [Mycobacterium tuberculosis str. Haarlem] gi|134151049|gb|EBA43094.1| conserved hypothetical protein [Mycobacterium tuberculosis str. Haarlem] Length = 389 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GG D YP + LL I G+ +E P G Sbjct: 181 LTGGFDIPYPAGHSALLHRI-AQHGVLFTEYPPG 213 >gi|85373787|ref|YP_457849.1| DNA processing chain A [Erythrobacter litoralis HTCC2594] gi|84786870|gb|ABC63052.1| DNA processing chain A [Erythrobacter litoralis HTCC2594] Length = 367 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YPP++ L E I + ++E P G Sbjct: 168 IASGIDIAYPPQHAELQERIASEA-LLLAEQPPG 200 >gi|313623980|gb|EFR94079.1| DNA protecting protein DprA [Listeria innocua FSL J1-023] Length = 286 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP N+ L +E+ G+ +SE Sbjct: 166 LGSGVNKIYPRTNKLLAKEVLAQ-GLLLSEY 195 >gi|108804233|ref|YP_644170.1| DNA processing protein DprA [Rubrobacter xylanophilus DSM 9941] gi|108765476|gb|ABG04358.1| DNA processing protein DprA, putative [Rubrobacter xylanophilus DSM 9941] Length = 368 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N L E+ GG +SE G Sbjct: 173 LGCGIDVVYPRVNARLFGEVRAAGG-IVSEYYLG 205 >gi|325924331|ref|ZP_08185875.1| DNA protecting protein DprA [Xanthomonas gardneri ATCC 19865] gi|325545196|gb|EGD16506.1| DNA protecting protein DprA [Xanthomonas gardneri ATCC 19865] Length = 378 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D YP +++L + I G +SE G Sbjct: 175 GTGTDVAYPAHHQSLRDRIAAR-GAVVSEYLPG 206 >gi|254463451|ref|ZP_05076867.1| DNA protecting protein DprA [Rhodobacterales bacterium HTCC2083] gi|206680040|gb|EDZ44527.1| DNA protecting protein DprA [Rhodobacteraceae bacterium HTCC2083] Length = 356 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YP E NL + D G +SE P G Sbjct: 153 LAGGVDVIYPNEKLNLASSMLDE-GALLSEQPIG 185 >gi|256824961|ref|YP_003148921.1| DNA protecting protein DprA [Kytococcus sedentarius DSM 20547] gi|256688354|gb|ACV06156.1| DNA protecting protein DprA [Kytococcus sedentarius DSM 20547] Length = 371 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D LYP N +LL E+ G +SE G Sbjct: 178 LAGGVDRLYPAGNADLLTEVV-RTGAVVSESAPG 210 >gi|196233436|ref|ZP_03132280.1| DNA protecting protein DprA [Chthoniobacter flavus Ellin428] gi|196222576|gb|EDY17102.1| DNA protecting protein DprA [Chthoniobacter flavus Ellin428] Length = 362 Score = 48.4 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYPPEN+ L E+I + G +SE P Sbjct: 172 IGSGLMDLYPPENQALAEKIT-SSGAVVSEFPM 203 >gi|182680321|ref|YP_001834467.1| DNA protecting protein DprA [Beijerinckia indica subsp. indica ATCC 9039] gi|182636204|gb|ACB96978.1| DNA protecting protein DprA [Beijerinckia indica subsp. indica ATCC 9039] Length = 429 Score = 48.4 bits (116), Expect = 4e-04, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGL +YP E+ LLE + G AISE+PF Sbjct: 177 LAGGLGRIYPAEHAPLLERLLGE-GAAISEMPF 208 >gi|319950989|ref|ZP_08024859.1| DNA protecting protein DprA [Dietzia cinnamea P4] gi|319435332|gb|EFV90582.1| DNA protecting protein DprA [Dietzia cinnamea P4] Length = 401 Score = 48.4 bits (116), Expect = 4e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D LYP N LL E+ + G IS P G Sbjct: 197 LAGGVDRLYPRGNDGLLREVAET-GAVISAQPPG 229 >gi|319649577|ref|ZP_08003733.1| DNA processing protein [Bacillus sp. 2_A_57_CT2] gi|317398739|gb|EFV79421.1| DNA processing protein [Bacillus sp. 2_A_57_CT2] Length = 291 Score = 48.4 bits (116), Expect = 4e-04, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGL +YP N+ L E+ N + ISE P Sbjct: 174 IAGGLFHIYPQANQRLAYEMMKNQ-LVISEYPP 205 >gi|227498486|ref|ZP_03928632.1| DNA protecting protein dprA [Acidaminococcus sp. D21] gi|226903944|gb|EEH89862.1| DNA protecting protein dprA [Acidaminococcus sp. D21] Length = 367 Score = 48.4 bits (116), Expect = 4e-04, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL YP ++ L + I + G ISE Sbjct: 171 LGSGLARPYPVRHKGLFQRISET-GAVISEFSP 202 >gi|46907501|ref|YP_013890.1| Smf family protein [Listeria monocytogenes serotype 4b str. F2365] gi|254824665|ref|ZP_05229666.1| smf family protein [Listeria monocytogenes FSL J1-194] gi|254852672|ref|ZP_05242020.1| smf family protein [Listeria monocytogenes FSL R2-503] gi|254932409|ref|ZP_05265768.1| smf family protein [Listeria monocytogenes HPB2262] gi|254993491|ref|ZP_05275681.1| Smf family protein [Listeria monocytogenes FSL J2-064] gi|255520256|ref|ZP_05387493.1| Smf family protein [Listeria monocytogenes FSL J1-175] gi|300765310|ref|ZP_07075294.1| DNA processing protein DprA [Listeria monocytogenes FSL N1-017] gi|46880769|gb|AAT04067.1| Smf family protein [Listeria monocytogenes serotype 4b str. F2365] gi|258605990|gb|EEW18598.1| smf family protein [Listeria monocytogenes FSL R2-503] gi|293583966|gb|EFF95998.1| smf family protein [Listeria monocytogenes HPB2262] gi|293593904|gb|EFG01665.1| smf family protein [Listeria monocytogenes FSL J1-194] gi|300513993|gb|EFK41056.1| DNA processing protein DprA [Listeria monocytogenes FSL N1-017] gi|328468564|gb|EGF39564.1| Smf family protein [Listeria monocytogenes 1816] gi|328475118|gb|EGF45902.1| Smf family protein [Listeria monocytogenes 220] gi|332311719|gb|EGJ24814.1| Smf family protein [Listeria monocytogenes str. Scott A] Length = 286 Score = 48.4 bits (116), Expect = 4e-04, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP +N L +EI G+ +SE Sbjct: 166 LGSGVNKVYPKKNELLAKEIVKE-GLLLSEY 195 >gi|21223959|ref|NP_629738.1| hypothetical protein SCO5604 [Streptomyces coelicolor A3(2)] gi|3191997|emb|CAA19396.1| conserved hypothetical protein SC2E1.21 [Streptomyces coelicolor A3(2)] Length = 382 Score = 48.4 bits (116), Expect = 4e-04, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YPP + L+ I + G+ + E+P G Sbjct: 281 CGVDRPYPPGHTALITRIAEQ-GLVVGELPPG 311 >gi|47093923|ref|ZP_00231662.1| DNA processing protein DprA, putative [Listeria monocytogenes str. 4b H7858] gi|47017709|gb|EAL08503.1| DNA processing protein DprA, putative [Listeria monocytogenes str. 4b H7858] Length = 286 Score = 48.4 bits (116), Expect = 4e-04, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP +N L +EI G+ +SE Sbjct: 166 LGSGVNKVYPKKNELLAKEIVKE-GLLLSEY 195 >gi|331266236|ref|YP_004325866.1| DNA processing protein DprA [Streptococcus oralis Uo5] gi|326682908|emb|CBZ00525.1| DNA processing protein DprA [Streptococcus oralis Uo5] Length = 282 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L E I N + +SE G Sbjct: 165 IGTGLDVFYPRANKRLQEHI-GNHHLVLSEYGPG 197 >gi|307703531|ref|ZP_07640473.1| DNA protecting protein DprA [Streptococcus oralis ATCC 35037] gi|307622938|gb|EFO01933.1| DNA protecting protein DprA [Streptococcus oralis ATCC 35037] Length = 282 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L E I N + +SE G Sbjct: 165 IGTGLDVFYPRANKRLQEHI-GNHHLVLSEYGPG 197 >gi|306833473|ref|ZP_07466600.1| DNA protecting protein DprA [Streptococcus bovis ATCC 700338] gi|304424243|gb|EFM27382.1| DNA protecting protein DprA [Streptococcus bovis ATCC 700338] Length = 280 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP EN+ L E + N + +SE Sbjct: 163 IGCGLDVYYPKENKQLQEYMVKNH-LVLSEY 192 >gi|227889895|ref|ZP_04007700.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus johnsonii ATCC 33200] gi|227849339|gb|EEJ59425.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus johnsonii ATCC 33200] Length = 281 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP EN+ L EEI G+ ISE Sbjct: 167 IGNGLNHFYPQENKMLQEEIMA-KGLLISEY 196 >gi|127514662|ref|YP_001095859.1| DNA protecting protein DprA [Shewanella loihica PV-4] gi|126639957|gb|ABO25600.1| DNA protecting protein DprA [Shewanella loihica PV-4] Length = 339 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP ++ + E+I G +SE Sbjct: 143 LGTGIEVIYPKRHKPIYEKI-QQRGCVLSEF 172 >gi|329667433|gb|AEB93381.1| SMF protein [Lactobacillus johnsonii DPC 6026] Length = 281 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP EN+ L EEI G+ ISE Sbjct: 167 IGNGLNHFYPQENKMLQEEIMA-KGLLISEY 196 >gi|295399799|ref|ZP_06809780.1| DNA protecting protein DprA [Geobacillus thermoglucosidasius C56-YS93] gi|312111689|ref|YP_003990005.1| DNA protecting protein DprA [Geobacillus sp. Y4.1MC1] gi|294978202|gb|EFG53799.1| DNA protecting protein DprA [Geobacillus thermoglucosidasius C56-YS93] gi|311216790|gb|ADP75394.1| DNA protecting protein DprA [Geobacillus sp. Y4.1MC1] Length = 297 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG++ +YP +N+ L +++ D G + +SE P Sbjct: 175 IAGGVNHIYPKQNQQLADQLMD-GHLVLSEHPP 206 >gi|322375364|ref|ZP_08049877.1| DNA protecting protein DprA [Streptococcus sp. C300] gi|321279627|gb|EFX56667.1| DNA protecting protein DprA [Streptococcus sp. C300] Length = 282 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L E I N + +SE G Sbjct: 165 IGTGLDVFYPRANKRLQEHI-GNHHLVLSEYGPG 197 >gi|268319574|ref|YP_003293230.1| DNA protecting protein DprA [Lactobacillus johnsonii FI9785] gi|262397949|emb|CAX66963.1| DNA protecting protein DprA [Lactobacillus johnsonii FI9785] Length = 281 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP EN+ L EEI G+ ISE Sbjct: 167 IGNGLNHFYPQENKMLQEEIMA-KGLLISEY 196 >gi|323136208|ref|ZP_08071290.1| DNA protecting protein DprA [Methylocystis sp. ATCC 49242] gi|322398282|gb|EFY00802.1| DNA protecting protein DprA [Methylocystis sp. ATCC 49242] Length = 424 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG YP E+ L+EEI + G+ +SE+P Sbjct: 175 LAGGQARPYPAEHGRLIEEIAER-GLIVSEMPL 206 >gi|293365577|ref|ZP_06612286.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037] gi|291315945|gb|EFE56389.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037] Length = 286 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L E I N + +SE G Sbjct: 169 IGTGLDVFYPRANKRLQEHI-GNHHLVLSEYGPG 201 >gi|213964531|ref|ZP_03392731.1| smf family protein [Corynebacterium amycolatum SK46] gi|213952724|gb|EEB64106.1| smf family protein [Corynebacterium amycolatum SK46] Length = 378 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Query: 9 YPPENRNLLEEIWDNGGIAISEIPFG 34 YP + L + I + G ++E P G Sbjct: 186 YPRTHAELFDRIAER-GALVTEYPPG 210 >gi|295696103|ref|YP_003589341.1| DNA protecting protein DprA [Bacillus tusciae DSM 2912] gi|295411705|gb|ADG06197.1| DNA protecting protein DprA [Bacillus tusciae DSM 2912] Length = 384 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG LYPPE+R+L G ISE P Sbjct: 184 LAGGFHHLYPPEHRSLAAA-VARSGALISEQPP 215 >gi|42519033|ref|NP_964963.1| SMF protein [Lactobacillus johnsonii NCC 533] gi|41583320|gb|AAS08929.1| SMF protein [Lactobacillus johnsonii NCC 533] Length = 281 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP EN+ L EEI G+ ISE Sbjct: 167 IGNGLNHFYPQENKMLQEEIMA-KGLLISEY 196 >gi|315613290|ref|ZP_07888199.1| DNA protecting protein DprA [Streptococcus sanguinis ATCC 49296] gi|315314525|gb|EFU62568.1| DNA protecting protein DprA [Streptococcus sanguinis ATCC 49296] Length = 286 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L E I N + +SE G Sbjct: 169 IGTGLDVFYPRANKRLQEHI-GNHHLVLSEYGPG 201 >gi|297180812|gb|ADI17018.1| predicted rossmann fold nucleotide-binding protein involved in DNA uptake [uncultured Vibrionales bacterium HF0010_22E23] Length = 366 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD LYP + +L EI + G +SE Sbjct: 171 LGSGLDNLYPKHHISLAGEITER-GALVSEF 200 >gi|223985626|ref|ZP_03635676.1| hypothetical protein HOLDEFILI_02982 [Holdemania filiformis DSM 12042] gi|223962393|gb|EEF66855.1| hypothetical protein HOLDEFILI_02982 [Holdemania filiformis DSM 12042] Length = 260 Score = 48.0 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GLD YP NR+L E+ + +SE P Sbjct: 130 GCGLDRPYPAYNRDLYTELPKAN-LLLSEYPP 160 >gi|260438814|ref|ZP_05792630.1| DNA processing protein DprA [Butyrivibrio crossotus DSM 2876] gi|292808803|gb|EFF68008.1| DNA processing protein DprA [Butyrivibrio crossotus DSM 2876] Length = 360 Score = 48.0 bits (115), Expect = 5e-04, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +AGG++ YP N NL +I N G ISE P Sbjct: 170 LAGGVEKCYPAGNFNLYMDI-QNRGGIISEYP 200 >gi|229820997|ref|YP_002882523.1| DNA protecting protein DprA [Beutenbergia cavernae DSM 12333] gi|229566910|gb|ACQ80761.1| DNA protecting protein DprA [Beutenbergia cavernae DSM 12333] Length = 386 Score = 48.0 bits (115), Expect = 5e-04, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGGLD YPP N +LL G ++E+P G Sbjct: 186 LAGGLDRFYPPGNSDLLRA-VGRDGALVAELPPG 218 >gi|307946437|ref|ZP_07661772.1| DNA protecting protein DprA [Roseibium sp. TrichSKD4] gi|307770101|gb|EFO29327.1| DNA protecting protein DprA [Roseibium sp. TrichSKD4] Length = 378 Score = 48.0 bits (115), Expect = 5e-04, Method: Composition-based stats. Identities = 18/33 (54%), Positives = 25/33 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYPP++ LL + + GG AI+E+PFG Sbjct: 177 AGGIDILYPPDHAGLLSSLLERGGNAITEMPFG 209 >gi|194367359|ref|YP_002029969.1| DNA protecting protein DprA [Stenotrophomonas maltophilia R551-3] gi|194350163|gb|ACF53286.1| DNA protecting protein DprA [Stenotrophomonas maltophilia R551-3] Length = 375 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP + L I G +SE G Sbjct: 171 IGTGPDRAYPDSHARLQARIAAE-GAVLSEYLPG 203 >gi|325104560|ref|YP_004274214.1| DNA protecting protein DprA [Pedobacter saltans DSM 12145] gi|324973408|gb|ADY52392.1| DNA protecting protein DprA [Pedobacter saltans DSM 12145] Length = 361 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP +RN+ E++ +GG+ +E Sbjct: 169 LGHGLDLIYPAAHRNVAEQMLSDGGLL-TEYYP 200 >gi|116671018|ref|YP_831951.1| DNA protecting protein DprA [Arthrobacter sp. FB24] gi|116611127|gb|ABK03851.1| DNA protecting protein DprA [Arthrobacter sp. FB24] Length = 394 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D YP N LL N G ++E+P G Sbjct: 197 MAGGVDRFYPSGNEELL-RTVANQGAVLAEVPPG 229 >gi|329936709|ref|ZP_08286416.1| DNA mediated transformation protein [Streptomyces griseoaurantiacus M045] gi|329303939|gb|EGG47822.1| DNA mediated transformation protein [Streptomyces griseoaurantiacus M045] Length = 425 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YP + LL I G+ + E+ G Sbjct: 220 LACGVDRTYPKGHTALLGRI-ARQGLLVGELAPG 252 >gi|239908043|ref|YP_002954784.1| SMF protein [Desulfovibrio magneticus RS-1] gi|239797909|dbj|BAH76898.1| SMF protein [Desulfovibrio magneticus RS-1] Length = 455 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP N ++ E+ GG +SE G Sbjct: 191 LGTGLDLVYPDANLDVWRELAA-GGAVVSEFAPG 223 >gi|311064587|ref|YP_003971312.1| Smf family protein [Bifidobacterium bifidum PRL2010] gi|310866906|gb|ADP36275.1| Smf family protein [Bifidobacterium bifidum PRL2010] Length = 504 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ P N L + I +NGG +SE+ G Sbjct: 235 AGGLNHAGPQCNSELFDGIAENGGALVSELCPG 267 >gi|310287689|ref|YP_003938947.1| SMF family protein [Bifidobacterium bifidum S17] gi|309251625|gb|ADO53373.1| SMF family protein [Bifidobacterium bifidum S17] Length = 504 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ P N L + I +NGG +SE+ G Sbjct: 235 AGGLNHAGPQCNSELFDGIAENGGALVSELCPG 267 >gi|225621489|ref|YP_002722748.1| putative DNA protecting protein DprA [Brachyspira hyodysenteriae WA1] gi|225216310|gb|ACN85044.1| putative DNA protecting protein DprA [Brachyspira hyodysenteriae WA1] Length = 416 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN + + G+ +SE G Sbjct: 167 LGNGIDNVYPSENLQIYNK-LSEKGLIVSEFEIG 199 >gi|254515966|ref|ZP_05128026.1| peptide deformylase, DNA processing protein [gamma proteobacterium NOR5-3] gi|219675688|gb|EED32054.1| peptide deformylase, DNA processing protein [gamma proteobacterium NOR5-3] Length = 371 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D P +R L E I G +SE+P G Sbjct: 180 LASGVDRPSPLRHRQLAEHIT-QAGCLVSELPAG 212 >gi|317056329|ref|YP_004104796.1| DNA protecting protein DprA [Ruminococcus albus 7] gi|315448598|gb|ADU22162.1| DNA protecting protein DprA [Ruminococcus albus 7] Length = 286 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D YP + +L I G ISE P Sbjct: 172 LGCGIDYDYPRYSGDLKNSIV-QNGAVISEYPP 203 >gi|271963393|ref|YP_003337589.1| DNA uptake Rossmann fold nucleotide-binding protein [Streptosporangium roseum DSM 43021] gi|270506568|gb|ACZ84846.1| Rossmann fold nucleotide-binding protein involved in DNA uptake-like protein [Streptosporangium roseum DSM 43021] Length = 396 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G D YP + +L + G+ +SE P G Sbjct: 196 LACGADVAYPSAHHSLFAA-VRSQGVLVSECPMG 228 >gi|162145885|ref|YP_001600343.1| DNA processing chain A [Gluconacetobacter diazotrophicus PAl 5] gi|161784459|emb|CAP53989.1| putative DNA processing chain A [Gluconacetobacter diazotrophicus PAl 5] Length = 395 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGLD YPP++ L I G+ ++E P G Sbjct: 169 AGGLDRPYPPDHAELQGRI-AQHGVVVTETPLG 200 >gi|322392030|ref|ZP_08065493.1| DNA processing protein DprA [Streptococcus peroris ATCC 700780] gi|321145128|gb|EFX40526.1| DNA processing protein DprA [Streptococcus peroris ATCC 700780] Length = 287 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L E I DN + +SE G Sbjct: 170 IGTGLDVYYPRANKRLQEYIGDNH-LVLSEYGPG 202 >gi|224283319|ref|ZP_03646641.1| hypothetical protein BbifN4_05770 [Bifidobacterium bifidum NCIMB 41171] gi|313140471|ref|ZP_07802664.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB 41171] gi|313132981|gb|EFR50598.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB 41171] Length = 504 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ P N L + I +NGG +SE+ G Sbjct: 235 AGGLNHAGPQCNSELFDGIAENGGALVSELCPG 267 >gi|46445706|ref|YP_007071.1| putative protein required for chromosomal DNA transformation [Candidatus Protochlamydia amoebophila UWE25] gi|46399347|emb|CAF22796.1| putative protein required for chromosomal DNA transformation [Candidatus Protochlamydia amoebophila UWE25] Length = 363 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP EN L ++I G ISE Sbjct: 172 IGSGLANIYPQENHYLADQI-AKKGAVISEFSM 203 >gi|209543807|ref|YP_002276036.1| DNA protecting protein DprA [Gluconacetobacter diazotrophicus PAl 5] gi|209531484|gb|ACI51421.1| DNA protecting protein DprA [Gluconacetobacter diazotrophicus PAl 5] Length = 395 Score = 47.6 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGLD YPP++ L I G+ ++E P G Sbjct: 169 AGGLDRPYPPDHAELQGRI-AQHGVVVTETPLG 200 >gi|255534194|ref|YP_003094565.1| Smf protein DNA processing chain A [Flavobacteriaceae bacterium 3519-10] gi|255340390|gb|ACU06503.1| Smf protein DNA processing chain A [Flavobacteriaceae bacterium 3519-10] Length = 342 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 21/31 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G +YP +NR L ++I ++GG+ ++E Sbjct: 147 LAHGFHTMYPSKNRRLADKILEDGGVLLTEF 177 >gi|325299271|ref|YP_004259188.1| SMF family protein [Bacteroides salanitronis DSM 18170] gi|324318824|gb|ADY36715.1| SMF family protein [Bacteroides salanitronis DSM 18170] Length = 308 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + LD + P EN L E+I + GG+ ISE Sbjct: 166 LPSTLDSILPKENVELAEKIVEAGGLLISEY 196 >gi|99082178|ref|YP_614332.1| DNA processing protein DprA, putative [Ruegeria sp. TM1040] gi|99038458|gb|ABF65070.1| DNA processing protein DprA putative [Ruegeria sp. TM1040] Length = 382 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GG+D +YP EN L + + G+ +SE P G Sbjct: 181 GGGVDIIYPSENTPLAMTLAEQ-GLRLSEQPMG 212 >gi|154489877|ref|ZP_02030138.1| hypothetical protein PARMER_00106 [Parabacteroides merdae ATCC 43184] gi|154089319|gb|EDN88363.1| hypothetical protein PARMER_00106 [Parabacteroides merdae ATCC 43184] Length = 371 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +RN E+ ++GG+ ++ P G Sbjct: 175 LAHGLDRIYPSCHRNTAVEMLESGGLL-TDFPSG 207 >gi|332525406|ref|ZP_08401566.1| putative SMF protein [Rubrivivax benzoatilyticus JA2] gi|332108675|gb|EGJ09899.1| putative SMF protein [Rubrivivax benzoatilyticus JA2] Length = 365 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 9/29 (31%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Query: 6 DCLYPPENRNLLEEIWDNGGIAISEIPFG 34 D +YP ++ L I + G +SE G Sbjct: 181 DRVYPARHKALARRIAET-GAIVSEYDPG 208 >gi|302023792|ref|ZP_07249003.1| DNA uptake Rossmann fold nucleotide-binding protein [Streptococcus suis 05HAS68] gi|330832819|ref|YP_004401644.1| DNA protecting protein DprA [Streptococcus suis ST3] gi|329307042|gb|AEB81458.1| DNA protecting protein DprA [Streptococcus suis ST3] Length = 280 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP ENR L I + + ++E G Sbjct: 163 IGTGLDKIYPKENRELQTYIGKHH-LVLTEYGPG 195 >gi|299783203|gb|ADJ41201.1| DNA processing protein [Lactobacillus fermentum CECT 5716] Length = 265 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD YP N L ++ D G+ ++E P Sbjct: 142 IGTGLDQTYPRSNGALQAQVADQ-GLLLTEYPL 173 >gi|303248293|ref|ZP_07334555.1| DNA protecting protein DprA [Desulfovibrio fructosovorans JJ] gi|302490318|gb|EFL50230.1| DNA protecting protein DprA [Desulfovibrio fructosovorans JJ] Length = 420 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP N ++ + G ISE P G Sbjct: 190 GTGLDLVYPDANLDVWRALAAE-GAIISEFPPG 221 >gi|149174899|ref|ZP_01853523.1| DNA processing chain A [Planctomyces maris DSM 8797] gi|148846236|gb|EDL60575.1| DNA processing chain A [Planctomyces maris DSM 8797] Length = 376 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MA GL +YPPE+R L E + G ++E P Sbjct: 180 MATGLAHIYPPEHRELSEAVALQ-GAIVTEFPL 211 >gi|290477160|ref|YP_003470075.1| protein smf [Xenorhabdus bovienii SS-2004] gi|289176508|emb|CBJ83317.1| Protein smf [Xenorhabdus bovienii SS-2004] Length = 358 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + +L I + G +SE Sbjct: 167 LGSGLEKIYPYRHDSLARFI-EENGALVSEFFP 198 >gi|281422352|ref|ZP_06253351.1| putative DNA processing protein DprA [Prevotella copri DSM 18205] gi|281403583|gb|EFB34263.1| putative DNA processing protein DprA [Prevotella copri DSM 18205] Length = 392 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP ++R + + GG+ +E Sbjct: 194 LAHGLDDLYPRQHRETAARMIEQGGLL-TEF 223 >gi|323343753|ref|ZP_08083980.1| SMF family DNA processing protein [Prevotella oralis ATCC 33269] gi|323095572|gb|EFZ38146.1| SMF family DNA processing protein [Prevotella oralis ATCC 33269] Length = 375 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYPP +R EE+ +GG+ SE Sbjct: 177 LAHGLDDLYPPRHRQTAEEMLLHGGLL-SEF 206 >gi|320008282|gb|ADW03132.1| DNA protecting protein DprA [Streptomyces flavogriseus ATCC 33331] Length = 390 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G+D YP + L+ I + G+ + E+P Sbjct: 185 LACGVDVAYPRGHAELIGRIAEQ-GVVMGELPP 216 >gi|295096930|emb|CBK86020.1| DNA protecting protein DprA [Enterobacter cloacae subsp. cloacae NCTC 9394] Length = 379 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 16/31 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL LYP + L E++ + G +SE Sbjct: 172 LGNGLFSLYPRRHHILAEQLIASEGAIVSEF 202 >gi|111225142|ref|YP_715936.1| putative DNA processing Smf-family protein [Frankia alni ACN14a] gi|111152674|emb|CAJ64415.1| Putative DNA processing Smf-family protein [Frankia alni ACN14a] Length = 442 Score = 47.6 bits (114), Expect = 6e-04, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP + LL EI G +SE+ G Sbjct: 232 LAGGVDVPYPAAHVELLAEI-GRTGAVVSEVAPG 264 >gi|184155374|ref|YP_001843714.1| DNA processing protein [Lactobacillus fermentum IFO 3956] gi|183226718|dbj|BAG27234.1| DNA processing protein [Lactobacillus fermentum IFO 3956] Length = 291 Score = 47.3 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD YP N L ++ D G+ ++E P Sbjct: 168 IGTGLDQTYPRSNGALQAQVADQ-GLLLTEYPL 199 >gi|160939767|ref|ZP_02087114.1| hypothetical protein CLOBOL_04658 [Clostridium bolteae ATCC BAA-613] gi|158437201|gb|EDP14966.1| hypothetical protein CLOBOL_04658 [Clostridium bolteae ATCC BAA-613] Length = 390 Score = 47.3 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ YP N L E I GG +SE Sbjct: 199 LGCGVNICYPRSNYYLYEAIPFQGG-ILSEF 228 >gi|255012931|ref|ZP_05285057.1| putative DNA processing Smf-like protein [Bacteroides sp. 2_1_7] gi|262382915|ref|ZP_06076052.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B] gi|262295793|gb|EEY83724.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B] Length = 372 Score = 47.3 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YPP +R+ E+ D GG+ ++ P G Sbjct: 175 LAHGLDRIYPPVHRSTAIEMLDRGGLL-TDFPSG 207 >gi|312130376|ref|YP_003997716.1| DNA protecting protein dpra [Leadbetterella byssophila DSM 17132] gi|311906922|gb|ADQ17363.1| DNA protecting protein DprA [Leadbetterella byssophila DSM 17132] Length = 359 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A GL +YP ++ + ++I +N G+ +SE P Sbjct: 173 LANGLHTVYPSVHKKVADQIQEN-GLLVSEQPP 204 >gi|227515156|ref|ZP_03945205.1| DNA processing protein [Lactobacillus fermentum ATCC 14931] gi|227086488|gb|EEI21800.1| DNA processing protein [Lactobacillus fermentum ATCC 14931] Length = 291 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD YP N L ++ D G+ ++E P Sbjct: 168 IGTGLDQTYPRSNGALQAQVADQ-GLLLTEYPL 199 >gi|90961696|ref|YP_535612.1| DNA processing protein [Lactobacillus salivarius UCC118] gi|90820890|gb|ABD99529.1| DNA processing protein [Lactobacillus salivarius UCC118] Length = 286 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN L + + GI +SE G Sbjct: 169 IGTGLDRTYPRENFELQANM-EKEGIVLSEYALG 201 >gi|260662113|ref|ZP_05863009.1| DNA processing protein [Lactobacillus fermentum 28-3-CHN] gi|260553496|gb|EEX26388.1| DNA processing protein [Lactobacillus fermentum 28-3-CHN] Length = 291 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD YP N L ++ D G+ ++E P Sbjct: 168 IGTGLDQTYPRSNGALQAQVADQ-GLLLTEYPL 199 >gi|149186760|ref|ZP_01865071.1| DNA processing chain A [Erythrobacter sp. SD-21] gi|148829668|gb|EDL48108.1| DNA processing chain A [Erythrobacter sp. SD-21] Length = 372 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D YPP++ L E I G+ I+E G Sbjct: 174 IASGIDIAYPPQHSELQERI-AREGLLIAEQTPG 206 >gi|331090298|ref|ZP_08339182.1| hypothetical protein HMPREF1025_02765 [Lachnospiraceae bacterium 3_1_46FAA] gi|330401433|gb|EGG81018.1| hypothetical protein HMPREF1025_02765 [Lachnospiraceae bacterium 3_1_46FAA] Length = 198 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 8/24 (33%), Positives = 13/24 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNG 24 + G+D YP E+ L +I + G Sbjct: 168 LGCGVDVCYPREHIGLYVDILEQG 191 >gi|126737264|ref|ZP_01752999.1| DNA processing protein DprA, putative [Roseobacter sp. SK209-2-6] gi|126721849|gb|EBA18552.1| DNA processing protein DprA, putative [Roseobacter sp. SK209-2-6] Length = 423 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG D +YP EN L EI G+ +SE P G Sbjct: 180 MAGGCDRIYPTENTELGVEI-ATQGLRLSEQPMG 212 >gi|288801753|ref|ZP_06407195.1| DNA processing protein DprA [Prevotella melaninogenica D18] gi|288335795|gb|EFC74228.1| DNA processing protein DprA [Prevotella melaninogenica D18] Length = 372 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP +R+ ++ GG+ SE Sbjct: 174 LAHGLDDIYPRGHRDTALKMIKQGGLL-SEY 203 >gi|262374666|ref|ZP_06067939.1| DNA protecting protein DprA [Acinetobacter junii SH205] gi|262310456|gb|EEY91547.1| DNA protecting protein DprA [Acinetobacter junii SH205] Length = 375 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GLD +YP +N+ L ++I G I+E Sbjct: 180 GTGLDTVYPTQNKPLAQQI-AQSGAIITEF 208 >gi|301300760|ref|ZP_07206944.1| DNA protecting protein DprA [Lactobacillus salivarius ACS-116-V-Col5a] gi|300851610|gb|EFK79310.1| DNA protecting protein DprA [Lactobacillus salivarius ACS-116-V-Col5a] Length = 286 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN L + + GI +SE G Sbjct: 169 IGTGLDRTYPRENFELQANM-EKEGIVLSEYALG 201 >gi|300214495|gb|ADJ78911.1| DNA processing protein [Lactobacillus salivarius CECT 5713] Length = 286 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN L + + GI +SE G Sbjct: 169 IGTGLDRTYPRENFELQANM-EKEGIVLSEYALG 201 >gi|227890784|ref|ZP_04008589.1| DNA processing protein [Lactobacillus salivarius ATCC 11741] gi|227867193|gb|EEJ74614.1| DNA processing protein [Lactobacillus salivarius ATCC 11741] Length = 286 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN L + + GI +SE G Sbjct: 169 IGTGLDRTYPRENFELQANM-EKEGIVLSEYALG 201 >gi|188993327|ref|YP_001905337.1| DNA processing chain A [Xanthomonas campestris pv. campestris str. B100] gi|167735087|emb|CAP53299.1| DNA processing chain A [Xanthomonas campestris pv. campestris] Length = 378 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D YP ++ +L + I G +SE G Sbjct: 175 GTGPDVAYPVQHHSLRDRIAAR-GAVVSEYLPG 206 >gi|332830027|gb|EGK02655.1| hypothetical protein HMPREF9455_00905 [Dysgonomonas gadei ATCC BAA-286] Length = 373 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +A GLD +YP +R E+ + GG+ S+ P Sbjct: 178 LAHGLDMIYPAVHRQTAIEMLEKGGLL-SDFP 208 >gi|269955977|ref|YP_003325766.1| DNA protecting protein DprA [Xylanimonas cellulosilytica DSM 15894] gi|269304658|gb|ACZ30208.1| DNA protecting protein DprA [Xylanimonas cellulosilytica DSM 15894] Length = 402 Score = 47.3 bits (113), Expect = 7e-04, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D YP N LL + + G ++E+P G Sbjct: 195 MAGGVDRFYPQGNHELLRRVAET-GTVVAEVPPG 227 >gi|226329517|ref|ZP_03805035.1| hypothetical protein PROPEN_03426 [Proteus penneri ATCC 35198] gi|225202703|gb|EEG85057.1| hypothetical protein PROPEN_03426 [Proteus penneri ATCC 35198] Length = 381 Score = 47.3 bits (113), Expect = 8e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE-IPF 33 + GL+ +YP +R L +I ++ G+ ISE +P Sbjct: 167 LGSGLEQIYPSFHRTLATQIKES-GLIISEHLPM 199 >gi|289664811|ref|ZP_06486392.1| DNA processing chain A [Xanthomonas campestris pv. vasculorum NCPPB702] Length = 254 Score = 47.3 bits (113), Expect = 8e-04, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D YP ++ L + I + G +SE G Sbjct: 48 GTGTDVTYPERHQGLRDRIAEC-GAVVSEYLPG 79 >gi|328885346|emb|CCA58585.1| Nucleotide binding protein Smf [Streptomyces venezuelae ATCC 10712] Length = 426 Score = 47.3 bits (113), Expect = 8e-04, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G+D YP + L+ + + G+ + E+P Sbjct: 221 LACGVDTPYPRGHDQLIRRVAEQ-GLVVGELPP 252 >gi|296327478|ref|ZP_06870024.1| DNA protecting protein DprA [Fusobacterium nucleatum subsp. nucleatum ATCC 23726] gi|296155304|gb|EFG96075.1| DNA protecting protein DprA [Fusobacterium nucleatum subsp. nucleatum ATCC 23726] Length = 308 Score = 47.3 bits (113), Expect = 8e-04, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP EN L E I +N G +SE+ Sbjct: 187 LGQGLNLEIYPRENIKLAEMILENNGFLLSEL 218 >gi|256844920|ref|ZP_05550378.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_36A2] gi|256718479|gb|EEU32034.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_36A2] Length = 304 Score = 47.3 bits (113), Expect = 8e-04, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ +YP EN L E I +N G +SE+ Sbjct: 183 LGQGLNLEIYPRENIKLAEMILENNGFLLSEL 214 >gi|237751535|ref|ZP_04582015.1| DNA processing chain A [Helicobacter bilis ATCC 43879] gi|229372901|gb|EEO23292.1| DNA processing chain A [Helicobacter bilis ATCC 43879] Length = 269 Score = 47.3 bits (113), Expect = 8e-04, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP EN L+ G+ +SE Sbjct: 99 LPCGIDAIYPKENATLINN-LAQNGLVLSEY 128 >gi|28210944|ref|NP_781888.1| SMF protein, putative DNA processing chain A [Clostridium tetani E88] gi|28203383|gb|AAO35825.1| SMF protein, putative DNA processing chain A [Clostridium tetani E88] Length = 361 Score = 47.3 bits (113), Expect = 8e-04, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N+N+ ++ + G ISE G Sbjct: 171 LGSGIDVIYPYINKNIYYKLLEE-GSVISEFLPG 203 >gi|288905298|ref|YP_003430520.1| DNA processing protein, Smf family [Streptococcus gallolyticus UCN34] gi|306831377|ref|ZP_07464536.1| Smf family DNA processing protein [Streptococcus gallolyticus subsp. gallolyticus TX20005] gi|288732024|emb|CBI13589.1| putative DNA processing protein, Smf family [Streptococcus gallolyticus UCN34] gi|304426437|gb|EFM29550.1| Smf family DNA processing protein [Streptococcus gallolyticus subsp. gallolyticus TX20005] Length = 215 Score = 47.3 bits (113), Expect = 8e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP EN+ L + N + +SE Sbjct: 163 IGCGLDVYYPKENKQLQAYMAKNH-LVLSEY 192 >gi|310827801|ref|YP_003960158.1| hypothetical protein ELI_2212 [Eubacterium limosum KIST612] gi|308739535|gb|ADO37195.1| hypothetical protein ELI_2212 [Eubacterium limosum KIST612] Length = 296 Score = 47.3 bits (113), Expect = 8e-04, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 14/33 (42%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + L + P EN L E I GG ISE Sbjct: 175 LPSNLMTITPRENMELAERIIAGGGCIISEFSP 207 >gi|302344838|ref|YP_003813191.1| DNA protecting protein DprA [Prevotella melaninogenica ATCC 25845] gi|302149494|gb|ADK95756.1| DNA protecting protein DprA [Prevotella melaninogenica ATCC 25845] Length = 353 Score = 47.3 bits (113), Expect = 8e-04, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP +R+ ++ GG+ SE Sbjct: 155 LAHGLDDIYPRGHRDTALKMIKQGGLL-SEY 184 >gi|81428603|ref|YP_395603.1| DprA/SMF family DNA processing protein [Lactobacillus sakei subsp. sakei 23K] gi|78610245|emb|CAI55294.1| Putative DNA processing protein, DprA/SMF family [Lactobacillus sakei subsp. sakei 23K] Length = 288 Score = 47.3 bits (113), Expect = 8e-04, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G++C YPP+N +L +++ G+ +SE G Sbjct: 169 IGTGINCSYPPQNEHL-QQVVAEKGLLLSEYALG 201 >gi|315226787|ref|ZP_07868575.1| DNA protecting protein DprA [Parascardovia denticolens DSM 10105] gi|315120919|gb|EFT84051.1| DNA protecting protein DprA [Parascardovia denticolens DSM 10105] Length = 197 Score = 46.9 bits (112), Expect = 9e-04, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 18/32 (56%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL+ P N L ++I GG ISE+P Sbjct: 72 AGGLNNCGPLSNSRLFDQIRLRGGALISELPP 103 >gi|320527485|ref|ZP_08028666.1| putative DNA protecting protein DprA [Solobacterium moorei F0204] gi|320132198|gb|EFW24747.1| putative DNA protecting protein DprA [Solobacterium moorei F0204] Length = 251 Score = 46.9 bits (112), Expect = 9e-04, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN +L +++ + +SE P G Sbjct: 131 IGSGLDIHYPYENEHLYQQLQKTD-LILSEYPSG 163 >gi|291297568|ref|YP_003508846.1| DNA protecting protein DprA [Stackebrandtia nassauensis DSM 44728] gi|290566788|gb|ADD39753.1| DNA protecting protein DprA [Stackebrandtia nassauensis DSM 44728] Length = 307 Score = 46.9 bits (112), Expect = 9e-04, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G+D YP N L EI G+ +SE Sbjct: 172 IANGVDQCYPRSNLGLQAEIT-QTGLILSEY 201 >gi|322373049|ref|ZP_08047585.1| DNA protecting protein DprA [Streptococcus sp. C150] gi|321278091|gb|EFX55160.1| DNA protecting protein DprA [Streptococcus sp. C150] Length = 279 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN++L + + N + +SE G Sbjct: 163 IGTGLDVYYPKENKSLQDYMSKNH-LVLSEYGPG 195 >gi|312866628|ref|ZP_07726843.1| DNA protecting protein DprA [Streptococcus parasanguinis F0405] gi|311097927|gb|EFQ56156.1| DNA protecting protein DprA [Streptococcus parasanguinis F0405] Length = 284 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + ++ + +SE G Sbjct: 165 IGTGLDVFYPKSNQRLQAHMGEHH-LILSEYGPG 197 >gi|103486697|ref|YP_616258.1| DNA processing protein DprA, putative [Sphingopyxis alaskensis RB2256] gi|98976774|gb|ABF52925.1| DNA processing protein DprA, putative [Sphingopyxis alaskensis RB2256] Length = 360 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +PPEN L E I + + I+E P G Sbjct: 165 IASGIDIAFPPENAALQERIAADQ-LLIAEQPPG 197 >gi|294787610|ref|ZP_06752863.1| DNA protecting protein DprA [Parascardovia denticolens F0305] gi|294484966|gb|EFG32601.1| DNA protecting protein DprA [Parascardovia denticolens F0305] Length = 206 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 18/32 (56%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL+ P N L ++I GG ISE+P Sbjct: 81 AGGLNNCGPLSNSRLFDQIRLRGGALISELPP 112 >gi|227538460|ref|ZP_03968509.1| SMF family DNA processing protein [Sphingobacterium spiritivorum ATCC 33300] gi|227241646|gb|EEI91661.1| SMF family DNA processing protein [Sphingobacterium spiritivorum ATCC 33300] Length = 370 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD +YP +R + E+ GG+ +E G Sbjct: 171 MGHGLDRIYPAAHRAIAAEMLSCGGLL-TEFTSG 203 >gi|190576009|ref|YP_001973854.1| putative Smf protein [Stenotrophomonas maltophilia K279a] gi|190013931|emb|CAQ47571.1| putative Smf protein [Stenotrophomonas maltophilia K279a] Length = 375 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP ++ L I G +SE G Sbjct: 171 IGTGPDRAYPDSHQRLQGRIAAE-GAVLSEYLPG 203 >gi|312862965|ref|ZP_07723205.1| DNA protecting protein DprA [Streptococcus vestibularis F0396] gi|322516894|ref|ZP_08069792.1| DNA protecting protein DprA [Streptococcus vestibularis ATCC 49124] gi|311101825|gb|EFQ60028.1| DNA protecting protein DprA [Streptococcus vestibularis F0396] gi|322124550|gb|EFX96029.1| DNA protecting protein DprA [Streptococcus vestibularis ATCC 49124] Length = 279 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN+ L + + N + ++E G Sbjct: 163 IGTGLDVYYPKENKALQDYMAKNH-LVLTEYGPG 195 >gi|55822858|ref|YP_141299.1| Smf family DNA processing protein [Streptococcus thermophilus CNRZ1066] gi|55738843|gb|AAV62484.1| DNA processing protein, Smf family [Streptococcus thermophilus CNRZ1066] Length = 279 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN+ L + + N + ++E G Sbjct: 163 IGTGLDVYYPKENKALQDYMAKNH-LVLTEYGPG 195 >gi|55820936|ref|YP_139378.1| Smf family DNA processing protein [Streptococcus thermophilus LMG 18311] gi|116627724|ref|YP_820343.1| DNA processing protein, Smf family [Streptococcus thermophilus LMD-9] gi|55736921|gb|AAV60563.1| DNA processing protein, Smf family [Streptococcus thermophilus LMG 18311] gi|116101001|gb|ABJ66147.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Streptococcus thermophilus LMD-9] gi|312278272|gb|ADQ62929.1| DprA/SMF protein, putative DNA processing factor [Streptococcus thermophilus ND03] Length = 279 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN+ L + + N + ++E G Sbjct: 163 IGTGLDVYYPKENKALQDYMAKNH-LVLTEYGPG 195 >gi|325978283|ref|YP_004287999.1| DNA-processing chain A, smf familiy [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069] gi|325178211|emb|CBZ48255.1| DNA-processing chain A, smf familiy [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069] Length = 280 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP EN+ L + N + +SE Sbjct: 163 IGCGLDVYYPKENKQLQAYMAKNH-LVLSEY 192 >gi|313676995|ref|YP_004054991.1| DNA protecting protein dpra [Marivirga tractuosa DSM 4126] gi|312943693|gb|ADR22883.1| DNA protecting protein DprA [Marivirga tractuosa DSM 4126] Length = 368 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G+D +YP +++ E+ +GG ISE FG Sbjct: 174 MGSGIDVIYPSAHQSTAMEMQKSGG-IISEQSFG 206 >gi|299822636|ref|ZP_07054522.1| smf family protein [Listeria grayi DSM 20601] gi|299816165|gb|EFI83403.1| smf family protein [Listeria grayi DSM 20601] Length = 322 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 8/30 (26%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL +YP ++ L I G+ ++E Sbjct: 201 LGSGLANIYPKQHLELARRIAA-KGLLLTE 229 >gi|325963703|ref|YP_004241609.1| DNA protecting protein DprA [Arthrobacter phenanthrenivorans Sphe3] gi|323469790|gb|ADX73475.1| DNA protecting protein DprA [Arthrobacter phenanthrenivorans Sphe3] Length = 400 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D YP N +LL + N G ++E+P G Sbjct: 203 MAGGVDRFYPSGNEDLLRAVC-NQGAVLAEVPPG 235 >gi|149183957|ref|ZP_01862336.1| hypothetical protein BSG1_20150 [Bacillus sp. SG-1] gi|148848335|gb|EDL62606.1| hypothetical protein BSG1_20150 [Bacillus sp. SG-1] Length = 191 Score = 46.9 bits (112), Expect = 0.001, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG +YP NR+L + + ISE P Sbjct: 68 IGGGFRHIYPASNRDLANFMAKKH-LLISEYPP 99 >gi|33866509|ref|NP_898068.1| Smf family DNA processing protein [Synechococcus sp. WH 8102] gi|33633287|emb|CAE08492.1| putative DNA processing protein (Smf family) [Synechococcus sp. WH 8102] Length = 354 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + LD +YP ++ L EE G+ +SE G Sbjct: 174 LGTPLDRVYPRHHQALQEE-VARNGLLLSERQPG 206 >gi|291166170|gb|EFE28216.1| Smf family protein [Filifactor alocis ATCC 35896] Length = 360 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Query: 1 MAGGLDC--LYPPENRNLLEEIWDNGGIAISEI 31 + L+ +YP N +L I +NGG+ +SE Sbjct: 167 LGSSLNEKSIYPKTNLSLYHRILNNGGLILSEY 199 >gi|296127436|ref|YP_003634688.1| DNA protecting protein DprA [Brachyspira murdochii DSM 12563] gi|296019252|gb|ADG72489.1| DNA protecting protein DprA [Brachyspira murdochii DSM 12563] Length = 426 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP EN + ++ + GI +SE G Sbjct: 178 LGNGIDTVYPSENLKIYNKLIE-KGIIVSEFEIG 210 >gi|299536761|ref|ZP_07050069.1| protein smf [Lysinibacillus fusiformis ZC1] gi|298727773|gb|EFI68340.1| protein smf [Lysinibacillus fusiformis ZC1] Length = 298 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G + LYP ENR L ++ ++ + ++E P Sbjct: 176 LGHGFNYLYPSENRILATQMAEHQ-LLMTEYPP 207 >gi|300774691|ref|ZP_07084554.1| SMF family DNA processing protein [Chryseobacterium gleum ATCC 35910] gi|300506506|gb|EFK37641.1| SMF family DNA processing protein [Chryseobacterium gleum ATCC 35910] Length = 369 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G LYP +NR L E+I + GG I+E Sbjct: 173 LAHGFQYLYPAKNRRLSEKILNEGGALITEF 203 >gi|296876489|ref|ZP_06900540.1| DNA protecting protein DprA [Streptococcus parasanguinis ATCC 15912] gi|296432482|gb|EFH18278.1| DNA protecting protein DprA [Streptococcus parasanguinis ATCC 15912] Length = 282 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + ++ + +SE G Sbjct: 163 IGTGLDVFYPKSNQRLQAHMGEHH-LILSEYGPG 195 >gi|220912959|ref|YP_002488268.1| DNA protecting protein DprA [Arthrobacter chlorophenolicus A6] gi|219859837|gb|ACL40179.1| DNA protecting protein DprA [Arthrobacter chlorophenolicus A6] Length = 402 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D YP N +LL + N G ++E+P G Sbjct: 205 MAGGVDRFYPSGNEDLLRAVC-NQGAVLAEVPPG 237 >gi|24379441|ref|NP_721396.1| putative DNA processing Smf protein [Streptococcus mutans UA159] gi|24377375|gb|AAN58702.1|AE014939_9 putative DNA processing Smf protein [Streptococcus mutans UA159] Length = 280 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP ENR L + I N + +SE Sbjct: 163 IGTGLDVHYPKENRRLQDYIAKNH-LLLSEY 192 >gi|189464639|ref|ZP_03013424.1| hypothetical protein BACINT_00982 [Bacteroides intestinalis DSM 17393] gi|189436913|gb|EDV05898.1| hypothetical protein BACINT_00982 [Bacteroides intestinalis DSM 17393] Length = 372 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP +R ++ +NGG+ +E Sbjct: 176 LAHGLDRIYPYVHRKTAIDMLENGGLL-TEF 205 >gi|270295207|ref|ZP_06201408.1| conserved hypothetical protein [Bacteroides sp. D20] gi|270274454|gb|EFA20315.1| conserved hypothetical protein [Bacteroides sp. D20] Length = 372 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ GG+ +E G Sbjct: 176 LAHGLDRIYPYVHRKTAIDMLAQGGLL-TEFLTG 208 >gi|262273078|ref|ZP_06050895.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Grimontia hollisae CIP 101886] gi|262222834|gb|EEY74142.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Grimontia hollisae CIP 101886] Length = 365 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP +R L ++ D+ G +SE+ Sbjct: 170 LGSGLDKVYPASHRQLAGDVRDS-GALVSEL 199 >gi|257869681|ref|ZP_05649334.1| SMF DNA recombination-mediator protein A [Enterococcus gallinarum EG2] gi|257803845|gb|EEV32667.1| SMF DNA recombination-mediator protein A [Enterococcus gallinarum EG2] Length = 290 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ++ L +I + +SE G Sbjct: 174 IGTGLDQCYPKSSQRLYSQI-KQEHLLVSEYSRG 206 >gi|227893504|ref|ZP_04011309.1| DNA processing protein chain A [Lactobacillus ultunensis DSM 16047] gi|227864674|gb|EEJ72095.1| DNA processing protein chain A [Lactobacillus ultunensis DSM 16047] Length = 277 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP +N +L EI G+ ISE Sbjct: 167 IGNGLNHSYPRQNFDLQREII-QNGVVISEY 196 >gi|160891697|ref|ZP_02072700.1| hypothetical protein BACUNI_04152 [Bacteroides uniformis ATCC 8492] gi|156859104|gb|EDO52535.1| hypothetical protein BACUNI_04152 [Bacteroides uniformis ATCC 8492] Length = 372 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ GG+ +E G Sbjct: 176 LAHGLDRIYPYVHRKTAIDMLAQGGLL-TEFLTG 208 >gi|293402456|ref|ZP_06646592.1| Smf family protein [Erysipelotrichaceae bacterium 5_2_54FAA] gi|291304119|gb|EFE45372.1| Smf family protein [Erysipelotrichaceae bacterium 5_2_54FAA] Length = 392 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + ++ YP ENRNL EI + G+ +S+ P Sbjct: 253 IGTPINQYYPKENRNLQMEI-EKKGLVVSQFPP 284 >gi|257867806|ref|ZP_05647459.1| DNA processing SMF protein [Enterococcus casseliflavus EC30] gi|257874133|ref|ZP_05653786.1| DNA processing SMF protein [Enterococcus casseliflavus EC10] gi|257801889|gb|EEV30792.1| DNA processing SMF protein [Enterococcus casseliflavus EC30] gi|257808297|gb|EEV37119.1| DNA processing SMF protein [Enterococcus casseliflavus EC10] Length = 292 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +A G+D YP + L ++I + +SE P Sbjct: 174 IASGMDHCYPSSSYRLFQQIRQEH-LVLSEYP 204 >gi|257876698|ref|ZP_05656351.1| DNA processing SMF protein [Enterococcus casseliflavus EC20] gi|257810864|gb|EEV39684.1| DNA processing SMF protein [Enterococcus casseliflavus EC20] Length = 292 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +A G+D YP + L ++I + +SE P Sbjct: 174 IASGMDHCYPSSSYRLFQQIRQEH-LVLSEYP 204 >gi|168700980|ref|ZP_02733257.1| DNA protecting protein DprA [Gemmata obscuriglobus UQM 2246] Length = 396 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGL +YPPE+ +L E G ++E P Sbjct: 172 LAGGLSSIYPPEHADLAAE-VAGNGCLVTETPM 203 >gi|317478243|ref|ZP_07937408.1| DNA recombination-mediator protein A [Bacteroides sp. 4_1_36] gi|316905550|gb|EFV27339.1| DNA recombination-mediator protein A [Bacteroides sp. 4_1_36] Length = 372 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ GG+ +E G Sbjct: 176 LAHGLDRIYPYVHRKTAIDMLAQGGLL-TEFLTG 208 >gi|332670025|ref|YP_004453033.1| SMF family protein [Cellulomonas fimi ATCC 484] gi|332339063|gb|AEE45646.1| SMF family protein [Cellulomonas fimi ATCC 484] Length = 412 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D YP N ++ + D+GG +SE+P G Sbjct: 190 LAGGVDRAYPVGNARMIAAVMDDGGTVVSEVPVG 223 >gi|303229497|ref|ZP_07316286.1| putative DNA protecting protein DprA [Veillonella atypica ACS-134-V-Col7a] gi|302515852|gb|EFL57805.1| putative DNA protecting protein DprA [Veillonella atypica ACS-134-V-Col7a] Length = 312 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + L+ ++P +R++ E I GG+ I+E Sbjct: 163 LPSPLNSIFPAAHRDMAERIVATGGLVITEY 193 >gi|291296459|ref|YP_003507857.1| transcriptional regulator TrmB [Meiothermus ruber DSM 1279] gi|290471418|gb|ADD28837.1| transcriptional regulator, TrmB [Meiothermus ruber DSM 1279] Length = 337 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + +D YP +NR L E + +SE P G Sbjct: 158 LGSAIDHFYPAQNRALAERMS-----VLSEFPLG 186 >gi|84685604|ref|ZP_01013501.1| DNA processing protein DprA, putative [Maritimibacter alkaliphilus HTCC2654] gi|84666270|gb|EAQ12743.1| DNA processing protein DprA, putative [Rhodobacterales bacterium HTCC2654] Length = 375 Score = 46.5 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MAGG+D +YP EN L EEI G+ +SE P Sbjct: 159 MAGGVDVIYPSENAVLGEEI-GRDGLRLSEAPM 190 >gi|294500949|ref|YP_003564649.1| DNA protecting protein DprA [Bacillus megaterium QM B1551] gi|294350886|gb|ADE71215.1| DNA protecting protein DprA [Bacillus megaterium QM B1551] Length = 293 Score = 46.1 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG +YP N+NL EI + + +SE Sbjct: 174 LGGGFYNIYPRGNQNLAREIAQHH-LLLSEYAP 205 >gi|55980090|ref|YP_143387.1| competence protein DprA [Thermus thermophilus HB8] gi|55771503|dbj|BAD69944.1| competence protein DprA (SMF protein (DNA processing chain A)) [Thermus thermophilus HB8] Length = 334 Score = 46.1 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 5/34 (14%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + LD +YPPENR L + + +SE PFG Sbjct: 154 LGSALDRVYPPENRPLAQRMD-----LLSEFPFG 182 >gi|254524568|ref|ZP_05136623.1| DNA processing chain A [Stenotrophomonas sp. SKA14] gi|219722159|gb|EED40684.1| DNA processing chain A [Stenotrophomonas sp. SKA14] Length = 375 Score = 46.1 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D YP + L I G +SE G Sbjct: 171 IGTGPDRAYPDSHARLQARI-ATEGAVLSEYLPG 203 >gi|300770008|ref|ZP_07079887.1| SMF family DNA processing protein [Sphingobacterium spiritivorum ATCC 33861] gi|300762484|gb|EFK59301.1| SMF family DNA processing protein [Sphingobacterium spiritivorum ATCC 33861] Length = 370 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M GLD +YP +R + E+ GG+ +E G Sbjct: 171 MGHGLDRIYPAAHRTIAAEMLSCGGLL-TEFTSG 203 >gi|46200175|ref|YP_005842.1| competence protein dprA [Thermus thermophilus HB27] gi|17226372|gb|AAL37758.1|AF439555_1 competence protein DprA [Thermus thermophilus HB27] gi|46197803|gb|AAS82215.1| competence protein dprA [Thermus thermophilus HB27] Length = 334 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 5/34 (14%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + LD +YPPENR L + + +SE PFG Sbjct: 154 LGSALDRVYPPENRPLAQRMD-----LLSEFPFG 182 >gi|297243647|ref|ZP_06927578.1| DNA-uptake Rossmann fold nucleotide-binding protein [Gardnerella vaginalis AMD] gi|296888398|gb|EFH27139.1| DNA-uptake Rossmann fold nucleotide-binding protein [Gardnerella vaginalis AMD] Length = 514 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 18/32 (56%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL+ + P N L E+I GG ISE+ Sbjct: 298 AGGLNHMGPRCNYQLFEQIIAKGGACISELCP 329 >gi|294792454|ref|ZP_06757601.1| DNA processing protein (Smf family) [Veillonella sp. 6_1_27] gi|294456353|gb|EFG24716.1| DNA processing protein (Smf family) [Veillonella sp. 6_1_27] Length = 331 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + L+ + P ++R++ +I + GG+ ISE Sbjct: 179 LPSPLNAISPADHRDMAHQIIEKGGLVISEY 209 >gi|294794254|ref|ZP_06759390.1| DNA processing protein (Smf family) [Veillonella sp. 3_1_44] gi|294454584|gb|EFG22957.1| DNA processing protein (Smf family) [Veillonella sp. 3_1_44] Length = 331 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + L+ + P ++R++ +I + GG+ ISE Sbjct: 179 LPSPLNAISPADHRDMAHQIIEKGGLVISEY 209 >gi|269798864|ref|YP_003312764.1| DNA uptake Rossmann fold nucleotide-binding protein [Veillonella parvula DSM 2008] gi|269095493|gb|ACZ25484.1| Rossmann fold nucleotide-binding protein involved in DNA uptake-like protein [Veillonella parvula DSM 2008] Length = 315 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + L+ + P ++R++ +I + GG+ ISE Sbjct: 163 LPSPLNAISPADHRDMAHQIIEKGGLVISEY 193 >gi|332185639|ref|ZP_08387387.1| DNA protecting protein DprA [Sphingomonas sp. S17] gi|332014617|gb|EGI56674.1| DNA protecting protein DprA [Sphingomonas sp. S17] Length = 359 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A G+D +PPEN L EE G+ I+E P G Sbjct: 164 IASGIDIAFPPENARLQEE-VATRGLLIAEQPPG 196 >gi|319937632|ref|ZP_08012036.1| hypothetical protein HMPREF9488_02872 [Coprobacillus sp. 29_1] gi|319807274|gb|EFW03886.1| hypothetical protein HMPREF9488_02872 [Coprobacillus sp. 29_1] Length = 254 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ YP ENR L +E+ + + +SE PF Sbjct: 138 LGTGIEYCYPRENRILYDELKLHH-LIMSEYPF 169 >gi|138894731|ref|YP_001125184.1| Smf family DNA processing protein [Geobacillus thermodenitrificans NG80-2] gi|134266244|gb|ABO66439.1| DNA processing protein (Smf family) [Geobacillus thermodenitrificans NG80-2] Length = 293 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGLD +YP E+R+ +++ + + ++E P Sbjct: 175 IAGGLDHIYPKEHRSFAQQLMNEQ-LVVAEHPP 206 >gi|297565482|ref|YP_003684454.1| DNA protecting protein DprA [Meiothermus silvanus DSM 9946] gi|296849931|gb|ADH62946.1| DNA protecting protein DprA [Meiothermus silvanus DSM 9946] Length = 338 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 5/34 (14%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + +D +YPP NR L E + +SE P G Sbjct: 158 LGSAVDQVYPPANRGLAERMN-----LLSEFPLG 186 >gi|312865084|ref|ZP_07725312.1| DNA protecting protein DprA [Streptococcus downei F0415] gi|311099195|gb|EFQ57411.1| DNA protecting protein DprA [Streptococcus downei F0415] Length = 279 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP ENR+L E + + + +SE G Sbjct: 164 GTGLDVFYPKENRDLQEYLAKHH-LLLSEYEAG 195 >gi|311113475|ref|YP_003984697.1| DNA protecting protein DprA [Rothia dentocariosa ATCC 17931] gi|310944969|gb|ADP41263.1| DNA protecting protein DprA [Rothia dentocariosa ATCC 17931] Length = 494 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGGLD YP +N +L I + G+ +SE+ G Sbjct: 290 MAGGLDHFYPVQNSEILHRIVEE-GLILSEVSIG 322 >gi|222153075|ref|YP_002562252.1| SMF family protein [Streptococcus uberis 0140J] gi|222113888|emb|CAR42055.1| SMF family protein [Streptococcus uberis 0140J] Length = 281 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G + +YP ENR L + I + + ISE Sbjct: 165 IGSGFNNIYPKENRRLQDYIGQHH-LLISEYAP 196 >gi|324998455|ref|ZP_08119567.1| DNA protecting protein DprA [Pseudonocardia sp. P1] Length = 314 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +P + NLL+ I +N G+ +S P G Sbjct: 195 LPCGIDRAHPAAHVNLLDRIAEN-GLVVSAQPLG 227 >gi|330997315|ref|ZP_08321168.1| DNA protecting protein DprA [Paraprevotella xylaniphila YIT 11841] gi|329571110|gb|EGG52817.1| DNA protecting protein DprA [Paraprevotella xylaniphila YIT 11841] Length = 373 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP +R+ ++ GG+ +E Sbjct: 177 LAHGLDQIYPRLHRDTAIQMMSQGGLL-TEF 206 >gi|158424472|ref|YP_001525764.1| SMF protein [Azorhizobium caulinodans ORS 571] gi|158331361|dbj|BAF88846.1| SMF protein [Azorhizobium caulinodans ORS 571] Length = 374 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL YP EN L++ + + G +SE+P G Sbjct: 174 AGGLSRPYPAENVPLIQAVAE-KGAVVSEMPLG 205 >gi|83649030|ref|YP_437465.1| DNA uptake Rossmann fold nucleotide-binding protein [Hahella chejuensis KCTC 2396] gi|83637073|gb|ABC33040.1| predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Hahella chejuensis KCTC 2396] Length = 233 Score = 46.1 bits (110), Expect = 0.002, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GL P +N L + I ++ G+ +SE P G Sbjct: 103 LASGLHIATPRQNAGLGDAILESDGLWVSEHPEG 136 >gi|126654065|ref|ZP_01725891.1| DNA processing protein, Smf family [Bacillus sp. B14905] gi|126589445|gb|EAZ83592.1| DNA processing protein, Smf family [Bacillus sp. B14905] Length = 298 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G + LYP EN+ L +E+ + + I+E P Sbjct: 176 LGHGFNYLYPKENQILAKEMANQQ-LLITEYPP 207 >gi|16800381|ref|NP_470649.1| hypothetical protein lin1313 [Listeria innocua Clip11262] gi|16413786|emb|CAC96544.1| lin1313 [Listeria innocua Clip11262] Length = 286 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP N L +E+ G+ +SE Sbjct: 166 LGSGVNKIYPRTNELLAKEVI-TQGLLLSEY 195 >gi|94986555|ref|YP_594488.1| DNA uptake Rossmann fold nucleotide-binding protein [Lawsonia intracellularis PHE/MN1-00] gi|94730804|emb|CAJ54166.1| predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Lawsonia intracellularis PHE/MN1-00] Length = 421 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G++ YP +N ++ E+ N G+ ISE G Sbjct: 197 LGSGINISYPRQNSDV-RELLVNKGLLISEYAPG 229 >gi|284006130|emb|CBA71371.1| DNA processing protein [Arsenophonus nasoniae] Length = 376 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ LYP ++ +L +I + G +SE Sbjct: 186 LGSGLNKLYPTQHTSLANKIKE-KGALVSEY 215 >gi|153807025|ref|ZP_01959693.1| hypothetical protein BACCAC_01302 [Bacteroides caccae ATCC 43185] gi|149130145|gb|EDM21355.1| hypothetical protein BACCAC_01302 [Bacteroides caccae ATCC 43185] Length = 374 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ DNGG+ +E G Sbjct: 178 LAHGLDRIYPYVHRKTAIDMLDNGGLL-TEFLTG 210 >gi|270292614|ref|ZP_06198825.1| DprA/SMF protein, putative DNA processing factor [Streptococcus sp. M143] gi|270278593|gb|EFA24439.1| DprA/SMF protein, putative DNA processing factor [Streptococcus sp. M143] Length = 286 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L E I N + +SE G Sbjct: 169 IGTGLDVFYPKANKRLQEYI-GNDHLVLSEYGPG 201 >gi|169827111|ref|YP_001697269.1| protein smf [Lysinibacillus sphaericus C3-41] gi|168991599|gb|ACA39139.1| Protein smf [Lysinibacillus sphaericus C3-41] Length = 298 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G + LYP EN+ L ++ D + I+E P Sbjct: 176 LGHGFNYLYPRENQVLAMDMADQQ-LLITEYPP 207 >gi|300741393|ref|ZP_07071414.1| DNA protecting protein DprA [Rothia dentocariosa M567] gi|300380578|gb|EFJ77140.1| DNA protecting protein DprA [Rothia dentocariosa M567] Length = 422 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGGLD YP +N +L I + G+ +SE+ G Sbjct: 218 MAGGLDHFYPVQNSEILHRIVEE-GLILSEVSIG 250 >gi|290580547|ref|YP_003484939.1| putative DNA processing Smf protein [Streptococcus mutans NN2025] gi|254997446|dbj|BAH88047.1| putative DNA processing Smf protein [Streptococcus mutans NN2025] Length = 180 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP ENR L + I N + +SE Sbjct: 63 IGTGLDVHYPKENRRLQDYIAKNH-LLLSEY 92 >gi|189016704|ref|YP_001711743.1| putative DNA processing SMF-family protein [Clavibacter michiganensis subsp. sepedonicus] gi|167728875|emb|CAQ03256.1| putative DNA processing SMF-family protein [Clavibacter michiganensis subsp. sepedonicus] Length = 317 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D YP + L E++ + G ++E P Sbjct: 200 SGVDVTYPHAHAELFEDVIET-GAVVTERPP 229 >gi|328950082|ref|YP_004367417.1| DNA protecting protein DprA [Marinithermus hydrothermalis DSM 14884] gi|328450406|gb|AEB11307.1| DNA protecting protein DprA [Marinithermus hydrothermalis DSM 14884] Length = 321 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 5/32 (15%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN+ L E + +SE+PFG Sbjct: 143 SGLDRIYPRENQALAERVT-----LVSELPFG 169 >gi|317474750|ref|ZP_07934024.1| DNA recombination-mediator protein A [Bacteroides eggerthii 1_2_48FAA] gi|316909431|gb|EFV31111.1| DNA recombination-mediator protein A [Bacteroides eggerthii 1_2_48FAA] Length = 372 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP +R ++ NGG+ +E Sbjct: 176 LAHGLDRIYPSLHRKTAVDMLANGGLL-TEF 205 >gi|299144970|ref|ZP_07038038.1| putative DNA processing protein DprA [Bacteroides sp. 3_1_23] gi|298515461|gb|EFI39342.1| putative DNA processing protein DprA [Bacteroides sp. 3_1_23] Length = 374 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ + GG+ +E G Sbjct: 178 LAHGLDRIYPYVHRKTAIDMLEKGGLL-TEFLSG 210 >gi|218282240|ref|ZP_03488539.1| hypothetical protein EUBIFOR_01121 [Eubacterium biforme DSM 3989] gi|218216778|gb|EEC90316.1| hypothetical protein EUBIFOR_01121 [Eubacterium biforme DSM 3989] Length = 336 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + ++ YP EN++L +I + G+ +S+ P Sbjct: 199 IGTPINQYYPKENKDLQIQI-EKNGLVVSQFPP 230 >gi|168210690|ref|ZP_02636315.1| DNA protecting protein DprA [Clostridium perfringens B str. ATCC 3626] gi|170711272|gb|EDT23454.1| DNA protecting protein DprA [Clostridium perfringens B str. ATCC 3626] Length = 211 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G++ YP NR L ++I N G ISE Sbjct: 21 GCGINLDYPVYNRELYKKIIKN-GCIISEFFP 51 >gi|260172928|ref|ZP_05759340.1| Smf protein DNA processing chain A [Bacteroides sp. D2] gi|315921211|ref|ZP_07917451.1| conserved hypothetical protein [Bacteroides sp. D2] gi|313695086|gb|EFS31921.1| conserved hypothetical protein [Bacteroides sp. D2] Length = 374 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ + GG+ +E G Sbjct: 178 LAHGLDRIYPYVHRKTAIDMLEKGGLL-TEFLSG 210 >gi|168207946|ref|ZP_02633951.1| DNA protecting protein DprA [Clostridium perfringens E str. JGS1987] gi|170660755|gb|EDT13438.1| DNA protecting protein DprA [Clostridium perfringens E str. JGS1987] Length = 360 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G++ YP NR L ++I N G ISE Sbjct: 170 GCGINLDYPVYNRELYKKIIKN-GCIISEFFP 200 >gi|169342679|ref|ZP_02863720.1| DNA protecting protein DprA [Clostridium perfringens C str. JGS1495] gi|169299185|gb|EDS81255.1| DNA protecting protein DprA [Clostridium perfringens C str. JGS1495] Length = 360 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G++ YP NR L ++I N G ISE Sbjct: 170 GCGINLDYPVYNRELYKKIIKN-GCIISEFFP 200 >gi|110803784|ref|YP_698990.1| DNA protecting protein DprA [Clostridium perfringens SM101] gi|110684285|gb|ABG87655.1| DNA protecting protein DprA [Clostridium perfringens SM101] Length = 360 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G++ YP NR L ++I N G ISE Sbjct: 170 GCGINLDYPVYNRELYKKIIKN-GCIISEFFP 200 >gi|218131616|ref|ZP_03460420.1| hypothetical protein BACEGG_03236 [Bacteroides eggerthii DSM 20697] gi|217985919|gb|EEC52258.1| hypothetical protein BACEGG_03236 [Bacteroides eggerthii DSM 20697] Length = 372 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP +R ++ NGG+ +E Sbjct: 176 LAHGLDRIYPSLHRKTAVDMLANGGLL-TEF 205 >gi|306829633|ref|ZP_07462823.1| DNA protecting protein DprA [Streptococcus mitis ATCC 6249] gi|304428719|gb|EFM31809.1| DNA protecting protein DprA [Streptococcus mitis ATCC 6249] Length = 286 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 169 IGTGLDVFYPRANKRLQDYI-GNHHLVLSEYGPG 201 >gi|270290223|ref|ZP_06196448.1| DNA processing protein [Pediococcus acidilactici 7_4] gi|304384963|ref|ZP_07367309.1| DNA protecting protein DprA [Pediococcus acidilactici DSM 20284] gi|270281004|gb|EFA26837.1| DNA processing protein [Pediococcus acidilactici 7_4] gi|304329157|gb|EFL96377.1| DNA protecting protein DprA [Pediococcus acidilactici DSM 20284] Length = 289 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP +N L ++ G+ +SE G Sbjct: 170 IGNGLDVTYPKQNAVLQDQ-VQQTGLLLSEYAQG 202 >gi|150398880|ref|YP_001322647.1| SMF family protein [Methanococcus vannielii SB] gi|150011583|gb|ABR54035.1| SMF family protein [Methanococcus vannielii SB] Length = 352 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGL-DCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL D ++P EN L E+I GG +SE+P Sbjct: 204 LGQGLLDPIFPKENMELSEKILKMGGFLVSELPP 237 >gi|322387952|ref|ZP_08061559.1| DNA processing protein DprA [Streptococcus infantis ATCC 700779] gi|321141225|gb|EFX36723.1| DNA processing protein DprA [Streptococcus infantis ATCC 700779] Length = 287 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L E I DN + +SE G Sbjct: 170 IGTGLDAYYPRSNKRLQEYIGDNH-LILSEYGPG 202 >gi|168215353|ref|ZP_02640978.1| DNA protecting protein DprA [Clostridium perfringens CPE str. F4969] gi|170713271|gb|EDT25453.1| DNA protecting protein DprA [Clostridium perfringens CPE str. F4969] Length = 360 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G++ YP NR L ++I N G ISE Sbjct: 170 GCGINLDYPVYNRELYKKIIKN-GCIISEFFP 200 >gi|110799380|ref|YP_696390.1| DNA protecting protein DprA [Clostridium perfringens ATCC 13124] gi|168216990|ref|ZP_02642615.1| DNA protecting protein DprA [Clostridium perfringens NCTC 8239] gi|110674027|gb|ABG83014.1| DNA protecting protein DprA [Clostridium perfringens ATCC 13124] gi|182380904|gb|EDT78383.1| DNA protecting protein DprA [Clostridium perfringens NCTC 8239] Length = 360 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G++ YP NR L ++I N G ISE Sbjct: 170 GCGINLDYPVYNRELYKKIIKN-GCIISEFFP 200 >gi|18310685|ref|NP_562619.1| DNA protecting protein DprA [Clostridium perfringens str. 13] gi|18145366|dbj|BAB81409.1| Smf protein DNA processing chain A [Clostridium perfringens str. 13] Length = 360 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G++ YP NR L ++I N G ISE Sbjct: 170 GCGINLDYPVYNRELYKKIIKN-GCIISEFFP 200 >gi|332201730|gb|EGJ15800.1| DNA protecting protein DprA [Streptococcus pneumoniae GA47368] Length = 286 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 169 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 201 >gi|237721926|ref|ZP_04552407.1| smf protein DNA processing chain A [Bacteroides sp. 2_2_4] gi|229448795|gb|EEO54586.1| smf protein DNA processing chain A [Bacteroides sp. 2_2_4] Length = 374 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ + GG+ +E G Sbjct: 178 LAHGLDRIYPYVHRKTAVDMLEKGGLL-TEFLSG 210 >gi|189460247|ref|ZP_03009032.1| hypothetical protein BACCOP_00884 [Bacteroides coprocola DSM 17136] gi|189433108|gb|EDV02093.1| hypothetical protein BACCOP_00884 [Bacteroides coprocola DSM 17136] Length = 371 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R E+ GG+ +E G Sbjct: 177 LAHGLDRIYPSVHRRTAAEMTQCGGLL-TEFMSG 209 >gi|168484518|ref|ZP_02709470.1| DNA protecting protein DprA [Streptococcus pneumoniae CDC1873-00] gi|172042257|gb|EDT50303.1| DNA protecting protein DprA [Streptococcus pneumoniae CDC1873-00] Length = 282 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 165 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 197 >gi|308173573|ref|YP_003920278.1| DNA processing Smf single strand binding protein [Bacillus amyloliquefaciens DSM 7] gi|307606437|emb|CBI42808.1| DNA processing Smf single strand binding protein [Bacillus amyloliquefaciens DSM 7] gi|328553494|gb|AEB23986.1| DNA processing Smf single strand binding protein [Bacillus amyloliquefaciens TA208] gi|328911714|gb|AEB63310.1| DNA processing Smf single strand binding protein [Bacillus amyloliquefaciens LL3] Length = 299 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG +YP EN L E + ++ + +SE P Sbjct: 173 IAGGFHHIYPRENLLLAEYMAEHH-LLLSEHPP 204 >gi|307706731|ref|ZP_07643536.1| DNA protecting protein DprA [Streptococcus mitis SK321] gi|307617816|gb|EFN96978.1| DNA protecting protein DprA [Streptococcus mitis SK321] Length = 282 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 165 IGTGLDVFYPKANKRLQDYI-SNDHLVLSEYGPG 197 >gi|313619219|gb|EFR90982.1| DNA protecting protein DprA [Listeria innocua FSL S4-378] Length = 286 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP N L +E+ G+ +SE Sbjct: 166 LGSGVNKIYPCSNELLAKEVIAQ-GLLLSEY 195 >gi|182625879|ref|ZP_02953645.1| DNA protecting protein DprA [Clostridium perfringens D str. JGS1721] gi|177908913|gb|EDT71405.1| DNA protecting protein DprA [Clostridium perfringens D str. JGS1721] Length = 360 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G++ YP NR L ++I N G ISE Sbjct: 170 GCGINLDYPVYNRELYKKIIKN-GCIISEFFP 200 >gi|313115002|ref|ZP_07800495.1| DNA protecting protein DprA [Faecalibacterium cf. prausnitzii KLE1255] gi|310622693|gb|EFQ06155.1| DNA protecting protein DprA [Faecalibacterium cf. prausnitzii KLE1255] Length = 378 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M +D YP N L +I + G ISE P Sbjct: 187 MGVPIDRTYPAANVVLRHKI-EQKGCVISEYPP 218 >gi|306821569|ref|ZP_07455167.1| DNA protecting protein DprA [Eubacterium yurii subsp. margaretiae ATCC 43715] gi|304550314|gb|EFM38307.1| DNA protecting protein DprA [Eubacterium yurii subsp. margaretiae ATCC 43715] Length = 237 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 19/29 (65%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 A +D +YP ENR L EE+ +G + ISE Sbjct: 44 ATSVDKIYPAENRYLYEEVLADGNLIISE 72 >gi|18977685|ref|NP_579042.1| DNA processing SMF protein [Pyrococcus furiosus DSM 3638] gi|18893417|gb|AAL81437.1| DNA processing smf protein homolog [Pyrococcus furiosus DSM 3638] Length = 217 Score = 45.7 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + ++ + P N L E+I +GG+ ISE+P G Sbjct: 114 LPSPVNDIVPKSNEKLAEKIIRSGGLLISELPEG 147 >gi|307704688|ref|ZP_07641587.1| DNA protecting protein DprA [Streptococcus mitis SK597] gi|307621735|gb|EFO00773.1| DNA protecting protein DprA [Streptococcus mitis SK597] Length = 282 Score = 45.3 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 165 IGTGLDVFYPKANKRLQDYI-GNDHLLLSEYGPG 197 >gi|78356624|ref|YP_388073.1| DNA processing protein DprA [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] gi|78219029|gb|ABB38378.1| DNA processing protein DprA, putative [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] Length = 425 Score = 45.3 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Query: 1 MAGGLDCLYPPENRN-LLEEIWDNGGIAISEIPFG 34 + G D +YPPENR+ L G+ ++E G Sbjct: 190 LGNGPDQIYPPENRDVLFS--LAGRGLVVTEFAPG 222 >gi|298482604|ref|ZP_07000789.1| DNA processing protein DprA [Bacteroides sp. D22] gi|298271311|gb|EFI12887.1| DNA processing protein DprA [Bacteroides sp. D22] Length = 374 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ + GG+ +E G Sbjct: 178 LAHGLDRIYPYVHRKTAVDMLEKGGLL-TEFLSG 210 >gi|224537324|ref|ZP_03677863.1| hypothetical protein BACCELL_02202 [Bacteroides cellulosilyticus DSM 14838] gi|224521055|gb|EEF90160.1| hypothetical protein BACCELL_02202 [Bacteroides cellulosilyticus DSM 14838] Length = 373 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP +R ++ DNGG+ +E Sbjct: 176 LAHGLDRIYPYVHRKTAIDMLDNGGLL-TEF 205 >gi|295692916|ref|YP_003601526.1| DNA processing protein [Lactobacillus crispatus ST1] gi|295031022|emb|CBL50501.1| DNA processing protein [Lactobacillus crispatus ST1] Length = 282 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GL+ YP +N L EEI G+ ISE G Sbjct: 167 IGNGLNFSYPMQNFALQEEIV-QKGLLISEYLPG 199 >gi|160884732|ref|ZP_02065735.1| hypothetical protein BACOVA_02721 [Bacteroides ovatus ATCC 8483] gi|156109767|gb|EDO11512.1| hypothetical protein BACOVA_02721 [Bacteroides ovatus ATCC 8483] Length = 374 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ + GG+ +E G Sbjct: 178 LAHGLDRIYPYVHRKTAVDMLEKGGLL-TEFLSG 210 >gi|295675124|ref|YP_003603648.1| DNA protecting protein DprA [Burkholderia sp. CCGE1002] gi|295434967|gb|ADG14137.1| DNA protecting protein DprA [Burkholderia sp. CCGE1002] Length = 409 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Query: 6 DCLYPPENRNLLEEIWDNGGIAISEIPFG 34 D +YP ++ L +I G +SE P G Sbjct: 185 DLIYPAAHQALARQIAVQ-GAILSEWPLG 212 >gi|323341687|ref|ZP_08081920.1| DNA protecting protein DprA [Erysipelothrix rhusiopathiae ATCC 19414] gi|322464112|gb|EFY09305.1| DNA protecting protein DprA [Erysipelothrix rhusiopathiae ATCC 19414] Length = 242 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP ++R E + N + ISE P G Sbjct: 129 GCGLDICYPSKHRVEFEFMKKNH-LVISEYPKG 160 >gi|313678964|ref|YP_004056703.1| DNA protecting protein dpra [Oceanithermus profundus DSM 14977] gi|313151679|gb|ADR35530.1| DNA protecting protein DprA [Oceanithermus profundus DSM 14977] Length = 341 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YPPEN L + +SE+P G Sbjct: 158 LGSGVDVVYPPENAELAGRVT-----LMSELPLG 186 >gi|315282096|ref|ZP_07870583.1| protein smf [Listeria marthii FSL S4-120] gi|313614256|gb|EFR87913.1| protein smf [Listeria marthii FSL S4-120] Length = 150 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ +YP +N+ L +I G+ +SE Sbjct: 30 LGSGVNNIYPLKNQLLANDI-ARDGLLLSEY 59 >gi|294675097|ref|YP_003575713.1| DNA protecting protein DprA [Prevotella ruminicola 23] gi|294472375|gb|ADE81764.1| DNA protecting protein DprA [Prevotella ruminicola 23] Length = 374 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP +R+ E+ +GG+ +E Sbjct: 176 LAHGLDQIYPYHHRDTAAEMTTHGGLL-TEF 205 >gi|322376816|ref|ZP_08051309.1| DNA protecting protein DprA [Streptococcus sp. M334] gi|321282623|gb|EFX59630.1| DNA protecting protein DprA [Streptococcus sp. M334] Length = 286 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 169 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 201 >gi|183603817|ref|ZP_02721636.2| DNA protecting protein DprA [Streptococcus pneumoniae MLV-016] gi|183578185|gb|EDT98713.1| DNA protecting protein DprA [Streptococcus pneumoniae MLV-016] Length = 286 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 169 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 201 >gi|148998905|ref|ZP_01826340.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP11-BS70] gi|307067914|ref|YP_003876880.1| putative DNA uptake Rossmann fold nucleotide-binding protein [Streptococcus pneumoniae AP200] gi|147755215|gb|EDK62267.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP11-BS70] gi|306409451|gb|ADM84878.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Streptococcus pneumoniae AP200] Length = 282 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 165 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 197 >gi|15901126|ref|NP_345730.1| DNA processing protein DprA, putative [Streptococcus pneumoniae TIGR4] gi|15903187|ref|NP_358737.1| DNA processing protein DprA, putative [Streptococcus pneumoniae R6] gi|14972749|gb|AAK75370.1| putative DNA processing protein DprA [Streptococcus pneumoniae TIGR4] gi|15458773|gb|AAK99947.1| DNA processing Smf protein [Streptococcus pneumoniae R6] gi|332073605|gb|EGI84084.1| DNA protecting protein DprA [Streptococcus pneumoniae GA17570] Length = 286 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 169 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 201 >gi|225859060|ref|YP_002740570.1| DNA protecting protein DprA [Streptococcus pneumoniae 70585] gi|225720776|gb|ACO16630.1| DNA protecting protein DprA [Streptococcus pneumoniae 70585] Length = 282 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 165 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 197 >gi|111658493|ref|ZP_01409159.1| hypothetical protein SpneT_02000320 [Streptococcus pneumoniae TIGR4] gi|116516400|ref|YP_816591.1| DNA processing protein DprA, putative [Streptococcus pneumoniae D39] gi|148989291|ref|ZP_01820671.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP6-BS73] gi|148994077|ref|ZP_01823417.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP9-BS68] gi|149007067|ref|ZP_01830736.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP18-BS74] gi|168489092|ref|ZP_02713291.1| DNA protecting protein DprA [Streptococcus pneumoniae SP195] gi|168491185|ref|ZP_02715328.1| DNA protecting protein DprA [Streptococcus pneumoniae CDC0288-04] gi|168493186|ref|ZP_02717329.1| DNA protecting protein DprA [Streptococcus pneumoniae CDC3059-06] gi|169834495|ref|YP_001694692.1| DNA protecting protein DprA [Streptococcus pneumoniae Hungary19A-6] gi|194398138|ref|YP_002037869.1| DNA processing Smf protein [Streptococcus pneumoniae G54] gi|221231954|ref|YP_002511106.1| SMF family protein [Streptococcus pneumoniae ATCC 700669] gi|225854729|ref|YP_002736241.1| DNA protecting protein DprA [Streptococcus pneumoniae JJA] gi|225856927|ref|YP_002738438.1| DNA protecting protein DprA [Streptococcus pneumoniae P1031] gi|307127143|ref|YP_003879174.1| DNA protecting protein DprA [Streptococcus pneumoniae 670-6B] gi|116076976|gb|ABJ54696.1| DNA processing protein DprA, putative [Streptococcus pneumoniae D39] gi|147761371|gb|EDK68337.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP18-BS74] gi|147925269|gb|EDK76348.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP6-BS73] gi|147927430|gb|EDK78459.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP9-BS68] gi|168996997|gb|ACA37609.1| DNA protecting protein DprA [Streptococcus pneumoniae Hungary19A-6] gi|183572464|gb|EDT92992.1| DNA protecting protein DprA [Streptococcus pneumoniae SP195] gi|183574382|gb|EDT94910.1| DNA protecting protein DprA [Streptococcus pneumoniae CDC0288-04] gi|183576496|gb|EDT97024.1| DNA protecting protein DprA [Streptococcus pneumoniae CDC3059-06] gi|194357805|gb|ACF56253.1| DNA processing Smf protein [Streptococcus pneumoniae G54] gi|220674414|emb|CAR68966.1| SMF family protein [Streptococcus pneumoniae ATCC 700669] gi|225723445|gb|ACO19298.1| DNA protecting protein DprA [Streptococcus pneumoniae JJA] gi|225725713|gb|ACO21565.1| DNA protecting protein DprA [Streptococcus pneumoniae P1031] gi|301794342|emb|CBW36769.1| SMF family protein [Streptococcus pneumoniae INV104] gi|306484205|gb|ADM91074.1| DNA protecting protein DprA [Streptococcus pneumoniae 670-6B] gi|332074600|gb|EGI85074.1| DNA protecting protein DprA [Streptococcus pneumoniae GA17545] gi|332200711|gb|EGJ14783.1| DNA protecting protein DprA [Streptococcus pneumoniae GA41317] gi|332203115|gb|EGJ17183.1| DNA protecting protein DprA [Streptococcus pneumoniae GA47901] Length = 282 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 165 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 197 >gi|255693546|ref|ZP_05417221.1| putative DNA processing protein DprA [Bacteroides finegoldii DSM 17565] gi|260620611|gb|EEX43482.1| putative DNA processing protein DprA [Bacteroides finegoldii DSM 17565] Length = 374 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ + GG+ +E G Sbjct: 178 LAHGLDRIYPHVHRKTAVDMLEKGGLL-TEFLSG 210 >gi|260101616|ref|ZP_05751853.1| DNA processing protein [Lactobacillus helveticus DSM 20075] gi|260084579|gb|EEW68699.1| DNA processing protein [Lactobacillus helveticus DSM 20075] Length = 282 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GL+ YP EN +L E+I N G+ ISE Sbjct: 168 GNGLNHSYPQENYSLQEQI-KNDGLIISEY 196 >gi|161507471|ref|YP_001577425.1| DNA processing protein chain A [Lactobacillus helveticus DPC 4571] gi|160348460|gb|ABX27134.1| DNA processing protein chain A [Lactobacillus helveticus DPC 4571] gi|323466643|gb|ADX70330.1| DNA processing protein chain A [Lactobacillus helveticus H10] gi|328467374|gb|EGF38452.1| DNA processing protein chain A [Lactobacillus helveticus MTCC 5463] Length = 282 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GL+ YP EN +L E+I N G+ ISE Sbjct: 168 GNGLNHSYPQENYSLQEQI-KNDGLIISEY 196 >gi|239993912|ref|ZP_04714436.1| DNA protecting protein DprA [Alteromonas macleodii ATCC 27126] Length = 369 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 M G + +YP +N L E I ++GG+ ++E G Sbjct: 174 MGTGPEKVYPAKNSKLYEAINNDGGVTVTEFFPG 207 >gi|237717087|ref|ZP_04547568.1| smf protein DNA processing chain A [Bacteroides sp. D1] gi|262405855|ref|ZP_06082405.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|294647816|ref|ZP_06725368.1| DNA protecting protein DprA [Bacteroides ovatus SD CC 2a] gi|294806210|ref|ZP_06765057.1| DNA protecting protein DprA [Bacteroides xylanisolvens SD CC 1b] gi|229443070|gb|EEO48861.1| smf protein DNA processing chain A [Bacteroides sp. D1] gi|262356730|gb|EEZ05820.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|292636724|gb|EFF55190.1| DNA protecting protein DprA [Bacteroides ovatus SD CC 2a] gi|294446466|gb|EFG15086.1| DNA protecting protein DprA [Bacteroides xylanisolvens SD CC 1b] Length = 373 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ + GG+ +E G Sbjct: 178 LAHGLDRIYPHVHRKTAVDMLEKGGLL-TEFLSG 210 >gi|169350424|ref|ZP_02867362.1| hypothetical protein CLOSPI_01192 [Clostridium spiroforme DSM 1552] gi|169292744|gb|EDS74877.1| hypothetical protein CLOSPI_01192 [Clostridium spiroforme DSM 1552] Length = 251 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D YP +N+ + E I + ISE P Sbjct: 139 LGSGIDNCYPLKNKTIYE-IMKVNQLVISEYP 169 >gi|310828090|ref|YP_003960447.1| DNA protecting protein DprA [Eubacterium limosum KIST612] gi|308739824|gb|ADO37484.1| DNA protecting protein DprA [Eubacterium limosum KIST612] Length = 368 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 M G++ YP +++ L ++I + G+ ++E Sbjct: 173 MGTGINVCYPEKHKVLYKKIV-HNGLILTEF 202 >gi|307709059|ref|ZP_07645519.1| DNA protecting protein DprA [Streptococcus mitis SK564] gi|307620395|gb|EFN99511.1| DNA protecting protein DprA [Streptococcus mitis SK564] Length = 282 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 165 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 197 >gi|293373773|ref|ZP_06620119.1| DNA protecting protein DprA [Bacteroides ovatus SD CMC 3f] gi|292631263|gb|EFF49895.1| DNA protecting protein DprA [Bacteroides ovatus SD CMC 3f] Length = 374 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ + GG+ +E G Sbjct: 178 LAHGLDRIYPHVHRKTAVDMLEKGGLL-TEFLSG 210 >gi|254284031|ref|ZP_04958999.1| SMF family protein [gamma proteobacterium NOR51-B] gi|219680234|gb|EED36583.1| SMF family protein [gamma proteobacterium NOR51-B] Length = 313 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 16/31 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ YP ++ L I +NGG ++E Sbjct: 188 LGTGILSDYPKGSQELRGRILENGGALVTEY 218 >gi|182684200|ref|YP_001835947.1| DNA processing protein DprA, putative [Streptococcus pneumoniae CGSP14] gi|182629534|gb|ACB90482.1| DNA processing protein DprA, putative [Streptococcus pneumoniae CGSP14] Length = 286 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 169 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 201 >gi|154686027|ref|YP_001421188.1| hypothetical protein RBAM_015940 [Bacillus amyloliquefaciens FZB42] gi|154351878|gb|ABS73957.1| Smf [Bacillus amyloliquefaciens FZB42] Length = 299 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG +YP EN L E + ++ + +SE P Sbjct: 173 IAGGFHHIYPRENLLLAEYMAEHH-LLLSEHPP 204 >gi|307708810|ref|ZP_07645272.1| DNA protecting protein DprA [Streptococcus mitis NCTC 12261] gi|307615176|gb|EFN94387.1| DNA protecting protein DprA [Streptococcus mitis NCTC 12261] Length = 286 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 169 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 201 >gi|149002637|ref|ZP_01827569.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP14-BS69] gi|149012323|ref|ZP_01833392.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP19-BS75] gi|237649964|ref|ZP_04524216.1| DNA processing protein DprA, putative [Streptococcus pneumoniae CCRI 1974] gi|237821130|ref|ZP_04596975.1| DNA processing protein DprA, putative [Streptococcus pneumoniae CCRI 1974M2] gi|303254488|ref|ZP_07340593.1| DNA processing protein DprA, putative [Streptococcus pneumoniae BS455] gi|303258903|ref|ZP_07344882.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP-BS293] gi|303261586|ref|ZP_07347533.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP14-BS292] gi|303264256|ref|ZP_07350176.1| DNA processing protein DprA, putative [Streptococcus pneumoniae BS397] gi|303267162|ref|ZP_07353030.1| DNA processing protein DprA, putative [Streptococcus pneumoniae BS457] gi|303268455|ref|ZP_07354250.1| DNA processing protein DprA, putative [Streptococcus pneumoniae BS458] gi|147759248|gb|EDK66241.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP14-BS69] gi|147763649|gb|EDK70584.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP19-BS75] gi|301802056|emb|CBW34788.1| SMF family protein [Streptococcus pneumoniae INV200] gi|302598574|gb|EFL65615.1| DNA processing protein DprA, putative [Streptococcus pneumoniae BS455] gi|302637166|gb|EFL67654.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP14-BS292] gi|302639846|gb|EFL70302.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP-BS293] gi|302642061|gb|EFL72413.1| DNA processing protein DprA, putative [Streptococcus pneumoniae BS458] gi|302643323|gb|EFL73602.1| DNA processing protein DprA, putative [Streptococcus pneumoniae BS457] gi|302646068|gb|EFL76295.1| DNA processing protein DprA, putative [Streptococcus pneumoniae BS397] Length = 282 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 165 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 197 >gi|302131146|ref|ZP_07257136.1| SMF protein [Pseudomonas syringae pv. tomato NCPPB 1108] Length = 292 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + L+ YP N+ L +EI N + ++E P G Sbjct: 177 LGTPLNMHYPKSNKALQDEIAANH-LVVTEYPVG 209 >gi|306825101|ref|ZP_07458443.1| DNA protecting protein DprA [Streptococcus sp. oral taxon 071 str. 73H25AP] gi|304432537|gb|EFM35511.1| DNA protecting protein DprA [Streptococcus sp. oral taxon 071 str. 73H25AP] Length = 286 Score = 45.3 bits (108), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 169 IGTGLDVFYPKANKRLQDYI-GNDHLVLSEYGPG 201 >gi|227543436|ref|ZP_03973485.1| DNA protecting protein DprA [Lactobacillus reuteri CF48-3A] gi|300910103|ref|ZP_07127563.1| DNA protecting protein DprA [Lactobacillus reuteri SD2112] gi|133930471|gb|ABO43807.1| Smf [Lactobacillus reuteri] gi|227186588|gb|EEI66659.1| DNA protecting protein DprA [Lactobacillus reuteri CF48-3A] gi|300892751|gb|EFK86111.1| DNA protecting protein DprA [Lactobacillus reuteri SD2112] Length = 291 Score = 44.9 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP ++ L +E G+ ISE Sbjct: 169 IGTGLDQAYPRNHQVLQDE-VARQGLVISEY 198 >gi|299142014|ref|ZP_07035148.1| DNA processing protein DprA [Prevotella oris C735] gi|298576476|gb|EFI48348.1| DNA processing protein DprA [Prevotella oris C735] Length = 375 Score = 44.9 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP +R+ +++ + GG+ +E Sbjct: 178 LAHGLDMLYPHAHRDTAKQMLNQGGLL-TEY 207 >gi|295706295|ref|YP_003599370.1| DNA protecting protein DprA [Bacillus megaterium DSM 319] gi|294803954|gb|ADF41020.1| DNA protecting protein DprA [Bacillus megaterium DSM 319] Length = 293 Score = 44.9 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG +YP N+NL EI + + +SE Sbjct: 174 LGGGFYNIYPRGNQNLAREITQHH-LLLSEYAP 205 >gi|289168064|ref|YP_003446333.1| DNA processing protein DprA [Streptococcus mitis B6] gi|288907631|emb|CBJ22468.1| DNA processing protein DprA [Streptococcus mitis B6] Length = 282 Score = 44.9 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N + +SE G Sbjct: 165 IGTGLDVFYPKANKRLQDYI-GNDHLILSEYGPG 197 >gi|296535601|ref|ZP_06897782.1| DNA protecting protein DprA [Roseomonas cervicalis ATCC 49957] gi|296264117|gb|EFH10561.1| DNA protecting protein DprA [Roseomonas cervicalis ATCC 49957] Length = 364 Score = 44.9 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GGLD YPPE+ L I + G+ ++E P G Sbjct: 164 IPGGLDRAYPPEHAELQSLIAER-GLVVAEAPLG 196 >gi|295085711|emb|CBK67234.1| DNA protecting protein DprA [Bacteroides xylanisolvens XB1A] Length = 374 Score = 44.9 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ + GG+ +E G Sbjct: 178 LAHGLDRIYPHVHRKTAVDMLEKGGLL-TEFLSG 210 >gi|242280185|ref|YP_002992314.1| DNA protecting protein DprA [Desulfovibrio salexigens DSM 2638] gi|242123079|gb|ACS80775.1| DNA protecting protein DprA [Desulfovibrio salexigens DSM 2638] Length = 402 Score = 44.9 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Query: 1 MAGGLDCL-YPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YPP++ L + ++ G+ ISE P G Sbjct: 175 LGTGLDVDSYPPDSDWLRRRVLES-GLIISEFPPG 208 >gi|304383998|ref|ZP_07366454.1| SMF family DNA processing protein [Prevotella marshii DSM 16973] gi|304334890|gb|EFM01164.1| SMF family DNA processing protein [Prevotella marshii DSM 16973] Length = 375 Score = 44.9 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +A G D LYP +++ + GG I+E P Sbjct: 177 LAHGHDNLYPSVHKDTATAMLQQGG-LITEYP 207 >gi|295426275|ref|ZP_06818935.1| DNA protecting protein DprA [Lactobacillus amylolyticus DSM 11664] gi|295064014|gb|EFG54962.1| DNA protecting protein DprA [Lactobacillus amylolyticus DSM 11664] Length = 298 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP +N L E+I + G+ +SE Sbjct: 172 LGNGLNHFYPMQNHFLQEQI-ASSGLLLSEY 201 >gi|194467937|ref|ZP_03073923.1| DNA protecting protein DprA [Lactobacillus reuteri 100-23] gi|194452790|gb|EDX41688.1| DNA protecting protein DprA [Lactobacillus reuteri 100-23] Length = 291 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP ++ L +E G+ ISE Sbjct: 169 IGTGLDQAYPRNHQVLQDE-VARQGLVISEY 198 >gi|283783113|ref|YP_003373867.1| DNA protecting protein DprA [Gardnerella vaginalis 409-05] gi|298253874|ref|ZP_06977461.1| DNA-uptake Rossmann fold nucleotide-binding protein [Gardnerella vaginalis 5-1] gi|283441767|gb|ADB14233.1| DNA protecting protein DprA [Gardnerella vaginalis 409-05] gi|297532017|gb|EFH70992.1| DNA-uptake Rossmann fold nucleotide-binding protein [Gardnerella vaginalis 5-1] Length = 514 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 19/32 (59%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL+ + P N L E+I GG+ ISE+ Sbjct: 298 AGGLNHMGPRCNYQLFEQIIAKGGVCISELCP 329 >gi|37521330|ref|NP_924707.1| hypothetical protein gll1761 [Gloeobacter violaceus PCC 7421] gi|35212327|dbj|BAC89702.1| gll1761 [Gloeobacter violaceus PCC 7421] Length = 360 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A L +YPPE+ + EI + G+ +SE Sbjct: 171 LATSLTRVYPPEHAGMAAEI-AHSGLLLSEYAP 202 >gi|238855695|ref|ZP_04645992.1| DNA protecting protein DprA [Lactobacillus jensenii 269-3] gi|260664450|ref|ZP_05865302.1| DNA protecting protein DprA [Lactobacillus jensenii SJ-7A-US] gi|282932209|ref|ZP_06337656.1| DNA protecting protein DprA [Lactobacillus jensenii 208-1] gi|313472149|ref|ZP_07812641.1| DNA protecting protein DprA [Lactobacillus jensenii 1153] gi|238831680|gb|EEQ24020.1| DNA protecting protein DprA [Lactobacillus jensenii 269-3] gi|239529521|gb|EEQ68522.1| DNA protecting protein DprA [Lactobacillus jensenii 1153] gi|260561515|gb|EEX27487.1| DNA protecting protein DprA [Lactobacillus jensenii SJ-7A-US] gi|281303659|gb|EFA95814.1| DNA protecting protein DprA [Lactobacillus jensenii 208-1] Length = 280 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GL+ YP ENRNL EI N G+ ISE Sbjct: 165 GNGLNHFYPEENRNLQFEIIKN-GLLISEY 193 >gi|157150409|ref|YP_001450485.1| DNA processing Smf protein [Streptococcus gordonii str. Challis substr. CH1] gi|157075203|gb|ABV09886.1| DNA processing Smf protein [Streptococcus gordonii str. Challis substr. CH1] Length = 280 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + +SE G Sbjct: 163 IGTGLDVFYPKANKKLQSYIGKNH-LVLSEYGPG 195 >gi|210622560|ref|ZP_03293242.1| hypothetical protein CLOHIR_01190 [Clostridium hiranonis DSM 13275] gi|210154143|gb|EEA85149.1| hypothetical protein CLOHIR_01190 [Clostridium hiranonis DSM 13275] Length = 379 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + G+D P N L+ +I D+GG ISE Sbjct: 179 LGSGIDNPLPKTNIWLMNKIVDSGGAVISE 208 >gi|148544009|ref|YP_001271379.1| DNA protecting protein DprA [Lactobacillus reuteri DSM 20016] gi|184153403|ref|YP_001841744.1| DNA processing protein [Lactobacillus reuteri JCM 1112] gi|227364922|ref|ZP_03848967.1| DNA protecting protein DprA [Lactobacillus reuteri MM2-3] gi|325682453|ref|ZP_08161970.1| DNA protecting protein DprA [Lactobacillus reuteri MM4-1A] gi|148531043|gb|ABQ83042.1| DNA protecting protein DprA [Lactobacillus reuteri DSM 20016] gi|183224747|dbj|BAG25264.1| DNA processing protein [Lactobacillus reuteri JCM 1112] gi|227070069|gb|EEI08447.1| DNA protecting protein DprA [Lactobacillus reuteri MM2-3] gi|324978292|gb|EGC15242.1| DNA protecting protein DprA [Lactobacillus reuteri MM4-1A] Length = 291 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP ++ L +E G+ ISE Sbjct: 169 IGTGLDQAYPRNHQVLQDE-VARQGLVISEY 198 >gi|282879050|ref|ZP_06287810.1| DNA protecting protein DprA [Prevotella buccalis ATCC 35310] gi|281298784|gb|EFA91193.1| DNA protecting protein DprA [Prevotella buccalis ATCC 35310] Length = 379 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYPP +R +E+ GG+ +E Sbjct: 180 LAHGLDYLYPPRHRQTADEMVQKGGLL-TEF 209 >gi|229918617|ref|YP_002887263.1| DNA protecting protein DprA [Exiguobacterium sp. AT1b] gi|229470046|gb|ACQ71818.1| DNA protecting protein DprA [Exiguobacterium sp. AT1b] Length = 264 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD LYP NR++L +I G+ +SE Sbjct: 145 LGAGLDRLYPAANRDMLLQIP-QEGVLLSEY 174 >gi|281424761|ref|ZP_06255674.1| DNA protecting protein DprA [Prevotella oris F0302] gi|281401131|gb|EFB31962.1| DNA protecting protein DprA [Prevotella oris F0302] Length = 375 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP +R+ +++ + GG+ +E Sbjct: 178 LAHGLDTLYPHAHRDTAKQMLNQGGLL-TEY 207 >gi|227549014|ref|ZP_03979063.1| DNA processing protein [Corynebacterium lipophiloflavum DSM 44291] gi|227078924|gb|EEI16887.1| DNA processing protein [Corynebacterium lipophiloflavum DSM 44291] Length = 391 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 12/33 (36%), Gaps = 4/33 (12%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G YP N L + I+E P G Sbjct: 190 ACGPGVTYPRRNAELFRRVT----AVITEYPPG 218 >gi|89511708|emb|CAI68100.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] Length = 282 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR + E + N + +SE P G Sbjct: 164 IGTGLDIFYPLENRKIQEYLAKNQ-LILSEYPVG 196 >gi|87300983|ref|ZP_01083825.1| putative DNA processing protein (Smf family protein) [Synechococcus sp. WH 5701] gi|87284854|gb|EAQ76806.1| putative DNA processing protein (Smf family protein) [Synechococcus sp. WH 5701] Length = 396 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + LD +YP ++ L G+ +SE P G Sbjct: 197 LGTPLDRVYPRHHQVLQSA-VARHGLLVSEHPRG 229 >gi|256851132|ref|ZP_05556521.1| DNA protecting protein DprA [Lactobacillus jensenii 27-2-CHN] gi|260660556|ref|ZP_05861471.1| DNA protecting protein DprA [Lactobacillus jensenii 115-3-CHN] gi|297205997|ref|ZP_06923392.1| DNA protecting protein DprA [Lactobacillus jensenii JV-V16] gi|256616194|gb|EEU21382.1| DNA protecting protein DprA [Lactobacillus jensenii 27-2-CHN] gi|260548278|gb|EEX24253.1| DNA protecting protein DprA [Lactobacillus jensenii 115-3-CHN] gi|297149123|gb|EFH29421.1| DNA protecting protein DprA [Lactobacillus jensenii JV-V16] Length = 282 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GL+ YP EN+ L EI + G+ ISE Sbjct: 167 GNGLNHFYPKENQLLQLEIIKH-GLLISEY 195 >gi|321315377|ref|YP_004207664.1| DNA processing Smf single strand binding protein [Bacillus subtilis BSn5] gi|320021651|gb|ADV96637.1| DNA processing Smf single strand binding protein [Bacillus subtilis BSn5] Length = 297 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG +YP EN L + + + I +SE P Sbjct: 171 IAGGFQHIYPRENLQLADHMAKHH-ILLSEHPP 202 >gi|292492338|ref|YP_003527777.1| SMF family protein [Nitrosococcus halophilus Nc4] gi|291580933|gb|ADE15390.1| SMF family protein [Nitrosococcus halophilus Nc4] Length = 324 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + L+ + P NR L EI + GG+ ISE Sbjct: 174 LPSPLNDVIPARNRALAGEIVEKGGLLISEY 204 >gi|239826603|ref|YP_002949227.1| DNA protecting protein DprA [Geobacillus sp. WCH70] gi|239806896|gb|ACS23961.1| DNA protecting protein DprA [Geobacillus sp. WCH70] Length = 294 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG + +YP +N+ L +++ G + +SE P Sbjct: 175 IAGGFEHIYPRQNKRLADQLMG-GHLILSEHPP 206 >gi|16078674|ref|NP_389493.1| DNA processing Smf single strand binding protein [Bacillus subtilis subsp. subtilis str. 168] gi|221309486|ref|ZP_03591333.1| DNA processing Smf protein [Bacillus subtilis subsp. subtilis str. 168] gi|221313811|ref|ZP_03595616.1| DNA processing Smf protein [Bacillus subtilis subsp. subtilis str. NCIB 3610] gi|221318735|ref|ZP_03600029.1| DNA processing Smf protein [Bacillus subtilis subsp. subtilis str. JH642] gi|221323006|ref|ZP_03604300.1| DNA processing Smf protein [Bacillus subtilis subsp. subtilis str. SMY] gi|3915864|sp|P39813|SMF_BACSU RecName: Full=Protein smf gi|2462969|emb|CAA04421.1| Smf protein [Bacillus subtilis subsp. subtilis str. 168] gi|2633983|emb|CAB13484.1| DNA processing Smf single strand binding protein [Bacillus subtilis subsp. subtilis str. 168] Length = 297 Score = 44.9 bits (107), Expect = 0.004, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG +YP EN L + + + I +SE P Sbjct: 171 IAGGFQHIYPRENLQLADHMAKHH-ILLSEHPP 202 >gi|291484162|dbj|BAI85237.1| DNA processing Smf protein [Bacillus subtilis subsp. natto BEST195] Length = 297 Score = 44.6 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG +YP EN L + + + I +SE P Sbjct: 171 IAGGFQHIYPRENLQLADHMAKHH-ILLSEHPP 202 >gi|258648286|ref|ZP_05735755.1| smf protein [Prevotella tannerae ATCC 51259] gi|260852205|gb|EEX72074.1| smf protein [Prevotella tannerae ATCC 51259] Length = 368 Score = 44.6 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +A GLD LYP +R + N G ++E P Sbjct: 174 LAHGLDRLYPSAHRTTAIAML-NKGGLLTEYP 204 >gi|332881647|ref|ZP_08449295.1| DNA protecting protein DprA [Capnocytophaga sp. oral taxon 329 str. F0087] gi|332680286|gb|EGJ53235.1| DNA protecting protein DprA [Capnocytophaga sp. oral taxon 329 str. F0087] Length = 373 Score = 44.6 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP +R+ ++ GG+ +E Sbjct: 177 LAHGLDQIYPRLHRDTAVQMTSQGGLL-TEF 206 >gi|322389592|ref|ZP_08063141.1| DNA protecting protein DprA [Streptococcus parasanguinis ATCC 903] gi|321143718|gb|EFX39147.1| DNA protecting protein DprA [Streptococcus parasanguinis ATCC 903] Length = 282 Score = 44.6 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + ++ + +SE G Sbjct: 163 IGTGLDVFYPKSNQRLQTYMGEHH-LILSEYGPG 195 >gi|282932229|ref|ZP_06337673.1| DNA protecting protein DprA [Lactobacillus jensenii 208-1] gi|281303624|gb|EFA95782.1| DNA protecting protein DprA [Lactobacillus jensenii 208-1] Length = 280 Score = 44.6 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GL+ YP EN+ L EI + G+ ISE Sbjct: 165 GNGLNHFYPKENQLLQLEIIKH-GLLISEY 193 >gi|297571162|ref|YP_003696936.1| DNA protecting protein DprA [Arcanobacterium haemolyticum DSM 20595] gi|296931509|gb|ADH92317.1| DNA protecting protein DprA [Arcanobacterium haemolyticum DSM 20595] Length = 384 Score = 44.6 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D YP + +L N G+ +SE P G Sbjct: 187 AGGVDRPYPLSHADLYTNTVKN-GVVVSESPVG 218 >gi|262282239|ref|ZP_06060007.1| DNA processing Smf protein [Streptococcus sp. 2_1_36FAA] gi|262261530|gb|EEY80228.1| DNA processing Smf protein [Streptococcus sp. 2_1_36FAA] Length = 280 Score = 44.6 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + +SE G Sbjct: 163 IGTGLDVFYPKANKKLQSYIGKNH-LVLSEYGPG 195 >gi|302517267|ref|ZP_07269609.1| DNA protecting protein DprA [Streptomyces sp. SPB78] gi|302426162|gb|EFK97977.1| DNA protecting protein DprA [Streptomyces sp. SPB78] Length = 178 Score = 44.6 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI----PFG 34 M G+ +YP ENR L + I GG +S+ P G Sbjct: 80 MGTGIAASIYPAENRPLAKAILSAGGALLSQFWPTSPPG 118 >gi|296453598|ref|YP_003660741.1| SMF family protein [Bifidobacterium longum subsp. longum JDM301] gi|296183029|gb|ADG99910.1| SMF family protein [Bifidobacterium longum subsp. longum JDM301] Length = 262 Score = 44.6 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ YP NR L + I + G+ +S+ Sbjct: 123 IGTGINRCYPASNRELQKSI-EKRGLVLSQF 152 >gi|261878856|ref|ZP_06005283.1| conserved hypothetical protein [Prevotella bergensis DSM 17361] gi|270334535|gb|EFA45321.1| conserved hypothetical protein [Prevotella bergensis DSM 17361] Length = 377 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYPP +R++ + GG+ +E Sbjct: 179 LAHGLDNLYPPRHRDVANAMVTRGGLL-TEF 208 >gi|329956498|ref|ZP_08297095.1| DNA protecting protein DprA [Bacteroides clarus YIT 12056] gi|328524395|gb|EGF51465.1| DNA protecting protein DprA [Bacteroides clarus YIT 12056] Length = 372 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP +R ++ NGG+ +E Sbjct: 176 LAHGLDRIYPFVHRKTAVDMLANGGLL-TEF 205 >gi|318062544|ref|ZP_07981265.1| hypothetical protein SSA3_31707 [Streptomyces sp. SA3_actG] gi|318078204|ref|ZP_07985536.1| hypothetical protein SSA3_16172 [Streptomyces sp. SA3_actF] Length = 195 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI----PFG 34 M G+ +YP ENR L + I GG +S+ P G Sbjct: 97 MGTGIAASIYPAENRPLAKAILSAGGALLSQFWPTSPPG 135 >gi|218297236|ref|ZP_03497892.1| DNA protecting protein DprA [Thermus aquaticus Y51MC23] gi|218242429|gb|EED08969.1| DNA protecting protein DprA [Thermus aquaticus Y51MC23] Length = 410 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + LD +YPPE+R + E + +SE P G Sbjct: 154 LGSALDQIYPPEHRPMAERMD-----LLSEFPLG 182 >gi|300313961|ref|YP_003778053.1| SMF protein involved in DNA uptake protein [Herbaspirillum seropedicae SmR1] gi|300076746|gb|ADJ66145.1| SMF protein involved in DNA uptake protein [Herbaspirillum seropedicae SmR1] Length = 378 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP + L G +SE P G Sbjct: 187 IGTGIDIVYPRRHEA-LAARIAAAGCIVSEYPLG 219 >gi|312887672|ref|ZP_07747263.1| DNA protecting protein DprA [Mucilaginibacter paludis DSM 18603] gi|311299851|gb|EFQ76929.1| DNA protecting protein DprA [Mucilaginibacter paludis DSM 18603] Length = 366 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 A GLD +YP ++R + +++ + GG +E P Sbjct: 172 AHGLDRIYPAQHRLVADKMLNKGGWL-TEFP 201 >gi|167763918|ref|ZP_02436045.1| hypothetical protein BACSTE_02300 [Bacteroides stercoris ATCC 43183] gi|167698034|gb|EDS14613.1| hypothetical protein BACSTE_02300 [Bacteroides stercoris ATCC 43183] Length = 372 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIA---ISE 30 +A GLD +YP +R ++ NGG+ +SE Sbjct: 176 LAHGLDRIYPSVHRKTAVDMLVNGGLLTEFLSE 208 >gi|296330826|ref|ZP_06873301.1| DNA processing Smf single strand binding protein [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305674344|ref|YP_003866016.1| DNA processing Smf single strand binding protein [Bacillus subtilis subsp. spizizenii str. W23] gi|296151831|gb|EFG92705.1| DNA processing Smf single strand binding protein [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305412588|gb|ADM37707.1| DNA processing Smf single strand binding protein [Bacillus subtilis subsp. spizizenii str. W23] Length = 297 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG +YP EN L + + + I +SE P Sbjct: 171 IAGGFQHIYPRENLQLADHMAKHH-ILLSEHPP 202 >gi|313204519|ref|YP_004043176.1| DNA protecting protein dpra [Paludibacter propionicigenes WB4] gi|312443835|gb|ADQ80191.1| DNA protecting protein DprA [Paludibacter propionicigenes WB4] Length = 372 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 8/30 (26%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GLD +YP +R ++ G ++E Sbjct: 177 GHGLDRIYPAAHRPTAVKML-QDGALLTEY 205 >gi|60683760|ref|YP_213904.1| putative DNA processing Smf-like protein [Bacteroides fragilis NCTC 9343] gi|60495194|emb|CAH10015.1| putative DNA processing Smf-like protein [Bacteroides fragilis NCTC 9343] Length = 373 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ GG+ +E G Sbjct: 177 LAHGLDRIYPSLHRKTAIDMLRQGGLL-TEFLSG 209 >gi|325268282|ref|ZP_08134915.1| SMF family DNA processing protein [Prevotella multiformis DSM 16608] gi|324989424|gb|EGC21374.1| SMF family DNA processing protein [Prevotella multiformis DSM 16608] Length = 372 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP +R ++ GG+ +E Sbjct: 174 LAHGLDDLYPRTHRQTAAQMMKQGGLL-TEY 203 >gi|255012004|ref|ZP_05284130.1| putative DNA processing Smf-like protein [Bacteroides fragilis 3_1_12] gi|313149841|ref|ZP_07812034.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12] gi|313138608|gb|EFR55968.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12] Length = 373 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ GG+ +E G Sbjct: 177 LAHGLDRIYPSLHRKTAIDMLRQGGLL-TEFLSG 209 >gi|253564628|ref|ZP_04842085.1| smf protein DNA processing chain A [Bacteroides sp. 3_2_5] gi|251948404|gb|EES88686.1| smf protein DNA processing chain A [Bacteroides sp. 3_2_5] gi|301165345|emb|CBW24917.1| putative DNA processing Smf-like protein [Bacteroides fragilis 638R] Length = 373 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ GG+ +E G Sbjct: 177 LAHGLDRIYPSLHRKTAIDMLRQGGLL-TEFLSG 209 >gi|53715841|ref|YP_101833.1| Smf protein DNA processing chain A [Bacteroides fragilis YCH46] gi|265764708|ref|ZP_06092983.1| smf protein DNA processing chain A [Bacteroides sp. 2_1_16] gi|52218706|dbj|BAD51299.1| Smf protein DNA processing chain A [Bacteroides fragilis YCH46] gi|263254092|gb|EEZ25526.1| smf protein DNA processing chain A [Bacteroides sp. 2_1_16] Length = 373 Score = 44.6 bits (106), Expect = 0.005, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +R ++ GG+ +E G Sbjct: 177 LAHGLDRIYPSLHRKTAIDMLRQGGLL-TEFLSG 209 >gi|312133263|ref|YP_004000602.1| smf family protein [Bifidobacterium longum subsp. longum BBMN68] gi|311772471|gb|ADQ01959.1| SMF family protein [Bifidobacterium longum subsp. longum BBMN68] Length = 338 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ YP N+ L I + G+ +S+ Sbjct: 199 IGTGINRCYPASNKGLQHTI-EERGLVLSQF 228 >gi|311068132|ref|YP_003973055.1| DNA processing Smf single strand binding protein [Bacillus atrophaeus 1942] gi|310868649|gb|ADP32124.1| DNA processing Smf single strand binding protein [Bacillus atrophaeus 1942] Length = 299 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG +YP EN+ L E + + +SE P Sbjct: 173 IAGGFHHIYPRENQQLAEYMAKYH-LLLSEHPP 204 >gi|284048588|ref|YP_003398927.1| DNA protecting protein DprA [Acidaminococcus fermentans DSM 20731] gi|283952809|gb|ADB47612.1| DNA protecting protein DprA [Acidaminococcus fermentans DSM 20731] Length = 370 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GGL LYP + L ++I + G ++E Sbjct: 171 LGGGLGELYPRRHLRLFDKICEQ-GALVTEQSP 202 >gi|21233179|ref|NP_639096.1| DNA processing chain A [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|66770119|ref|YP_244881.1| DNA processing chain A [Xanthomonas campestris pv. campestris str. 8004] gi|21115029|gb|AAM43008.1| DNA processing chain A [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|66575451|gb|AAY50861.1| DNA processing chain A [Xanthomonas campestris pv. campestris str. 8004] Length = 378 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D YP ++ +L + I +SE G Sbjct: 175 GTGPDVAYPVQHHSLRDRIAARS-AVVSEYLPG 206 >gi|313123916|ref|YP_004034175.1| rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|312280479|gb|ADQ61198.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|325686017|gb|EGD28076.1| DNA processing protein [Lactobacillus delbrueckii subsp. lactis DSM 20072] Length = 279 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GL+ YP EN L ++I G+ +SE Sbjct: 168 ANGLNYFYPRENTLLQQQIAAR-GLLLSEY 196 >gi|298346457|ref|YP_003719144.1| DNA-binding/uptake protein [Mobiluncus curtisii ATCC 43063] gi|298236518|gb|ADI67650.1| DNA-binding/uptake protein [Mobiluncus curtisii ATCC 43063] Length = 462 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL LYP N L +I G +SE P Sbjct: 240 AGGLGNLYPAMNARLFSQI-QQTGAIVSEAPP 270 >gi|205373361|ref|ZP_03226165.1| Smf family DNA processing protein [Bacillus coahuilensis m4-4] Length = 322 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+ YP +N + + I + G+ +SE P Sbjct: 174 LGNGILQCYPLKNSEIQKRIGE-KGLLLSEYPP 205 >gi|292558329|gb|ADE31330.1| SMF protein [Streptococcus suis GZ1] Length = 309 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN++L I + + ++E G Sbjct: 192 IGTGLDNIYPKENKDLQTYIGKHH-LVLTEYEAG 224 >gi|146320848|ref|YP_001200559.1| DNA uptake Rossmann fold nucleotide-binding protein [Streptococcus suis 98HAH33] gi|145691654|gb|ABP92159.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Streptococcus suis 98HAH33] Length = 318 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN++L I + + ++E G Sbjct: 201 IGTGLDNIYPKENKDLQTYIGKHH-LVLTEYEAG 233 >gi|310658803|ref|YP_003936524.1| DNA processing protein [Clostridium sticklandii DSM 519] gi|308825581|emb|CBH21619.1| DNA processing protein (smf family) (modular protein) [Clostridium sticklandii] Length = 356 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + + YP N L++ + D+GG+ ISE Sbjct: 166 LGSSITKPYPKTNAKLMQSVIDSGGLVISEY 196 >gi|225870569|ref|YP_002746516.1| SMF family protein [Streptococcus equi subsp. equi 4047] gi|225699973|emb|CAW93944.1| SMF family protein [Streptococcus equi subsp. equi 4047] Length = 281 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP EN L +E + +SE Sbjct: 163 IGTGLDRYYPKENHQL-QEFLSQRHLVLSEY 192 >gi|104774161|ref|YP_619141.1| DNA processing protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] gi|103423242|emb|CAI98075.1| DNA processing protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] Length = 279 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GL+ YP EN L ++I G+ +SE Sbjct: 168 ANGLNYFYPRENTLLQQQIAAR-GLLLSEY 196 >gi|195978103|ref|YP_002123347.1| nucleotide-binding protein Smf [Streptococcus equi subsp. zooepidemicus MGCS10565] gi|195974808|gb|ACG62334.1| nucleotide-binding protein Smf [Streptococcus equi subsp. zooepidemicus MGCS10565] Length = 281 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP EN L +E + +SE Sbjct: 163 IGTGLDRYYPKENHQL-QEFLSQRHLVLSEY 192 >gi|300812557|ref|ZP_07092974.1| DNA protecting protein DprA [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] gi|300496430|gb|EFK31535.1| DNA protecting protein DprA [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] gi|325125944|gb|ADY85274.1| SMF protein [Lactobacillus delbrueckii subsp. bulgaricus 2038] Length = 279 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GL+ YP EN L ++I G+ +SE Sbjct: 168 ANGLNYFYPRENTLLQQQIAAR-GLLLSEY 196 >gi|225868569|ref|YP_002744517.1| SMF family protein [Streptococcus equi subsp. zooepidemicus] gi|225701845|emb|CAW99302.1| SMF family protein [Streptococcus equi subsp. zooepidemicus] Length = 281 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP EN L +E + +SE Sbjct: 163 IGTGLDRYYPKENHQL-QEFLSQRHLVLSEY 192 >gi|154247839|ref|YP_001418797.1| DNA protecting protein DprA [Xanthobacter autotrophicus Py2] gi|154161924|gb|ABS69140.1| DNA protecting protein DprA [Xanthobacter autotrophicus Py2] Length = 378 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL YPPEN L+E++ G +SE+P Sbjct: 183 AGGLARPYPPENLGLIEKVAAT-GAIVSEMPL 213 >gi|124009967|ref|ZP_01694631.1| Smf protein DNA processing chain A [Microscilla marina ATCC 23134] gi|123983989|gb|EAY24372.1| Smf protein DNA processing chain A [Microscilla marina ATCC 23134] Length = 371 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MA G+D +YP + ++ G ++E FG Sbjct: 173 MASGIDVVYPTPHLGTARQMVQQQGGVMTEARFG 206 >gi|56419745|ref|YP_147063.1| Smf family DNA processing protein [Geobacillus kaustophilus HTA426] gi|56379587|dbj|BAD75495.1| DNA processing protein (Smf family) [Geobacillus kaustophilus HTA426] Length = 293 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGLD +YP E+R + + + I+E P Sbjct: 175 IAGGLDHIYPKEHRPFATRLMNEQ-LVIAEHPP 206 >gi|317153575|ref|YP_004121623.1| DNA protecting protein DprA [Desulfovibrio aespoeensis Aspo-2] gi|316943826|gb|ADU62877.1| DNA protecting protein DprA [Desulfovibrio aespoeensis Aspo-2] Length = 439 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP +N ++ + G+ ++E G Sbjct: 173 LGCGLDVDYPHDNHDVRRA-LETRGLVVTEFGPG 205 >gi|332666158|ref|YP_004448946.1| DNA protecting protein DprA [Haliscomenobacter hydrossis DSM 1100] gi|332334972|gb|AEE52073.1| DNA protecting protein DprA [Haliscomenobacter hydrossis DSM 1100] Length = 364 Score = 44.2 bits (105), Expect = 0.006, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GL LYPP +R++ + + +NGG I+E Sbjct: 172 LAHGLAHLYPPTHRSVAQRMLENGG-IITEY 201 >gi|330941260|gb|EGH44124.1| SMF protein [Pseudomonas syringae pv. pisi str. 1704B] Length = 292 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + L+ YP N L +EI + + ++E P G Sbjct: 177 LGTPLNMHYPKSNARLQDEIAVHH-LVVTEYPIG 209 >gi|328955476|ref|YP_004372809.1| SMF family protein [Coriobacterium glomerans PW2] gi|328455800|gb|AEB06994.1| SMF family protein [Coriobacterium glomerans PW2] Length = 324 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP + LL + + G +S P+G Sbjct: 105 LGCGADVVYPKSSARLLRDTIEGAGAVVSLDPWG 138 >gi|315655028|ref|ZP_07907932.1| DNA protecting protein DprA [Mobiluncus curtisii ATCC 51333] gi|315490684|gb|EFU80305.1| DNA protecting protein DprA [Mobiluncus curtisii ATCC 51333] Length = 462 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL LYP N L +I G +SE P Sbjct: 240 AGGLGNLYPAMNARLFSQI-QQTGAIVSEAPP 270 >gi|253751761|ref|YP_003024902.1| SMF family protein [Streptococcus suis SC84] gi|253753585|ref|YP_003026726.1| SMF family protein [Streptococcus suis P1/7] gi|253755534|ref|YP_003028674.1| SMF family protein [Streptococcus suis BM407] gi|251816050|emb|CAZ51670.1| SMF family protein [Streptococcus suis SC84] gi|251817998|emb|CAZ55780.1| SMF family protein [Streptococcus suis BM407] gi|251819831|emb|CAR45802.1| SMF family protein [Streptococcus suis P1/7] gi|319758110|gb|ADV70052.1| Rossmann fold nucleotide-binding protein involved in DNA uptake [Streptococcus suis JS14] Length = 280 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN++L I + + ++E G Sbjct: 163 IGTGLDNIYPKENKDLQTYIGKHH-LVLTEYEAG 195 >gi|171779425|ref|ZP_02920389.1| hypothetical protein STRINF_01270 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] gi|171282042|gb|EDT47473.1| hypothetical protein STRINF_01270 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] Length = 280 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP EN+ L + + N + +SE Sbjct: 163 IGCGLDVYYPKENKQLQDYLRKNH-LILSEY 192 >gi|315657109|ref|ZP_07909993.1| DNA protecting protein DprA [Mobiluncus curtisii subsp. holmesii ATCC 35242] gi|315492212|gb|EFU81819.1| DNA protecting protein DprA [Mobiluncus curtisii subsp. holmesii ATCC 35242] Length = 462 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL LYP N L +I G +SE P Sbjct: 240 AGGLGNLYPAMNARLFSQI-QQTGAIVSEAPP 270 >gi|282861384|ref|ZP_06270449.1| DNA protecting protein DprA [Streptomyces sp. ACTE] gi|282564042|gb|EFB69579.1| DNA protecting protein DprA [Streptomyces sp. ACTE] Length = 413 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G+D YP + L+ I G+ I E+ Sbjct: 208 LACGVDVAYPRGHAELIGRIVGQ-GLVIGELAP 239 >gi|223933023|ref|ZP_03625017.1| DNA protecting protein DprA [Streptococcus suis 89/1591] gi|223898340|gb|EEF64707.1| DNA protecting protein DprA [Streptococcus suis 89/1591] Length = 280 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN++L I + + ++E G Sbjct: 163 IGTGLDNIYPKENKDLQTYIGKHH-LVLTEYEAG 195 >gi|327400752|ref|YP_004341591.1| SMF family protein [Archaeoglobus veneficus SNP6] gi|327316260|gb|AEA46876.1| SMF family protein [Archaeoglobus veneficus SNP6] Length = 224 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISEI 31 ++ + P EN++L E I G+ ISE Sbjct: 124 IENITPKENKDLAERILKKDGLIISEF 150 >gi|237752848|ref|ZP_04583328.1| DNA processing protein chainA [Helicobacter winghamensis ATCC BAA-430] gi|229376337|gb|EEO26428.1| DNA processing protein chainA [Helicobacter winghamensis ATCC BAA-430] Length = 354 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDN-GGIAISEI 31 + LD + P ENR L EI N G+ ISE Sbjct: 171 LPSTLDNILPKENRELASEIVRNKNGLLISEY 202 >gi|58337277|ref|YP_193862.1| DNA processing protein chainA [Lactobacillus acidophilus NCFM] gi|227903863|ref|ZP_04021668.1| DNA processing protein chain A [Lactobacillus acidophilus ATCC 4796] gi|58254594|gb|AAV42831.1| DNA processing protein chainA [Lactobacillus acidophilus NCFM] gi|227868254|gb|EEJ75675.1| DNA processing protein chain A [Lactobacillus acidophilus ATCC 4796] Length = 285 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GL+ YP EN +L +I G+ ISE Sbjct: 168 GNGLNYSYPKENVDLQNQI-KQKGLIISEY 196 >gi|295115885|emb|CBL36732.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [butyrate-producing bacterium SM4/1] Length = 267 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 1 MAGGLDCLYPPENRNLLEEI 20 + G+D YP E+ L E I Sbjct: 173 LGCGIDICYPREHTELAERI 192 >gi|116514254|ref|YP_813160.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] gi|116093569|gb|ABJ58722.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] Length = 279 Score = 44.2 bits (105), Expect = 0.007, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GL+ YP EN L ++I G+ +SE Sbjct: 168 ANGLNYFYPRENTLLHQQIAAR-GLLLSEY 196 >gi|319900680|ref|YP_004160408.1| DNA protecting protein DprA [Bacteroides helcogenes P 36-108] gi|319415711|gb|ADV42822.1| DNA protecting protein DprA [Bacteroides helcogenes P 36-108] Length = 374 Score = 43.8 bits (104), Expect = 0.007, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP +R ++ NGG+ +E Sbjct: 176 LAHGLDRLYPYVHRKTAVDMLANGGLL-TEF 205 >gi|304389804|ref|ZP_07371763.1| DNA protecting protein DprA [Mobiluncus curtisii subsp. curtisii ATCC 35241] gi|304326980|gb|EFL94219.1| DNA protecting protein DprA [Mobiluncus curtisii subsp. curtisii ATCC 35241] Length = 462 Score = 43.8 bits (104), Expect = 0.007, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL LYP N L +I G +SE P Sbjct: 240 AGGLGNLYPAMNAQLFSQI-QQTGAIVSEAPP 270 >gi|332360457|gb|EGJ38268.1| DNA processing Smf protein [Streptococcus sanguinis SK355] Length = 280 Score = 43.8 bits (104), Expect = 0.008, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|297717816|gb|ADI50051.1| putative DNA processing protein DprA [Candidatus Odyssella thessalonicensis L13] Length = 361 Score = 43.8 bits (104), Expect = 0.008, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Query: 8 LYPPENRNLLEEIWDNGGIAISEIPFG 34 +YPPE+ +L +I G +SE+ G Sbjct: 167 IYPPEHEDLYNDI-QRHGCIVSEMLIG 192 >gi|189485676|ref|YP_001956617.1| DprA-like DNA processing protein [uncultured Termite group 1 bacterium phylotype Rs-D17] gi|170287635|dbj|BAG14156.1| DprA-like DNA processing protein [uncultured Termite group 1 bacterium phylotype Rs-D17] Length = 364 Score = 43.8 bits (104), Expect = 0.008, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL YPPEN L E+I G ISE+ Sbjct: 173 LGNGLLVNYPPENAKLQEKI-SQCGAVISEL 202 >gi|221133368|ref|ZP_03559673.1| Rossmann fold nucleotide-binding protein involved in DNA uptake [Glaciecola sp. HTCC2999] Length = 322 Score = 43.8 bits (104), Expect = 0.008, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + L + P N++L +EI ++GG+ ++E Sbjct: 173 LPSSLHNILPRGNQSLAKEIVESGGLLVTEY 203 >gi|332361196|gb|EGJ39000.1| DNA processing Smf protein [Streptococcus sanguinis SK1056] Length = 280 Score = 43.8 bits (104), Expect = 0.008, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|315606821|ref|ZP_07881830.1| DNA processing protein DprA [Prevotella buccae ATCC 33574] gi|315251486|gb|EFU31466.1| DNA processing protein DprA [Prevotella buccae ATCC 33574] Length = 375 Score = 43.8 bits (104), Expect = 0.008, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYPP +R E+ +GG ++E Sbjct: 177 LAHGLDDLYPPRHRQTAIEMVSHGG-LVTEF 206 >gi|325689697|gb|EGD31701.1| DNA processing Smf protein [Streptococcus sanguinis SK115] Length = 280 Score = 43.8 bits (104), Expect = 0.008, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|324994468|gb|EGC26381.1| DNA processing Smf protein [Streptococcus sanguinis SK678] Length = 280 Score = 43.8 bits (104), Expect = 0.008, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|328946301|gb|EGG40445.1| DNA processing Smf protein [Streptococcus sanguinis SK1087] Length = 280 Score = 43.8 bits (104), Expect = 0.008, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|325687467|gb|EGD29488.1| DNA processing Smf protein [Streptococcus sanguinis SK72] Length = 280 Score = 43.8 bits (104), Expect = 0.008, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|125718007|ref|YP_001035140.1| DNA processing Smf protein [Streptococcus sanguinis SK36] gi|125497924|gb|ABN44590.1| DNA processing Smf protein, putative [Streptococcus sanguinis SK36] gi|327460348|gb|EGF06685.1| DNA processing Smf protein [Streptococcus sanguinis SK1057] Length = 280 Score = 43.8 bits (104), Expect = 0.009, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|33322498|gb|AAQ06976.1|AF496303_1 smf protein [Lactobacillus delbrueckii subsp. lactis] Length = 117 Score = 43.8 bits (104), Expect = 0.009, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GL+ YP EN L ++I G+ +SE Sbjct: 44 ANGLNYFYPRENTLLQQQIAAR-GLLLSEY 72 >gi|327474221|gb|EGF19628.1| DNA processing Smf protein [Streptococcus sanguinis SK408] gi|332366885|gb|EGJ44626.1| DNA processing Smf protein [Streptococcus sanguinis SK1059] Length = 280 Score = 43.8 bits (104), Expect = 0.009, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|325067042|ref|ZP_08125715.1| DNA protecting protein DprA [Actinomyces oris K20] Length = 459 Score = 43.8 bits (104), Expect = 0.009, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYP N +LE + + G ++E+P G Sbjct: 253 AGGVDRLYPAGNTGVLEAVIAS-GALVAEVPPG 284 >gi|324992895|gb|EGC24815.1| DNA processing Smf protein [Streptococcus sanguinis SK405] gi|325696511|gb|EGD38401.1| DNA processing Smf protein [Streptococcus sanguinis SK160] gi|327462201|gb|EGF08528.1| DNA processing Smf protein [Streptococcus sanguinis SK1] Length = 280 Score = 43.8 bits (104), Expect = 0.009, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|325694496|gb|EGD36405.1| DNA processing Smf protein [Streptococcus sanguinis SK150] Length = 280 Score = 43.8 bits (104), Expect = 0.009, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|209559443|ref|YP_002285915.1| Putative DNA processing protein [Streptococcus pyogenes NZ131] gi|209540644|gb|ACI61220.1| Putative DNA processing protein [Streptococcus pyogenes NZ131] Length = 278 Score = 43.8 bits (104), Expect = 0.009, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR L + + I+E G Sbjct: 163 IGTGLDRFYPKENRKL-QTFLGKNHLVITEYGPG 195 >gi|322411763|gb|EFY02671.1| DNA processing protein [Streptococcus dysgalactiae subsp. dysgalactiae ATCC 27957] Length = 280 Score = 43.8 bits (104), Expect = 0.009, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR L + + ++E G Sbjct: 163 IGTGLDRFYPKENREL-QTFLGRKHLILTEYGPG 195 >gi|153837695|ref|ZP_01990362.1| SMF protein [Vibrio parahaemolyticus AQ3810] gi|149748985|gb|EDM59812.1| SMF protein [Vibrio parahaemolyticus AQ3810] Length = 331 Score = 43.8 bits (104), Expect = 0.009, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP + + E+I GG ++E G Sbjct: 188 LGTGIDSNYPKGSELVREQILSQGGSIVTEYLIG 221 >gi|327489688|gb|EGF21479.1| DNA processing Smf protein [Streptococcus sanguinis SK1058] Length = 280 Score = 43.8 bits (104), Expect = 0.009, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|324991145|gb|EGC23079.1| DNA processing Smf protein [Streptococcus sanguinis SK353] Length = 280 Score = 43.4 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|327470029|gb|EGF15493.1| DNA processing Smf protein [Streptococcus sanguinis SK330] Length = 280 Score = 43.4 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEYGPG 195 >gi|288925389|ref|ZP_06419323.1| DNA processing protein DprA [Prevotella buccae D17] gi|288337860|gb|EFC76212.1| DNA processing protein DprA [Prevotella buccae D17] Length = 375 Score = 43.4 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYPP +R E+ +GG ++E Sbjct: 177 LAHGLDDLYPPRHRQTAIEMVSHGG-LVTEF 206 >gi|229098303|ref|ZP_04229250.1| DNA protecting protein DprA [Bacillus cereus Rock3-29] gi|229117320|ref|ZP_04246698.1| DNA protecting protein DprA [Bacillus cereus Rock1-3] gi|228666220|gb|EEL21684.1| DNA protecting protein DprA [Bacillus cereus Rock1-3] gi|228685201|gb|EEL39132.1| DNA protecting protein DprA [Bacillus cereus Rock3-29] Length = 289 Score = 43.4 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E+ W+ + ++E P Sbjct: 172 LGHGLSYMYPKENRRLYEK-WEEYILLLTEYPP 203 >gi|229104396|ref|ZP_04235065.1| DNA protecting protein DprA [Bacillus cereus Rock3-28] gi|228679094|gb|EEL33302.1| DNA protecting protein DprA [Bacillus cereus Rock3-28] Length = 289 Score = 43.4 bits (103), Expect = 0.010, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E+ W+ + ++E P Sbjct: 172 LGHGLSYMYPKENRRLYEK-WEEYILLLTEYPP 203 >gi|282880522|ref|ZP_06289229.1| DNA protecting protein DprA [Prevotella timonensis CRIS 5C-B1] gi|281305625|gb|EFA97678.1| DNA protecting protein DprA [Prevotella timonensis CRIS 5C-B1] Length = 377 Score = 43.4 bits (103), Expect = 0.010, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G+D LYP ++ +E+ GG+ +E Sbjct: 178 LAHGVDYLYPARHKQTADEMVKKGGLL-TEF 207 >gi|255034029|ref|YP_003084650.1| DNA protecting protein DprA [Dyadobacter fermentans DSM 18053] gi|254946785|gb|ACT91485.1| DNA protecting protein DprA [Dyadobacter fermentans DSM 18053] Length = 372 Score = 43.4 bits (103), Expect = 0.010, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MA G D +YP ++ ++ NGG ++E G Sbjct: 177 MASGADVIYPAVHQRTAADMQANGG-IVTENALG 209 >gi|307564746|ref|ZP_07627274.1| DNA protecting protein DprA [Prevotella amnii CRIS 21A-A] gi|307346468|gb|EFN91777.1| DNA protecting protein DprA [Prevotella amnii CRIS 21A-A] Length = 376 Score = 43.4 bits (103), Expect = 0.010, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP +++ E+ GG+ +E Sbjct: 177 LAHGLDMIYPSTHKDTAIEMLKTGGLL-TEY 206 >gi|255531337|ref|YP_003091709.1| DNA protecting protein DprA [Pedobacter heparinus DSM 2366] gi|255344321|gb|ACU03647.1| DNA protecting protein DprA [Pedobacter heparinus DSM 2366] Length = 363 Score = 43.4 bits (103), Expect = 0.010, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP ++ + +++ NGG+ +E Sbjct: 171 LAHGLDRIYPALHKPVAQKMLLNGGLL-TEF 200 >gi|325284173|ref|YP_004256714.1| DNA protecting protein DprA [Deinococcus proteolyticus MRP] gi|324315982|gb|ADY27097.1| DNA protecting protein DprA [Deinococcus proteolyticus MRP] Length = 374 Score = 43.4 bits (103), Expect = 0.010, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 5/33 (15%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +D +YP EN +L + +SE P G Sbjct: 192 GHAVDRVYPAENVDLARRLT-----LVSEYPLG 219 >gi|282849513|ref|ZP_06258897.1| putative DNA protecting protein DprA [Veillonella parvula ATCC 17745] gi|282580450|gb|EFB85849.1| putative DNA protecting protein DprA [Veillonella parvula ATCC 17745] Length = 270 Score = 43.4 bits (103), Expect = 0.010, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI--PF 33 + ++ + P E+ ++I + GG+ ISE P Sbjct: 116 LPSSINEVLPKEHAERAKQIVETGGLLISEYYAPP 150 >gi|116075868|ref|ZP_01473127.1| putative DNA processing protein (Smf family) [Synechococcus sp. RS9916] gi|116067183|gb|EAU72938.1| putative DNA processing protein (Smf family) [Synechococcus sp. RS9916] Length = 369 Score = 43.4 bits (103), Expect = 0.011, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + L+ YPPE+R L + G+ I+E+ G Sbjct: 177 LGTPLERAYPPEHRQLQSD-VARAGLLITELAPG 209 >gi|317504339|ref|ZP_07962325.1| DNA protecting protein DprA [Prevotella salivae DSM 15606] gi|315664530|gb|EFV04211.1| DNA protecting protein DprA [Prevotella salivae DSM 15606] Length = 375 Score = 43.4 bits (103), Expect = 0.011, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP +R+ +++ GG+ +E Sbjct: 178 LAHGLDTLYPNAHRDTAKQMLVQGGLL-TEY 207 >gi|283852862|ref|ZP_06370124.1| DNA protecting protein DprA [Desulfovibrio sp. FW1012B] gi|283571772|gb|EFC19770.1| DNA protecting protein DprA [Desulfovibrio sp. FW1012B] Length = 437 Score = 43.4 bits (103), Expect = 0.011, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP N ++ G +SE G Sbjct: 199 GTGLDLVYPDANMDVWRA-LAEDGAIVSEFAPG 230 >gi|94502014|ref|ZP_01308521.1| SMF protein [Oceanobacter sp. RED65] gi|94425890|gb|EAT10891.1| SMF protein [Oceanobacter sp. RED65] Length = 314 Score = 43.4 bits (103), Expect = 0.011, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 16/31 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL YP + L EI ++GG ++E Sbjct: 182 LGNGLSIDYPAGSEKLKSEIINSGGAIVTEY 212 >gi|520752|gb|AAA22762.1| putative [Bacillus subtilis] Length = 160 Score = 43.4 bits (103), Expect = 0.012, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG +YP EN L + + + I +SE P Sbjct: 34 IAGGFQHIYPRENLQLADHMAKHH-ILLSEHPP 65 >gi|291519604|emb|CBK74825.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Butyrivibrio fibrisolvens 16/4] Length = 191 Score = 43.4 bits (103), Expect = 0.012, Method: Composition-based stats. Identities = 11/20 (55%), Positives = 13/20 (65%) Query: 1 MAGGLDCLYPPENRNLLEEI 20 + G D +YPPEN L EEI Sbjct: 171 LGCGCDVIYPPENHLLYEEI 190 >gi|83950056|ref|ZP_00958789.1| DNA processing protein DprA, putative [Roseovarius nubinhibens ISM] gi|83837955|gb|EAP77251.1| DNA processing protein DprA, putative [Roseovarius nubinhibens ISM] Length = 362 Score = 43.0 bits (102), Expect = 0.012, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGG+D +YP EN L ++ + G+ +SE G Sbjct: 153 MAGGVDVIYPVENDRLAVDLLAH-GLRLSENAMG 185 >gi|149192577|ref|ZP_01870740.1| SMF protein [Vibrio shilonii AK1] gi|148833589|gb|EDL50663.1| SMF protein [Vibrio shilonii AK1] Length = 335 Score = 43.0 bits (102), Expect = 0.013, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP + + E+I GG ++E G Sbjct: 188 LGTGIDSNYPKGSEVVREQILAGGGTIVTEYLIG 221 >gi|94986442|ref|YP_605806.1| DNA processing protein DprA, putative [Deinococcus geothermalis DSM 11300] gi|94556723|gb|ABF46637.1| DNA protecting protein DprA [Deinococcus geothermalis DSM 11300] Length = 358 Score = 43.0 bits (102), Expect = 0.013, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + ++ +YP EN +L + +SE P G Sbjct: 180 LGSAVNVIYPSENAHLARHLT-----LVSEYPLG 208 >gi|315640710|ref|ZP_07895812.1| DNA processing protein DprA [Enterococcus italicus DSM 15952] gi|315483465|gb|EFU73959.1| DNA processing protein DprA [Enterococcus italicus DSM 15952] Length = 297 Score = 43.0 bits (102), Expect = 0.013, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP E + E+ + + ISE P G Sbjct: 174 IGTGLDYCYPREAFPIFSEMKKHH-LVISEYPVG 206 >gi|183603389|ref|ZP_02711942.2| DNA protecting protein DprA [Streptococcus pneumoniae CDC1087-00] gi|298502737|ref|YP_003724677.1| DNA protecting protein DprA [Streptococcus pneumoniae TCH8431/19A] gi|183569725|gb|EDT90253.1| DNA protecting protein DprA [Streptococcus pneumoniae CDC1087-00] gi|298238332|gb|ADI69463.1| DNA protecting protein DprA [Streptococcus pneumoniae TCH8431/19A] Length = 286 Score = 43.0 bits (102), Expect = 0.013, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N +A+SE G Sbjct: 169 IGTGLDVFYPKANKRLQDYI-GNDHLALSEYGPG 201 >gi|282858750|ref|ZP_06267903.1| DNA protecting protein DprA [Prevotella bivia JCVIHMP010] gi|282588499|gb|EFB93651.1| DNA protecting protein DprA [Prevotella bivia JCVIHMP010] Length = 376 Score = 43.0 bits (102), Expect = 0.013, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP +R+ E+ ++GG+ +E Sbjct: 177 LAHGLDMIYPTAHRSTATEMTNHGGLL-TEY 206 >gi|226357401|ref|YP_002787141.1| DNA processing protein DprA (Smf) [Deinococcus deserti VCD115] gi|226319391|gb|ACO47387.1| putative DNA processing protein DprA (Smf) [Deinococcus deserti VCD115] Length = 369 Score = 43.0 bits (102), Expect = 0.014, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + ++ +YPPEN L E++ +SE P G Sbjct: 191 LGSAVNRIYPPENEALSEQLT-----LVSEYPLG 219 >gi|225860903|ref|YP_002742412.1| DNA protecting protein DprA [Streptococcus pneumoniae Taiwan19F-14] gi|298230477|ref|ZP_06964158.1| DNA protecting protein DprA [Streptococcus pneumoniae str. Canada MDR_19F] gi|298254294|ref|ZP_06977880.1| DNA protecting protein DprA [Streptococcus pneumoniae str. Canada MDR_19A] gi|225727626|gb|ACO23477.1| DNA protecting protein DprA [Streptococcus pneumoniae Taiwan19F-14] gi|327389501|gb|EGE87846.1| DNA protecting protein DprA [Streptococcus pneumoniae GA04375] Length = 282 Score = 43.0 bits (102), Expect = 0.014, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N +A+SE G Sbjct: 165 IGTGLDVFYPKANKRLQDYI-GNDHLALSEYGPG 197 >gi|148985166|ref|ZP_01818405.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP3-BS71] gi|147922611|gb|EDK73729.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP3-BS71] gi|301800179|emb|CBW32787.1| SMF family protein [Streptococcus pneumoniae OXC141] Length = 282 Score = 43.0 bits (102), Expect = 0.014, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N +A+SE G Sbjct: 165 IGTGLDVFYPKANKRLQDYI-GNDHLALSEYGPG 197 >gi|309389210|gb|ADO77090.1| DNA protecting protein DprA [Halanaerobium praevalens DSM 2228] Length = 380 Score = 43.0 bits (102), Expect = 0.015, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G D LYP +N+ L ++I +N G+ I+E Sbjct: 172 LGNGFDFLYPSQNKLLAQKITEN-GLMITEFNP 203 >gi|224543200|ref|ZP_03683739.1| hypothetical protein CATMIT_02400 [Catenibacterium mitsuokai DSM 15897] gi|224523987|gb|EEF93092.1| hypothetical protein CATMIT_02400 [Catenibacterium mitsuokai DSM 15897] Length = 311 Score = 43.0 bits (102), Expect = 0.015, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + ++ YP EN+ L I + G+ +S+ P Sbjct: 175 IGTPINQYYPKENKKLQLTI-EKHGLVVSQFPP 206 >gi|302327592|gb|ADL26793.1| putative DNA processing protein DprA [Fibrobacter succinogenes subsp. succinogenes S85] Length = 288 Score = 43.0 bits (102), Expect = 0.015, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + +D YP EN+ L +EI N + IS++P Sbjct: 166 IGTPIDHYYPKENKELQDEIATNH-LLISQVPL 197 >gi|261415223|ref|YP_003248906.1| SMF family protein [Fibrobacter succinogenes subsp. succinogenes S85] gi|261371679|gb|ACX74424.1| SMF family protein [Fibrobacter succinogenes subsp. succinogenes S85] Length = 282 Score = 43.0 bits (102), Expect = 0.015, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + +D YP EN+ L +EI N + IS++P Sbjct: 160 IGTPIDHYYPKENKELQDEIATNH-LLISQVPL 191 >gi|320546750|ref|ZP_08041061.1| Smf family DNA processing protein [Streptococcus equinus ATCC 9812] gi|320448629|gb|EFW89361.1| Smf family DNA processing protein [Streptococcus equinus ATCC 9812] Length = 280 Score = 43.0 bits (102), Expect = 0.016, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN+ LL+E + +SE G Sbjct: 163 IGCGLDVHYPKENK-LLQEYLGKNHLILSEYAVG 195 >gi|217968559|ref|YP_002353793.1| DNA protecting protein DprA [Thauera sp. MZ1T] gi|217505886|gb|ACK52897.1| DNA protecting protein DprA [Thauera sp. MZ1T] Length = 387 Score = 43.0 bits (102), Expect = 0.016, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP N L G +SE P G Sbjct: 177 IGTGIDRIYPARNAA-LAREIAAAGAVVSEFPLG 209 >gi|94990507|ref|YP_598607.1| DNA processing protein [Streptococcus pyogenes MGAS10270] gi|94544015|gb|ABF34063.1| DNA processing protein [Streptococcus pyogenes MGAS10270] Length = 278 Score = 43.0 bits (102), Expect = 0.016, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR L + + ++E G Sbjct: 163 IGTGLDRFYPKENREL-QTFLGKNHLVLTEYGPG 195 >gi|149019261|ref|ZP_01834623.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP23-BS72] gi|147931131|gb|EDK82110.1| DNA processing protein DprA, putative [Streptococcus pneumoniae SP23-BS72] Length = 282 Score = 42.6 bits (101), Expect = 0.016, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N +A+SE G Sbjct: 165 IGTGLDVFYPKANKRLQDCI-GNDHLALSEYGPG 197 >gi|297584026|ref|YP_003699806.1| DNA protecting protein DprA [Bacillus selenitireducens MLS10] gi|297142483|gb|ADH99240.1| DNA protecting protein DprA [Bacillus selenitireducens MLS10] Length = 308 Score = 42.6 bits (101), Expect = 0.016, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G D LYP +NR+L + ++E P Sbjct: 177 LAFGFDHLYPAKNRDLYAR-LQTDELVVTEFPP 208 >gi|116330093|ref|YP_799811.1| DNA processing protein A [Leptospira borgpetersenii serovar Hardjo-bovis JB197] gi|116123782|gb|ABJ75053.1| DNA processing protein A [Leptospira borgpetersenii serovar Hardjo-bovis JB197] Length = 327 Score = 42.6 bits (101), Expect = 0.016, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 1 MAGGLDCLYPPENRNLLEEI-WDNGGIAISEIPFG 34 M G + YP ENR L + + + + ++E P G Sbjct: 158 MGTGPETEYPFENRKLYQRMKYAKRTLILTEYPPG 192 >gi|15675139|ref|NP_269313.1| Smf family DNA processing protein [Streptococcus pyogenes M1 GAS] gi|71910697|ref|YP_282247.1| hypothetical protein M5005_Spy_0884 [Streptococcus pyogenes MGAS5005] gi|13622299|gb|AAK34034.1| putative DNA processing protein (Smf family) [Streptococcus pyogenes M1 GAS] gi|71853479|gb|AAZ51502.1| hypothetical protein M5005_Spy0884 [Streptococcus pyogenes MGAS5005] Length = 278 Score = 42.6 bits (101), Expect = 0.016, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR L + + ++E G Sbjct: 163 IGTGLDRFYPKENREL-QTFLGKNHLVLTEYGPG 195 >gi|116329300|ref|YP_799020.1| DNA processing protein A [Leptospira borgpetersenii serovar Hardjo-bovis L550] gi|116122044|gb|ABJ80087.1| DNA processing protein A [Leptospira borgpetersenii serovar Hardjo-bovis L550] Length = 327 Score = 42.6 bits (101), Expect = 0.017, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 1 MAGGLDCLYPPENRNLLEEI-WDNGGIAISEIPFG 34 M G + YP ENR L + + + + ++E P G Sbjct: 158 MGTGPETEYPFENRKLYQRMKYAKRTLILTEYPPG 192 >gi|71903523|ref|YP_280326.1| hypothetical protein M28_Spy0858 [Streptococcus pyogenes MGAS6180] gi|71802618|gb|AAX71971.1| hypothetical protein M28_Spy0858 [Streptococcus pyogenes MGAS6180] Length = 278 Score = 42.6 bits (101), Expect = 0.017, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR L + + ++E G Sbjct: 163 IGTGLDRFYPKENREL-QTFLGKNHLVLTEYGPG 195 >gi|94988632|ref|YP_596733.1| DNA processing protein [Streptococcus pyogenes MGAS9429] gi|94992455|ref|YP_600554.1| DNA processing protein [Streptococcus pyogenes MGAS2096] gi|94542140|gb|ABF32189.1| DNA processing protein [Streptococcus pyogenes MGAS9429] gi|94545963|gb|ABF36010.1| DNA processing protein [Streptococcus pyogenes MGAS2096] Length = 278 Score = 42.6 bits (101), Expect = 0.018, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR L + + ++E G Sbjct: 163 IGTGLDRFYPKENREL-QTFLGKNHLVLTEYGPG 195 >gi|306827334|ref|ZP_07460621.1| DNA protecting protein DprA [Streptococcus pyogenes ATCC 10782] gi|304430481|gb|EFM33503.1| DNA protecting protein DprA [Streptococcus pyogenes ATCC 10782] Length = 278 Score = 42.6 bits (101), Expect = 0.018, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR L + + ++E G Sbjct: 163 IGTGLDRFYPKENREL-QTFLGKNHLVLTEYGPG 195 >gi|148241522|ref|YP_001226679.1| Rossmann fold nucleotide-binding protein involved in DNA uptake [Synechococcus sp. RCC307] gi|147849832|emb|CAK27326.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptak [Synechococcus sp. RCC307] Length = 364 Score = 42.6 bits (101), Expect = 0.018, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + L+ +YP ++ L + G+ ISE G Sbjct: 173 LGTSLERVYPRHHQRLQSQ-VGRRGLLISEQAPG 205 >gi|78777855|ref|YP_394170.1| SMF protein [Sulfurimonas denitrificans DSM 1251] gi|78498395|gb|ABB44935.1| SMF protein [Sulfurimonas denitrificans DSM 1251] Length = 258 Score = 42.6 bits (101), Expect = 0.018, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP N+NLL EI + G+ +S+ G Sbjct: 90 LPCGVDVRYPAVNKNLLCEI-EKNGLLLSQFESG 122 >gi|146318641|ref|YP_001198353.1| Rossmann fold nucleotide-binding protein involved in DNA uptake [Streptococcus suis 05ZYH33] gi|145689447|gb|ABP89953.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Streptococcus suis 05ZYH33] Length = 99 Score = 42.6 bits (101), Expect = 0.019, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD +YP EN++L I + + ++E G Sbjct: 34 IGTGLDNIYPKENKDLQTYIGKHH-LVLTEYEAG 66 >gi|327183487|gb|AEA31934.1| DNA processing protein chain A [Lactobacillus amylovorus GRL 1118] Length = 282 Score = 42.6 bits (101), Expect = 0.020, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP +N L +I G+ ISE Sbjct: 167 IGNGLNYSYPRQNTWLQNQI-KQKGLVISEY 196 >gi|315038210|ref|YP_004031778.1| DNA processing protein chain A [Lactobacillus amylovorus GRL 1112] gi|325956664|ref|YP_004292076.1| DNA processing protein chain A [Lactobacillus acidophilus 30SC] gi|312276343|gb|ADQ58983.1| DNA processing protein chain A [Lactobacillus amylovorus GRL 1112] gi|325333229|gb|ADZ07137.1| DNA processing protein chain A [Lactobacillus acidophilus 30SC] Length = 282 Score = 42.6 bits (101), Expect = 0.020, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP +N L +I G+ ISE Sbjct: 167 IGNGLNYSYPRQNTWLQNQI-KQKGLVISEY 196 >gi|89511736|emb|CAI68115.1| DNA processing SMF protein [Lactococcus lactis subsp. cremoris] Length = 282 Score = 42.6 bits (101), Expect = 0.020, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR + E + N + +SE G Sbjct: 164 IGTGLDIFYPLENRKIQEYLAKNQ-LVLSEYSLG 196 >gi|89511728|emb|CAI68111.1| DNA processing SMF protein [Lactococcus lactis subsp. cremoris] Length = 282 Score = 42.6 bits (101), Expect = 0.020, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR + E + N + +SE G Sbjct: 164 IGTGLDIFYPLENRKIQEYLAKNQ-LVLSEYSLG 196 >gi|125624097|ref|YP_001032580.1| Smf protein [Lactococcus lactis subsp. cremoris MG1363] gi|89511687|emb|CAI68094.1| DNA processing SMF protein [Lactococcus lactis subsp. cremoris MG1363] gi|89511718|emb|CAI68106.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis bv. diacetylactis] gi|89511720|emb|CAI68107.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] gi|89511726|emb|CAI68110.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] gi|89511732|emb|CAI68113.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] gi|89511734|emb|CAI68114.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] gi|124492905|emb|CAL97866.1| Smf protein [Lactococcus lactis subsp. cremoris MG1363] gi|300070870|gb|ADJ60270.1| Smf protein [Lactococcus lactis subsp. cremoris NZ9000] Length = 282 Score = 42.6 bits (101), Expect = 0.020, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR + E + N + +SE G Sbjct: 164 IGTGLDIFYPLENRKIQEYLAKNQ-LVLSEYSLG 196 >gi|89511722|emb|CAI68108.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] Length = 282 Score = 42.6 bits (101), Expect = 0.020, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR + E + N + +SE G Sbjct: 164 IGTGLDIFYPLENRKIQEYLAKNQ-LVLSEYSLG 196 >gi|116512037|ref|YP_809253.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactococcus lactis subsp. cremoris SK11] gi|116107691|gb|ABJ72831.1| Predicted Rossmann fold nucleotide-binding protein for DNA uptake [Lactococcus lactis subsp. cremoris SK11] Length = 282 Score = 42.6 bits (101), Expect = 0.020, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR + E + N + +SE G Sbjct: 164 IGTGLDIFYPLENRKIQEYLAKNQ-LVLSEYSLG 196 >gi|325954541|ref|YP_004238201.1| DNA protecting protein DprA [Weeksella virosa DSM 16922] gi|323437159|gb|ADX67623.1| DNA protecting protein DprA [Weeksella virosa DSM 16922] Length = 364 Score = 42.6 bits (101), Expect = 0.020, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A L+ +YP +++ +E+ +NGG ISE Sbjct: 173 LAHHLNKVYPAKHKKEAQEMLENGG-LISEY 202 >gi|119385851|ref|YP_916906.1| SMF family protein [Paracoccus denitrificans PD1222] gi|119376446|gb|ABL71210.1| SMF family protein [Paracoccus denitrificans PD1222] Length = 331 Score = 42.6 bits (101), Expect = 0.020, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ YP + L + I +GG ++E Sbjct: 195 LGTGIFSDYPRNSEKLRDAIAKSGGAIVTEY 225 >gi|332360878|gb|EGJ38684.1| DNA processing Smf protein [Streptococcus sanguinis SK49] Length = 280 Score = 42.6 bits (101), Expect = 0.020, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L I N + ++E G Sbjct: 163 IGTGLDVFYPKPNKKLQAYIGKNH-LLLTEYGPG 195 >gi|260910931|ref|ZP_05917572.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str. F0295] gi|260634922|gb|EEX52971.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str. F0295] Length = 375 Score = 42.6 bits (101), Expect = 0.020, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP ++ +E+ GG+ +E Sbjct: 177 LAHGLDYLYPTRHKQTADEMLTQGGLL-TEF 206 >gi|323697641|ref|ZP_08109553.1| DNA protecting protein DprA [Desulfovibrio sp. ND132] gi|323457573|gb|EGB13438.1| DNA protecting protein DprA [Desulfovibrio desulfuricans ND132] Length = 418 Score = 42.6 bits (101), Expect = 0.020, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 9/38 (23%) Query: 1 MAGGLDCLYPPEN----RNLLEEIWDNGGIAISEIPFG 34 + GLD YPP N R L + G+ ++E G Sbjct: 174 LGCGLDVDYPPGNGDVRRALYD-----KGLVVTEYGPG 206 >gi|76787406|ref|YP_329722.1| DNA processing protein DprA [Streptococcus agalactiae A909] gi|76562463|gb|ABA45047.1| DNA processing protein DprA, putative [Streptococcus agalactiae A909] Length = 280 Score = 42.6 bits (101), Expect = 0.021, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN+ L E + N + +SE G Sbjct: 164 IGSGLDVYYPTENKKLQEYMSYNH-LVLSEYFTG 196 >gi|227879128|ref|ZP_03997012.1| DNA processing protein chain A [Lactobacillus crispatus JV-V01] gi|256843161|ref|ZP_05548649.1| DNA processing protein chain A [Lactobacillus crispatus 125-2-CHN] gi|256850240|ref|ZP_05555669.1| DNA processing protein chainA [Lactobacillus crispatus MV-1A-US] gi|262046368|ref|ZP_06019330.1| DNA processing protein subunit A [Lactobacillus crispatus MV-3A-US] gi|293380237|ref|ZP_06626318.1| DNA protecting protein DprA [Lactobacillus crispatus 214-1] gi|312977296|ref|ZP_07789044.1| DNA protecting protein DprA [Lactobacillus crispatus CTV-05] gi|227861285|gb|EEJ68920.1| DNA processing protein chain A [Lactobacillus crispatus JV-V01] gi|256614581|gb|EEU19782.1| DNA processing protein chain A [Lactobacillus crispatus 125-2-CHN] gi|256712877|gb|EEU27869.1| DNA processing protein chainA [Lactobacillus crispatus MV-1A-US] gi|260573239|gb|EEX29797.1| DNA processing protein subunit A [Lactobacillus crispatus MV-3A-US] gi|290923204|gb|EFE00126.1| DNA protecting protein DprA [Lactobacillus crispatus 214-1] gi|310895727|gb|EFQ44793.1| DNA protecting protein DprA [Lactobacillus crispatus CTV-05] Length = 282 Score = 42.3 bits (100), Expect = 0.021, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP +N L EEI G+ ISE Sbjct: 167 IGNGLNFSYPMQNFALQEEIV-QKGLLISEY 196 >gi|88705376|ref|ZP_01103087.1| SMF protein [Congregibacter litoralis KT71] gi|88700466|gb|EAQ97574.1| SMF protein [Congregibacter litoralis KT71] Length = 375 Score = 42.3 bits (100), Expect = 0.021, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +A GL+ P +R L EI + G +SE+P Sbjct: 180 LASGLEQASPLRHRALAAEIAAS-GCVVSELP 210 >gi|284037272|ref|YP_003387202.1| DNA protecting protein DprA [Spirosoma linguale DSM 74] gi|283816565|gb|ADB38403.1| DNA protecting protein DprA [Spirosoma linguale DSM 74] Length = 370 Score = 42.3 bits (100), Expect = 0.021, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MA GLD +YP ++ ++ GG+ +E G Sbjct: 173 MASGLDVIYPNVHQRTAADMLVQGGLL-TESRPG 205 >gi|318042637|ref|ZP_07974593.1| DNA uptake Rossmann fold nucleotide-binding protein [Synechococcus sp. CB0101] Length = 415 Score = 42.3 bits (100), Expect = 0.021, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + L+ +YP + L + + G+ +SE+P G Sbjct: 225 LGTPLNRVYPRHHGQLQATVAEQ-GVLVSELPEG 257 >gi|25011095|ref|NP_735490.1| hypothetical protein gbs1041 [Streptococcus agalactiae NEM316] gi|76798273|ref|ZP_00780521.1| DNA processing Smf protein [Streptococcus agalactiae 18RS21] gi|77407070|ref|ZP_00784075.1| DNA processing chain A [Streptococcus agalactiae H36B] gi|77408077|ref|ZP_00784825.1| DNA processing chain A [Streptococcus agalactiae COH1] gi|77410536|ref|ZP_00786897.1| DNA processing chain A [Streptococcus agalactiae CJB111] gi|77414788|ref|ZP_00790911.1| DNA processing chain A [Streptococcus agalactiae 515] gi|23095494|emb|CAD46700.1| Unknown [Streptococcus agalactiae NEM316] gi|76586384|gb|EAO62894.1| DNA processing Smf protein [Streptococcus agalactiae 18RS21] gi|77159164|gb|EAO70352.1| DNA processing chain A [Streptococcus agalactiae 515] gi|77163484|gb|EAO74434.1| DNA processing chain A [Streptococcus agalactiae CJB111] gi|77173342|gb|EAO76463.1| DNA processing chain A [Streptococcus agalactiae COH1] gi|77174323|gb|EAO77187.1| DNA processing chain A [Streptococcus agalactiae H36B] Length = 280 Score = 42.3 bits (100), Expect = 0.021, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN+ L E + N + +SE G Sbjct: 164 IGSGLDVYYPTENKKLQEYMSYNH-LVLSEYFTG 196 >gi|308235790|ref|ZP_07666527.1| DNA protecting protein DprA [Gardnerella vaginalis ATCC 14018] gi|311114449|ref|YP_003985670.1| DNA protecting protein DprA [Gardnerella vaginalis ATCC 14019] gi|310945943|gb|ADP38647.1| DNA protecting protein DprA [Gardnerella vaginalis ATCC 14019] Length = 504 Score = 42.3 bits (100), Expect = 0.022, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 18/32 (56%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL+ + P N L + I +GG ISE+ Sbjct: 295 AGGLNKMGPSSNAQLFDAILSSGGACISELCP 326 >gi|15615031|ref|NP_243334.1| Smf family DNA processing protein [Bacillus halodurans C-125] gi|10175088|dbj|BAB06187.1| DNA processing protein (Smf family) [Bacillus halodurans C-125] Length = 302 Score = 42.3 bits (100), Expect = 0.022, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Query: 1 MAGGLDCLYPPENRNLLE-EIWDNGGIAISEIPF 33 +A G D LYP +R E E+ + ISE P Sbjct: 174 LAHGHDNLYPAAHRPFAEHEMVSQ--LMISEYPP 205 >gi|225012503|ref|ZP_03702939.1| DNA protecting protein DprA [Flavobacteria bacterium MS024-2A] gi|225003480|gb|EEG41454.1| DNA protecting protein DprA [Flavobacteria bacterium MS024-2A] Length = 365 Score = 42.3 bits (100), Expect = 0.022, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A D +YP E+ EI + G +++ G Sbjct: 173 LAHSFDRIYPYEHHKTASEI-EKKGALVTDFLPG 205 >gi|22537166|ref|NP_688017.1| DprA/SMF protein DNA processing factor [Streptococcus agalactiae 2603V/R] gi|22534030|gb|AAM99889.1|AE014238_2 DprA/SMF protein, putative DNA processing factor [Streptococcus agalactiae 2603V/R] Length = 280 Score = 42.3 bits (100), Expect = 0.022, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN+ L E + N + +SE G Sbjct: 164 IGSGLDVYYPTENKKLQEYMSYNH-LVLSEYFTG 196 >gi|325299438|ref|YP_004259355.1| DNA protecting protein DprA [Bacteroides salanitronis DSM 18170] gi|324318991|gb|ADY36882.1| DNA protecting protein DprA [Bacteroides salanitronis DSM 18170] Length = 370 Score = 42.3 bits (100), Expect = 0.023, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP +RN E+ +GG+ +E G Sbjct: 176 LAHGLDRIYPFVHRNTASEMTLHGGLL-TEFMSG 208 >gi|24216282|ref|NP_713763.1| DNA processing protein A [Leptospira interrogans serovar Lai str. 56601] gi|45656514|ref|YP_000600.1| DNA processing chain A [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] gi|24197549|gb|AAN50781.1| DNA processing protein A [Leptospira interrogans serovar Lai str. 56601] gi|45599749|gb|AAS69237.1| DNA processing chain A [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] Length = 327 Score = 42.3 bits (100), Expect = 0.023, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Query: 1 MAGGLDCLYPPENRNLLEEI-WDNGGIAISEIPFG 34 M G + YP EN+ L + I + ++E P G Sbjct: 158 MGTGPEKEYPFENKMLYQRINSSQRTLILTEYPPG 192 >gi|323489569|ref|ZP_08094796.1| protein smf [Planococcus donghaensis MPA1U2] gi|323396700|gb|EGA89519.1| protein smf [Planococcus donghaensis MPA1U2] Length = 295 Score = 42.3 bits (100), Expect = 0.023, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G YP EN +L I + + ++E P Sbjct: 176 GSGFLHPYPKENASL-NHIIEERHLVLTEYPP 206 >gi|319744994|gb|EFV97322.1| Smf family DNA processing protein [Streptococcus agalactiae ATCC 13813] Length = 280 Score = 42.3 bits (100), Expect = 0.024, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP EN+ L E + N + +SE Sbjct: 164 IGSGLDVYYPTENKKLQEYMSYNH-LVLSEY 193 >gi|227431676|ref|ZP_03913708.1| Rossmann fold nucleotide-binding protein for DNA uptake [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] gi|227352561|gb|EEJ42755.1| Rossmann fold nucleotide-binding protein for DNA uptake [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] Length = 288 Score = 42.3 bits (100), Expect = 0.025, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP +N+ L + GI +SE Sbjct: 169 IGTGLNIAYPAKNKVLQRQ-VAQHGIVLSEY 198 >gi|212639577|ref|YP_002316097.1| putative Rossmann fold nucleotide-binding protein involved in DNA uptake [Anoxybacillus flavithermus WK1] gi|212561057|gb|ACJ34112.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Anoxybacillus flavithermus WK1] Length = 295 Score = 42.3 bits (100), Expect = 0.025, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGL +YPPEN +L + + ISE P Sbjct: 175 IAGGLYYMYPPENESLFRQ-LATTQLIISEYPP 206 >gi|251782420|ref|YP_002996722.1| DNA processing protein [Streptococcus dysgalactiae subsp. equisimilis GGS_124] gi|242391049|dbj|BAH81508.1| DNA processing protein [Streptococcus dysgalactiae subsp. equisimilis GGS_124] gi|323127301|gb|ADX24598.1| DNA processing protein [Streptococcus dysgalactiae subsp. equisimilis ATCC 12394] Length = 280 Score = 42.3 bits (100), Expect = 0.026, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP EN+ L + + ++E G Sbjct: 163 IGTGLDRFYPKENQEL-QTFLGRKHLILTEYGPG 195 >gi|121999102|ref|YP_001003889.1| DNA protecting protein DprA [Halorhodospira halophila SL1] gi|121590507|gb|ABM63087.1| DNA protecting protein DprA [Halorhodospira halophila SL1] Length = 388 Score = 42.3 bits (100), Expect = 0.026, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Query: 6 DCLYPPENRNLLEEIWDNGGIAISEIPFG 34 D +YP ++ L EI + G + E+P G Sbjct: 198 DQVYPARHQRLHAEITAS-GAVLGELPPG 225 >gi|152976200|ref|YP_001375717.1| DNA protecting protein DprA [Bacillus cereus subsp. cytotoxis NVH 391-98] gi|152024952|gb|ABS22722.1| DNA protecting protein DprA [Bacillus cytotoxicus NVH 391-98] Length = 291 Score = 42.3 bits (100), Expect = 0.027, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP EN L IW + ++E P Sbjct: 174 LGHGLQYMYPKENDRLY-AIWKKQMLLLTEYPP 205 >gi|116618376|ref|YP_818747.1| Rossmann fold nucleotide-binding protein for DNA uptake [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] gi|116097223|gb|ABJ62374.1| Rossmann fold nucleotide-binding protein for DNA uptake [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] Length = 288 Score = 42.3 bits (100), Expect = 0.027, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP +N+ L + GI +SE Sbjct: 169 IGTGLNIAYPAKNKVLQRQ-VAQHGIVLSEY 198 >gi|222097279|ref|YP_002531336.1| DNA processing protein (smf family) [Bacillus cereus Q1] gi|221241337|gb|ACM14047.1| DNA processing protein (smf family) [Bacillus cereus Q1] Length = 289 Score = 41.9 bits (99), Expect = 0.028, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E +W+ + ++E P Sbjct: 172 LGHGLSYIYPRENRYLYE-VWNEYILLLTEYPP 203 >gi|217961254|ref|YP_002339822.1| DNA processing Smf protein [Bacillus cereus AH187] gi|229140476|ref|ZP_04269031.1| DNA protecting protein DprA [Bacillus cereus BDRD-ST26] gi|217062931|gb|ACJ77181.1| DNA processing Smf protein [Bacillus cereus AH187] gi|228643037|gb|EEK99313.1| DNA protecting protein DprA [Bacillus cereus BDRD-ST26] Length = 289 Score = 41.9 bits (99), Expect = 0.028, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E +W+ + ++E P Sbjct: 172 LGHGLSYIYPRENRYLYE-VWNEYILLLTEYPP 203 >gi|324327731|gb|ADY22991.1| Smf family DNA processing protein [Bacillus thuringiensis serovar finitimus YBT-020] Length = 289 Score = 41.9 bits (99), Expect = 0.029, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E +W+ + ++E P Sbjct: 172 LGHGLSYIYPRENRYLYE-VWNEYILLLTEYPP 203 >gi|52141654|ref|YP_085175.1| SMF family nucleotide-binding protein [Bacillus cereus E33L] gi|51975123|gb|AAU16673.1| nucleotide-binding protein, Smf family [Bacillus cereus E33L] Length = 289 Score = 41.9 bits (99), Expect = 0.029, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 172 LGHGLSYIYPRENRYLYEAWNEYI-LLLTEYPP 203 >gi|42782926|ref|NP_980173.1| Smf family DNA processing protein [Bacillus cereus ATCC 10987] gi|42738853|gb|AAS42781.1| DNA processing protein (smf family) [Bacillus cereus ATCC 10987] Length = 289 Score = 41.9 bits (99), Expect = 0.029, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E +W+ + ++E P Sbjct: 172 LGHGLSYIYPRENRYLYE-VWNEYILLLTEYPP 203 >gi|332638610|ref|ZP_08417473.1| DNA protecting protein DprA [Weissella cibaria KACC 11862] Length = 288 Score = 41.9 bits (99), Expect = 0.030, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D YP NL +I G+ +SE Sbjct: 169 IGTGVDVAYPKRRDNLQTQI-SQQGLILSEY 198 >gi|229197944|ref|ZP_04324659.1| DNA protecting protein DprA [Bacillus cereus m1293] gi|228585523|gb|EEK43626.1| DNA protecting protein DprA [Bacillus cereus m1293] Length = 289 Score = 41.9 bits (99), Expect = 0.030, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E +W+ + ++E P Sbjct: 172 LGHGLSYIYPRENRYLYE-VWNEYILLLTEYPP 203 >gi|254430989|ref|ZP_05044692.1| SMF family protein [Cyanobium sp. PCC 7001] gi|197625442|gb|EDY38001.1| SMF family protein [Cyanobium sp. PCC 7001] Length = 354 Score = 41.9 bits (99), Expect = 0.030, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + L+ +YP + +L ++ + G+ +SE P G Sbjct: 166 LGTPLERVYPRHHGSLQRQVGER-GLLVSEQPAG 198 >gi|325859769|ref|ZP_08172899.1| DNA protecting protein DprA [Prevotella denticola CRIS 18C-A] gi|325482695|gb|EGC85698.1| DNA protecting protein DprA [Prevotella denticola CRIS 18C-A] Length = 372 Score = 41.9 bits (99), Expect = 0.031, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP +R+ ++ GG+ +E Sbjct: 174 LAHGLDDLYPRVHRDTAVQMMRRGGLL-TEY 203 >gi|225865815|ref|YP_002751193.1| DNA processing Smf protein [Bacillus cereus 03BB102] gi|229186074|ref|ZP_04313243.1| DNA protecting protein DprA [Bacillus cereus BGSC 6E1] gi|225790506|gb|ACO30723.1| DNA processing Smf protein [Bacillus cereus 03BB102] gi|228597250|gb|EEK54901.1| DNA protecting protein DprA [Bacillus cereus BGSC 6E1] Length = 289 Score = 41.9 bits (99), Expect = 0.031, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 172 LGHGLSYIYPKENRYLYEAWNEYI-LLLTEYPP 203 >gi|254721980|ref|ZP_05183769.1| DNA processing Smf protein [Bacillus anthracis str. A1055] Length = 289 Score = 41.9 bits (99), Expect = 0.031, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 172 LGHGLSYIYPKENRYLYEAWNEYI-LLLTEYPP 203 >gi|218904962|ref|YP_002452796.1| DNA processing Smf protein [Bacillus cereus AH820] gi|218534888|gb|ACK87286.1| DNA processing Smf protein [Bacillus cereus AH820] Length = 289 Score = 41.9 bits (99), Expect = 0.031, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 172 LGHGLSYIYPKENRYLYEAWNEYI-LLLTEYPP 203 >gi|315604539|ref|ZP_07879602.1| DNA protecting protein DprA [Actinomyces sp. oral taxon 180 str. F0310] gi|315313551|gb|EFU61605.1| DNA protecting protein DprA [Actinomyces sp. oral taxon 180 str. F0310] Length = 393 Score = 41.9 bits (99), Expect = 0.031, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG+ YP + + ++ +GG +SE+ Sbjct: 189 LAGGVANPYPACHGAVFRDVLTSGGALVSEVAP 221 >gi|327312940|ref|YP_004328377.1| DNA protecting protein DprA [Prevotella denticola F0289] gi|326944194|gb|AEA20079.1| DNA protecting protein DprA [Prevotella denticola F0289] Length = 372 Score = 41.9 bits (99), Expect = 0.032, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP +R+ ++ GG+ +E Sbjct: 174 LAHGLDDLYPRVHRDTAVQMMRRGGLL-TEY 203 >gi|118479056|ref|YP_896207.1| SMF family nucleotide-binding protein [Bacillus thuringiensis str. Al Hakam] gi|196047754|ref|ZP_03114950.1| DNA processing Smf protein [Bacillus cereus 03BB108] gi|228916471|ref|ZP_04080037.1| DNA protecting protein DprA [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] gi|228935148|ref|ZP_04097975.1| DNA protecting protein DprA [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] gi|228947553|ref|ZP_04109843.1| DNA protecting protein DprA [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|229092876|ref|ZP_04224010.1| DNA protecting protein DprA [Bacillus cereus Rock3-42] gi|118418281|gb|ABK86700.1| nucleotide-binding protein, SMF family [Bacillus thuringiensis str. Al Hakam] gi|196021413|gb|EDX60124.1| DNA processing Smf protein [Bacillus cereus 03BB108] gi|228690498|gb|EEL44281.1| DNA protecting protein DprA [Bacillus cereus Rock3-42] gi|228812073|gb|EEM58404.1| DNA protecting protein DprA [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228824513|gb|EEM70318.1| DNA protecting protein DprA [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] gi|228843050|gb|EEM88132.1| DNA protecting protein DprA [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] Length = 289 Score = 41.9 bits (99), Expect = 0.032, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 172 LGHGLSYIYPKENRYLYEAWNEYI-LLLTEYPP 203 >gi|260591927|ref|ZP_05857385.1| putative DNA processing protein DprA [Prevotella veroralis F0319] gi|260536211|gb|EEX18828.1| putative DNA processing protein DprA [Prevotella veroralis F0319] Length = 372 Score = 41.9 bits (99), Expect = 0.032, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP ++ ++ GG+ +E Sbjct: 174 LAHGLDDLYPRGHQETALKMIKQGGLL-TEY 203 >gi|224541327|ref|ZP_03681866.1| hypothetical protein CATMIT_00487 [Catenibacterium mitsuokai DSM 15897] gi|224525764|gb|EEF94869.1| hypothetical protein CATMIT_00487 [Catenibacterium mitsuokai DSM 15897] Length = 252 Score = 41.9 bits (99), Expect = 0.033, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D YPP N +L + N + +SE P Sbjct: 141 LGSGIDYPYPPMNEDLYY-VLKNE-LVLSEYP 170 >gi|288800404|ref|ZP_06405862.1| DNA processing protein DprA [Prevotella sp. oral taxon 299 str. F0039] gi|288332617|gb|EFC71097.1| DNA processing protein DprA [Prevotella sp. oral taxon 299 str. F0039] Length = 378 Score = 41.9 bits (99), Expect = 0.033, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP ++ ++ +GG+ +E Sbjct: 179 LAHGLDYLYPHAHKETALQMLSHGGLL-TEY 208 >gi|260061224|ref|YP_003194304.1| DNA processing protein DprA [Robiginitalea biformata HTCC2501] gi|88785356|gb|EAR16525.1| DNA processing protein DprA, putative [Robiginitalea biformata HTCC2501] Length = 412 Score = 41.9 bits (99), Expect = 0.034, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MA GLD LYP +R + + NGG +E P G Sbjct: 172 MAHGLDSLYPASHRKYRDALVANGGFL-TEFPSG 204 >gi|320096215|ref|ZP_08027801.1| DNA protecting protein DprA [Actinomyces sp. oral taxon 178 str. F0338] gi|319976841|gb|EFW08598.1| DNA protecting protein DprA [Actinomyces sp. oral taxon 178 str. F0338] Length = 318 Score = 41.9 bits (99), Expect = 0.035, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 15/32 (46%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGG+ YP + + D GG +SE P Sbjct: 116 AGGVGAPYPRAHAEDFRAVMDAGGAVVSEAPP 147 >gi|49478404|ref|YP_037895.1| SMF family nucleotide-binding protein [Bacillus thuringiensis serovar konkukian str. 97-27] gi|196042354|ref|ZP_03109625.1| DNA processing Smf protein [Bacillus cereus NVH0597-99] gi|49329960|gb|AAT60606.1| nucleotide-binding protein, SMF family [Bacillus thuringiensis serovar konkukian str. 97-27] gi|196026810|gb|EDX65446.1| DNA processing Smf protein [Bacillus cereus NVH0597-99] Length = 289 Score = 41.5 bits (98), Expect = 0.035, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 172 LGHGLSYIYPKENRYLYEAWNEYI-LLLTEYPP 203 >gi|288929781|ref|ZP_06423624.1| DNA processing protein DprA [Prevotella sp. oral taxon 317 str. F0108] gi|288328882|gb|EFC67470.1| DNA processing protein DprA [Prevotella sp. oral taxon 317 str. F0108] Length = 375 Score = 41.5 bits (98), Expect = 0.037, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP ++ E+ GG+ +E Sbjct: 177 LAHGLDYLYPTRHKQTANEMLTQGGLL-TEF 206 >gi|16126686|ref|NP_421250.1| dprA protein [Caulobacter crescentus CB15] gi|221235465|ref|YP_002517902.1| DNA processing protein [Caulobacter crescentus NA1000] gi|13423992|gb|AAK24418.1| dprA protein [Caulobacter crescentus CB15] gi|220964638|gb|ACL95994.1| DNA processing protein [Caulobacter crescentus NA1000] Length = 365 Score = 41.5 bits (98), Expect = 0.037, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG+ +YPPE+ L + G +SE Sbjct: 171 LGGGVGDIYPPEHDKLHARLAAE-GCVVSESAP 202 >gi|301055324|ref|YP_003793535.1| nucleotide-binding protein, Smf family [Bacillus anthracis CI] gi|300377493|gb|ADK06397.1| nucleotide-binding protein, Smf family [Bacillus cereus biovar anthracis str. CI] Length = 249 Score = 41.5 bits (98), Expect = 0.037, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 132 LGHGLSYIYPKENRYLYEAWNEYI-LLLTEYPP 163 >gi|295690151|ref|YP_003593844.1| DNA protecting protein DprA [Caulobacter segnis ATCC 21756] gi|295432054|gb|ADG11226.1| DNA protecting protein DprA [Caulobacter segnis ATCC 21756] Length = 365 Score = 41.5 bits (98), Expect = 0.037, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG+ +YPPE+ L + G +SE Sbjct: 171 LGGGVGDIYPPEHDRLHARLAAE-GCVVSESAP 202 >gi|307700240|ref|ZP_07637281.1| DNA protecting protein DprA [Mobiluncus mulieris FB024-16] gi|307614622|gb|EFN93850.1| DNA protecting protein DprA [Mobiluncus mulieris FB024-16] Length = 462 Score = 41.5 bits (98), Expect = 0.038, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL LYP N ++ ++I + G ISE P+ Sbjct: 219 AGGLRELYPAMNTSMFDQILET-GAIISEQPW 249 >gi|329947873|ref|ZP_08294805.1| putative DNA protecting protein DprA [Actinomyces sp. oral taxon 170 str. F0386] gi|328523497|gb|EGF50595.1| putative DNA protecting protein DprA [Actinomyces sp. oral taxon 170 str. F0386] Length = 468 Score = 41.5 bits (98), Expect = 0.038, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYP N +LE + + G ++E+P G Sbjct: 270 AGGVDRLYPVANTEVLEAVIAS-GALVAEVPPG 301 >gi|46580474|ref|YP_011282.1| DNA processing protein DprA [Desulfovibrio vulgaris str. Hildenborough] gi|46449893|gb|AAS96542.1| DNA processing protein DprA, putative [Desulfovibrio vulgaris str. Hildenborough] gi|311234216|gb|ADP87070.1| DNA protecting protein DprA [Desulfovibrio vulgaris RCH1] Length = 663 Score = 41.5 bits (98), Expect = 0.040, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +D YP +N +L E + + G+ ++E G Sbjct: 206 IDIRYPYDNEDLFERM-ASEGLLVTEFAPG 234 >gi|315222961|ref|ZP_07864840.1| DNA protecting protein DprA [Streptococcus anginosus F0211] gi|315187911|gb|EFU21647.1| DNA protecting protein DprA [Streptococcus anginosus F0211] Length = 292 Score = 41.5 bits (98), Expect = 0.041, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP N+ L + ++ + +SE Sbjct: 175 IGTGLDVFYPRANKKLQSYLGEHH-LVLSEY 204 >gi|291557378|emb|CBL34495.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Eubacterium siraeum V10Sc8a] Length = 492 Score = 41.5 bits (98), Expect = 0.041, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G+ YP + L + I DNGG+ +SE+ Sbjct: 167 LACGITIDYPNNSFGLRKNIIDNGGLILSEL 197 >gi|228928882|ref|ZP_04091914.1| DNA protecting protein DprA [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] gi|229123348|ref|ZP_04252552.1| DNA protecting protein DprA [Bacillus cereus 95/8201] gi|228660124|gb|EEL15760.1| DNA protecting protein DprA [Bacillus cereus 95/8201] gi|228830689|gb|EEM76294.1| DNA protecting protein DprA [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] Length = 211 Score = 41.5 bits (98), Expect = 0.041, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 94 LGHGLSYIYPKENRYLYEAWNEYI-LLLTEYPP 125 >gi|319941689|ref|ZP_08016012.1| hypothetical protein HMPREF9464_01231 [Sutterella wadsworthensis 3_1_45B] gi|319804810|gb|EFW01672.1| hypothetical protein HMPREF9464_01231 [Sutterella wadsworthensis 3_1_45B] Length = 278 Score = 41.5 bits (98), Expect = 0.041, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + L +PPEN L +EI ++ G+ +SE P Sbjct: 142 LGTPLSFPWPPENARLADEIAES-GLILSECP 172 >gi|269977905|ref|ZP_06184859.1| SMF protein [Mobiluncus mulieris 28-1] gi|269933871|gb|EEZ90451.1| SMF protein [Mobiluncus mulieris 28-1] Length = 462 Score = 41.5 bits (98), Expect = 0.042, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL LYP N ++ ++I + G ISE P+ Sbjct: 219 AGGLRELYPAMNTSMFDQILET-GAIISEQPW 249 >gi|49186684|ref|YP_029936.1| nucleotide-binding SMF protein [Bacillus anthracis str. Sterne] gi|65321161|ref|ZP_00394120.1| COG0758: Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Bacillus anthracis str. A2012] gi|227813258|ref|YP_002813267.1| DNA processing Smf protein [Bacillus anthracis str. CDC 684] gi|254735872|ref|ZP_05193578.1| DNA processing Smf protein [Bacillus anthracis str. Western North America USA6153] gi|254751203|ref|ZP_05203242.1| DNA processing Smf protein [Bacillus anthracis str. Vollum] gi|254759314|ref|ZP_05211339.1| DNA processing Smf protein [Bacillus anthracis str. Australia 94] gi|49180611|gb|AAT55987.1| nucleotide-binding SMF protein [Bacillus anthracis str. Sterne] gi|227003266|gb|ACP13009.1| DNA processing Smf protein [Bacillus anthracis str. CDC 684] Length = 221 Score = 41.5 bits (98), Expect = 0.042, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 172 LGHGLSYIYPKENRYLYEAWNEYI-LLLTEYPP 203 >gi|319947074|ref|ZP_08021308.1| DNA protecting protein DprA [Streptococcus australis ATCC 700641] gi|319747122|gb|EFV99381.1| DNA protecting protein DprA [Streptococcus australis ATCC 700641] Length = 280 Score = 41.5 bits (98), Expect = 0.042, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + + + + ++E G Sbjct: 163 IGTGLDVFYPRSNKQLQKYMSGSH-LVLTEYGPG 195 >gi|309804174|ref|ZP_07698252.1| putative DNA protecting protein DprA [Lactobacillus iners LactinV 11V1-d] gi|308163757|gb|EFO66026.1| putative DNA protecting protein DprA [Lactobacillus iners LactinV 11V1-d] Length = 254 Score = 41.5 bits (98), Expect = 0.042, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP +N L +EI+ G+ +SE Sbjct: 167 IGNGLNYFYPHQNEGLQQEIF-RKGLVLSEY 196 >gi|254683459|ref|ZP_05147319.1| DNA processing Smf protein [Bacillus anthracis str. CNEVA-9066] Length = 221 Score = 41.5 bits (98), Expect = 0.042, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 172 LGHGLSYIYPKENRYLYEAWNEYI-LLLTEYPP 203 >gi|154174599|ref|YP_001408002.1| DNA protecting protein DprA [Campylobacter curvus 525.92] gi|112803316|gb|EAU00660.1| DNA protecting protein DprA [Campylobacter curvus 525.92] Length = 257 Score = 41.5 bits (98), Expect = 0.042, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD +YPP N ++EI++N +A+SE Sbjct: 92 ASGLDIIYPPSNAKFIKEIYENS-LALSEY 120 >gi|228960050|ref|ZP_04121714.1| DNA protecting protein DprA [Bacillus thuringiensis serovar pakistani str. T13001] gi|228799566|gb|EEM46519.1| DNA protecting protein DprA [Bacillus thuringiensis serovar pakistani str. T13001] Length = 278 Score = 41.5 bits (98), Expect = 0.043, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR+L E +W + ++E P Sbjct: 161 LGHGLSFMYPKENRHLYE-MWKEYILLLTEYPP 192 >gi|227875948|ref|ZP_03994071.1| DNA-binding/uptake protein [Mobiluncus mulieris ATCC 35243] gi|227843480|gb|EEJ53666.1| DNA-binding/uptake protein [Mobiluncus mulieris ATCC 35243] Length = 462 Score = 41.5 bits (98), Expect = 0.043, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL LYP N ++ ++I + G ISE P+ Sbjct: 219 AGGLRELYPAMNTSMFDQILET-GAIISEQPW 249 >gi|319956137|ref|YP_004167400.1| smf family protein [Nitratifractor salsuginis DSM 16511] gi|319418541|gb|ADV45651.1| SMF family protein [Nitratifractor salsuginis DSM 16511] Length = 259 Score = 41.5 bits (98), Expect = 0.043, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D YP N L+E I + G+ +S G Sbjct: 92 LGTGVDLRYPAVNAPLIESI-EKEGLLLSRFEPG 124 >gi|228909659|ref|ZP_04073482.1| DNA protecting protein DprA [Bacillus thuringiensis IBL 200] gi|228849948|gb|EEM94779.1| DNA protecting protein DprA [Bacillus thuringiensis IBL 200] Length = 289 Score = 41.5 bits (98), Expect = 0.043, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR+L E +W + ++E P Sbjct: 172 LGHGLSFMYPKENRHLYE-MWKEYILLLTEYPP 203 >gi|306819227|ref|ZP_07452938.1| DNA processing factor [Mobiluncus mulieris ATCC 35239] gi|304648009|gb|EFM45323.1| DNA processing factor [Mobiluncus mulieris ATCC 35239] Length = 462 Score = 41.5 bits (98), Expect = 0.044, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL LYP N ++ ++I + G ISE P+ Sbjct: 219 AGGLRELYPAMNTSMFDQILET-GAIISEQPW 249 >gi|228940922|ref|ZP_04103481.1| DNA protecting protein DprA [Bacillus thuringiensis serovar berliner ATCC 10792] gi|228973851|ref|ZP_04134427.1| DNA protecting protein DprA [Bacillus thuringiensis serovar thuringiensis str. T01001] gi|228980441|ref|ZP_04140751.1| DNA protecting protein DprA [Bacillus thuringiensis Bt407] gi|228779261|gb|EEM27518.1| DNA protecting protein DprA [Bacillus thuringiensis Bt407] gi|228785876|gb|EEM33879.1| DNA protecting protein DprA [Bacillus thuringiensis serovar thuringiensis str. T01001] gi|228818758|gb|EEM64824.1| DNA protecting protein DprA [Bacillus thuringiensis serovar berliner ATCC 10792] gi|326941603|gb|AEA17499.1| nucleotide-binding SMF protein [Bacillus thuringiensis serovar chinensis CT-43] Length = 289 Score = 41.5 bits (98), Expect = 0.044, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR+L E +W + ++E P Sbjct: 172 LGHGLSFMYPKENRHLYE-MWKEYILLLTEYPP 203 >gi|291531139|emb|CBK96724.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Eubacterium siraeum 70/3] Length = 500 Score = 41.5 bits (98), Expect = 0.045, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G+ YP + L + I DNGG+ +SE+ Sbjct: 167 LACGITIDYPNNSFGLRKNIIDNGGLILSEL 197 >gi|229146405|ref|ZP_04274776.1| DNA protecting protein DprA [Bacillus cereus BDRD-ST24] gi|228637038|gb|EEK93497.1| DNA protecting protein DprA [Bacillus cereus BDRD-ST24] Length = 289 Score = 41.5 bits (98), Expect = 0.045, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR+L E +W + ++E P Sbjct: 172 LGHGLSFMYPKENRHLYE-MWKEYILLLTEYPP 203 >gi|30021922|ref|NP_833553.1| nucleotide-binding SMF protein [Bacillus cereus ATCC 14579] gi|229129110|ref|ZP_04258083.1| DNA protecting protein DprA [Bacillus cereus BDRD-Cer4] gi|296504329|ref|YP_003666029.1| nucleotide-binding SMF protein [Bacillus thuringiensis BMB171] gi|29897478|gb|AAP10754.1| Nucleotide-binding SMF protein [Bacillus cereus ATCC 14579] gi|228654347|gb|EEL10212.1| DNA protecting protein DprA [Bacillus cereus BDRD-Cer4] gi|296325381|gb|ADH08309.1| nucleotide-binding SMF protein [Bacillus thuringiensis BMB171] Length = 289 Score = 41.5 bits (98), Expect = 0.045, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR+L E +W + ++E P Sbjct: 172 LGHGLSFMYPKENRHLYE-MWKEYILLLTEYPP 203 >gi|167750872|ref|ZP_02422999.1| hypothetical protein EUBSIR_01856 [Eubacterium siraeum DSM 15702] gi|167656051|gb|EDS00181.1| hypothetical protein EUBSIR_01856 [Eubacterium siraeum DSM 15702] Length = 500 Score = 41.5 bits (98), Expect = 0.045, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G+ YP + L + I DNGG+ +SE+ Sbjct: 167 LACGITIDYPNNSFGLRKNIIDNGGLILSEL 197 >gi|330878711|gb|EGH12860.1| hypothetical protein PSYMP_22558 [Pseudomonas syringae pv. morsprunorum str. M302280PT] Length = 371 Score = 41.1 bits (97), Expect = 0.046, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 15/31 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ YP + L EEI GG +SE Sbjct: 202 LGTGILQNYPKGSNELREEILRAGGSIVSEY 232 >gi|320532033|ref|ZP_08032923.1| putative DNA protecting protein DprA [Actinomyces sp. oral taxon 171 str. F0337] gi|320135746|gb|EFW27804.1| putative DNA protecting protein DprA [Actinomyces sp. oral taxon 171 str. F0337] Length = 445 Score = 41.1 bits (97), Expect = 0.047, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYP N +LE + + G ++E+P G Sbjct: 247 AGGVDRLYPVGNTGVLEAVIAS-GALVAEVPPG 278 >gi|206972726|ref|ZP_03233662.1| DNA processing Smf protein [Bacillus cereus AH1134] gi|206732348|gb|EDZ49534.1| DNA processing Smf protein [Bacillus cereus AH1134] Length = 289 Score = 41.1 bits (97), Expect = 0.047, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR+L E +W + ++E P Sbjct: 172 LGHGLSFMYPKENRHLYE-MWKEYILLLTEYPP 203 >gi|218232997|ref|YP_002368635.1| DNA processing Smf protein [Bacillus cereus B4264] gi|229152033|ref|ZP_04280228.1| DNA protecting protein DprA [Bacillus cereus m1550] gi|218160954|gb|ACK60946.1| DNA processing Smf protein [Bacillus cereus B4264] gi|228631382|gb|EEK88016.1| DNA protecting protein DprA [Bacillus cereus m1550] Length = 289 Score = 41.1 bits (97), Expect = 0.048, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR+L E +W + ++E P Sbjct: 172 LGHGLSFMYPKENRHLYE-MWKEYILLLTEYPP 203 >gi|162453392|ref|YP_001615759.1| DNA processing chain A [Sorangium cellulosum 'So ce 56'] gi|161163974|emb|CAN95279.1| DNA processing chain A [Sorangium cellulosum 'So ce 56'] Length = 350 Score = 41.1 bits (97), Expect = 0.050, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 14/31 (45%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 GG YP E+ L + GG ++ +P Sbjct: 128 GGGHAHPYPREHAALFARVLAAGGALLARVP 158 >gi|329962716|ref|ZP_08300639.1| DNA protecting protein DprA [Bacteroides fluxus YIT 12057] gi|328529550|gb|EGF56453.1| DNA protecting protein DprA [Bacteroides fluxus YIT 12057] Length = 371 Score = 41.1 bits (97), Expect = 0.051, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G+D +YP +R ++ +GG+ +E Sbjct: 176 LAHGMDRIYPFVHRKTAVDMLADGGLL-TEF 205 >gi|218898987|ref|YP_002447398.1| DNA processing Smf protein [Bacillus cereus G9842] gi|228902337|ref|ZP_04066494.1| DNA protecting protein DprA [Bacillus thuringiensis IBL 4222] gi|228966779|ref|ZP_04127823.1| DNA protecting protein DprA [Bacillus thuringiensis serovar sotto str. T04001] gi|218541375|gb|ACK93769.1| DNA processing Smf protein [Bacillus cereus G9842] gi|228792878|gb|EEM40436.1| DNA protecting protein DprA [Bacillus thuringiensis serovar sotto str. T04001] gi|228857306|gb|EEN01809.1| DNA protecting protein DprA [Bacillus thuringiensis IBL 4222] Length = 289 Score = 41.1 bits (97), Expect = 0.051, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR+L E +W + ++E P Sbjct: 172 LGHGLSFMYPKENRHLYE-MWKEYILLLTEYPP 203 >gi|326771766|ref|ZP_08231051.1| DNA protecting protein DprA [Actinomyces viscosus C505] gi|326637899|gb|EGE38800.1| DNA protecting protein DprA [Actinomyces viscosus C505] Length = 462 Score = 41.1 bits (97), Expect = 0.051, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYP N +LE + + G ++E+P G Sbjct: 256 AGGVDRLYPVGNTGVLEAVIAS-GALVAEVPPG 287 >gi|194014384|ref|ZP_03053001.1| DNA protecting protein DprA [Bacillus pumilus ATCC 7061] gi|194013410|gb|EDW22975.1| DNA protecting protein DprA [Bacillus pumilus ATCC 7061] Length = 300 Score = 41.1 bits (97), Expect = 0.051, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG LYP E+ + E + ++ + +SE P Sbjct: 174 IAGGFQHLYPKEHVQMAEYMGEHH-LLLSEHPP 205 >gi|319939098|ref|ZP_08013462.1| DNA processing Smf protein [Streptococcus anginosus 1_2_62CV] gi|319812148|gb|EFW08414.1| DNA processing Smf protein [Streptococcus anginosus 1_2_62CV] Length = 280 Score = 41.1 bits (97), Expect = 0.051, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP N+ L + ++ + +SE Sbjct: 163 IGTGLDVFYPRANKKLQSYLGEHH-LVLSEY 192 >gi|327441066|dbj|BAK17431.1| predicted Rossmann fold nucleotide-binding protein [Solibacillus silvestris StLB046] Length = 297 Score = 41.1 bits (97), Expect = 0.052, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL YPP+N+ L + + I+E P Sbjct: 175 LGHGLFHNYPPQNKELNAYMASEH-LLITEYPP 206 >gi|228986977|ref|ZP_04147103.1| DNA protecting protein DprA [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] gi|228772755|gb|EEM21195.1| DNA protecting protein DprA [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] Length = 278 Score = 41.1 bits (97), Expect = 0.052, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 161 LGHGLSYIYPKENRCLYEAWNEYI-LLLTEYPP 192 >gi|222151082|ref|YP_002560236.1| hypothetical protein MCCL_0833 [Macrococcus caseolyticus JCSC5402] gi|222120205|dbj|BAH17540.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402] Length = 295 Score = 41.1 bits (97), Expect = 0.053, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G D +YP E L+ + + I ISE P Sbjct: 172 LAYGHDFIYPAE-TALIRRLMEKRHIVISEYPP 203 >gi|297530615|ref|YP_003671890.1| DNA protecting protein DprA [Geobacillus sp. C56-T3] gi|297253867|gb|ADI27313.1| DNA protecting protein DprA [Geobacillus sp. C56-T3] Length = 293 Score = 41.1 bits (97), Expect = 0.053, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGLD +YP E+R + N + I+E P Sbjct: 175 IAGGLDHIYPKEHRP-FATLLMNEQLVIAEHPP 206 >gi|261419410|ref|YP_003253092.1| DNA protecting protein DprA [Geobacillus sp. Y412MC61] gi|319766225|ref|YP_004131726.1| DNA protecting protein DprA [Geobacillus sp. Y412MC52] gi|261375867|gb|ACX78610.1| DNA protecting protein DprA [Geobacillus sp. Y412MC61] gi|317111091|gb|ADU93583.1| DNA protecting protein DprA [Geobacillus sp. Y412MC52] Length = 293 Score = 41.1 bits (97), Expect = 0.053, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGLD +YP E+R + N + I+E P Sbjct: 175 IAGGLDHIYPKEHRP-FATLLMNEQLVIAEHPP 206 >gi|126725956|ref|ZP_01741798.1| DNA processing protein DprA, putative [Rhodobacterales bacterium HTCC2150] gi|126705160|gb|EBA04251.1| DNA processing protein DprA, putative [Rhodobacterales bacterium HTCC2150] Length = 390 Score = 41.1 bits (97), Expect = 0.053, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Query: 9 YPPENRNLLEEIWDNGGIAISEIPFG 34 YP EN +L I G+ ISE P G Sbjct: 187 YPAENTDLAANI-SRDGLVISEQPLG 211 >gi|304321726|ref|YP_003855369.1| DNA processing protein [Parvularcula bermudensis HTCC2503] gi|303300628|gb|ADM10227.1| DNA processing protein [Parvularcula bermudensis HTCC2503] Length = 371 Score = 41.1 bits (97), Expect = 0.055, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 +AGG+D +YPP++ +L I G+ ++E G Sbjct: 169 IAGGIDSIYPPDHADLYRAIGKQ-GLILAEDAIG 201 >gi|47570335|ref|ZP_00240980.1| MW1132 [Bacillus cereus G9241] gi|47553000|gb|EAL11406.1| MW1132 [Bacillus cereus G9241] Length = 284 Score = 41.1 bits (97), Expect = 0.055, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 172 LGHGLSYIYPKENRCLYEAWNEYI-LLLTEYPP 203 >gi|157692290|ref|YP_001486752.1| Smf family DNA processing protein [Bacillus pumilus SAFR-032] gi|157681048|gb|ABV62192.1| Smf family DNA processing protein [Bacillus pumilus SAFR-032] Length = 300 Score = 41.1 bits (97), Expect = 0.056, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG LYP E+ + E + ++ + +SE P Sbjct: 174 IAGGFQHLYPKEHVQMAEYMGEHH-LLLSEHPP 205 >gi|297626585|ref|YP_003688348.1| DNA processing / uptake protein [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] gi|296922350|emb|CBL56922.1| DNA processing / uptake protein [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] Length = 386 Score = 41.1 bits (97), Expect = 0.057, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGGLD YP N LL++I + ++EIP G Sbjct: 180 MAGGLDGWYPRGNSRLLDQIAGE-CVVVTEIPPG 212 >gi|228922588|ref|ZP_04085888.1| DNA protecting protein DprA [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] gi|228837017|gb|EEM82358.1| DNA protecting protein DprA [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] Length = 289 Score = 41.1 bits (97), Expect = 0.057, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR+L E +W + ++E P Sbjct: 172 LGHGLSFMYPKENRHLYE-MWKEYILLLTEYPP 203 >gi|87200216|ref|YP_497473.1| SMF protein [Novosphingobium aromaticivorans DSM 12444] gi|87135897|gb|ABD26639.1| SMF protein [Novosphingobium aromaticivorans DSM 12444] Length = 345 Score = 41.1 bits (97), Expect = 0.057, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 14/31 (45%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ YP + L + I GG +SE Sbjct: 204 LGTGMLEDYPKGSGRLRDHILATGGAIVSEY 234 >gi|228954110|ref|ZP_04116139.1| DNA protecting protein DprA [Bacillus thuringiensis serovar kurstaki str. T03a001] gi|229071332|ref|ZP_04204555.1| DNA protecting protein DprA [Bacillus cereus F65185] gi|229081089|ref|ZP_04213599.1| DNA protecting protein DprA [Bacillus cereus Rock4-2] gi|229180110|ref|ZP_04307454.1| DNA protecting protein DprA [Bacillus cereus 172560W] gi|229192003|ref|ZP_04318973.1| DNA protecting protein DprA [Bacillus cereus ATCC 10876] gi|228591554|gb|EEK49403.1| DNA protecting protein DprA [Bacillus cereus ATCC 10876] gi|228603319|gb|EEK60796.1| DNA protecting protein DprA [Bacillus cereus 172560W] gi|228702133|gb|EEL54609.1| DNA protecting protein DprA [Bacillus cereus Rock4-2] gi|228711786|gb|EEL63738.1| DNA protecting protein DprA [Bacillus cereus F65185] gi|228805676|gb|EEM52266.1| DNA protecting protein DprA [Bacillus thuringiensis serovar kurstaki str. T03a001] Length = 289 Score = 41.1 bits (97), Expect = 0.059, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E +W + ++E P Sbjct: 172 LGHGLSFMYPKENRPLYE-MWKEYILLLTEYPP 203 >gi|259500644|ref|ZP_05743546.1| conserved hypothetical protein [Lactobacillus iners DSM 13335] gi|302191333|ref|ZP_07267587.1| SMF protein [Lactobacillus iners AB-1] gi|309809242|ref|ZP_07703111.1| DNA protecting protein DprA [Lactobacillus iners SPIN 2503V10-D] gi|325911992|ref|ZP_08174394.1| DNA protecting protein DprA [Lactobacillus iners UPII 143-D] gi|325912850|ref|ZP_08175228.1| DNA protecting protein DprA [Lactobacillus iners UPII 60-B] gi|259168028|gb|EEW52523.1| conserved hypothetical protein [Lactobacillus iners DSM 13335] gi|308170355|gb|EFO72379.1| DNA protecting protein DprA [Lactobacillus iners SPIN 2503V10-D] gi|325476177|gb|EGC79341.1| DNA protecting protein DprA [Lactobacillus iners UPII 143-D] gi|325477843|gb|EGC80977.1| DNA protecting protein DprA [Lactobacillus iners UPII 60-B] Length = 281 Score = 40.7 bits (96), Expect = 0.061, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP +N L +EI+ G+ +SE Sbjct: 167 IGNGLNYFYPHQNEGLQQEIF-RKGLVLSEY 196 >gi|309807509|ref|ZP_07701466.1| DNA protecting protein DprA [Lactobacillus iners LactinV 01V1-a] gi|308169236|gb|EFO71297.1| DNA protecting protein DprA [Lactobacillus iners LactinV 01V1-a] Length = 281 Score = 40.7 bits (96), Expect = 0.062, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP +N L +EI+ G+ +SE Sbjct: 167 IGNGLNYFYPHQNEGLQQEIF-RKGLVLSEY 196 >gi|309806750|ref|ZP_07700744.1| DNA protecting protein DprA [Lactobacillus iners LactinV 03V1-b] gi|308166865|gb|EFO69050.1| DNA protecting protein DprA [Lactobacillus iners LactinV 03V1-b] Length = 281 Score = 40.7 bits (96), Expect = 0.063, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP +N L +EI+ G+ +SE Sbjct: 167 IGNGLNYFYPHQNEGLQQEIF-RKGLVLSEY 196 >gi|309805709|ref|ZP_07699749.1| DNA protecting protein DprA [Lactobacillus iners LactinV 09V1-c] gi|312871383|ref|ZP_07731478.1| DNA protecting protein DprA [Lactobacillus iners LEAF 3008A-a] gi|312872344|ref|ZP_07732414.1| DNA protecting protein DprA [Lactobacillus iners LEAF 2062A-h1] gi|312873943|ref|ZP_07733979.1| DNA protecting protein DprA [Lactobacillus iners LEAF 2052A-d] gi|312875492|ref|ZP_07735495.1| DNA protecting protein DprA [Lactobacillus iners LEAF 2053A-b] gi|315653521|ref|ZP_07906442.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus iners ATCC 55195] gi|329921333|ref|ZP_08277771.1| DNA protecting protein DprA [Lactobacillus iners SPIN 1401G] gi|308164962|gb|EFO67205.1| DNA protecting protein DprA [Lactobacillus iners LactinV 09V1-c] gi|311089003|gb|EFQ47444.1| DNA protecting protein DprA [Lactobacillus iners LEAF 2053A-b] gi|311090492|gb|EFQ48900.1| DNA protecting protein DprA [Lactobacillus iners LEAF 2052A-d] gi|311092167|gb|EFQ50541.1| DNA protecting protein DprA [Lactobacillus iners LEAF 2062A-h1] gi|311093036|gb|EFQ51385.1| DNA protecting protein DprA [Lactobacillus iners LEAF 3008A-a] gi|315489212|gb|EFU78853.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus iners ATCC 55195] gi|328934625|gb|EGG31129.1| DNA protecting protein DprA [Lactobacillus iners SPIN 1401G] Length = 281 Score = 40.7 bits (96), Expect = 0.063, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ YP +N L +EI+ G+ +SE Sbjct: 167 IGNGLNYFYPHQNEGLQQEIF-RKGLVLSEY 196 >gi|323351564|ref|ZP_08087218.1| DNA processing Smf protein [Streptococcus sanguinis VMC66] gi|322122050|gb|EFX93776.1| DNA processing Smf protein [Streptococcus sanguinis VMC66] Length = 280 Score = 40.7 bits (96), Expect = 0.063, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP N+ L I N + ++E Sbjct: 163 IGTGLDVFYPKANKKLQAYIGKNH-LLLTEY 192 >gi|110637848|ref|YP_678055.1| DNA processing protein [Cytophaga hutchinsonii ATCC 33406] gi|110280529|gb|ABG58715.1| DNA processing protein [Cytophaga hutchinsonii ATCC 33406] Length = 364 Score = 40.7 bits (96), Expect = 0.063, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 MA G + +YP ++N ++ + GG+ SE Sbjct: 172 MANGTNIIYPSVHKNTALKMLEQGGLL-SEY 201 >gi|193213418|ref|YP_001999371.1| DNA protecting protein DprA [Chlorobaculum parvum NCIB 8327] gi|193086895|gb|ACF12171.1| DNA protecting protein DprA [Chlorobaculum parvum NCIB 8327] Length = 387 Score = 40.7 bits (96), Expect = 0.065, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Query: 1 MAGGLDCLY--PPENRNLLEEIWDNGGIAISE 30 + G+D +Y P L I ++GG ++E Sbjct: 187 LGCGVDTIYTDPAG--RLWPRILESGGAIVAE 216 >gi|283768286|ref|ZP_06341198.1| DNA protecting protein DprA [Bulleidia extructa W1219] gi|283104678|gb|EFC06050.1| DNA protecting protein DprA [Bulleidia extructa W1219] Length = 241 Score = 40.7 bits (96), Expect = 0.067, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + GL+ YP N L ++ + +SE P Sbjct: 130 IGSGLEVHYPRCNEKLYQQ-LSRNHLILSEWP 160 >gi|157165513|ref|YP_001467157.1| DNA protecting protein DprA [Campylobacter concisus 13826] gi|112801459|gb|EAT98803.1| DNA protecting protein DprA [Campylobacter concisus 13826] Length = 256 Score = 40.7 bits (96), Expect = 0.067, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD +YP +N+ + EI++N G+A+SE Sbjct: 89 ANGLDIIYPAQNKVAIREIYEN-GLALSEY 117 >gi|229162770|ref|ZP_04290727.1| DNA protecting protein DprA [Bacillus cereus R309803] gi|228620652|gb|EEK77521.1| DNA protecting protein DprA [Bacillus cereus R309803] Length = 278 Score = 40.7 bits (96), Expect = 0.068, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR+L E +W + ++E P Sbjct: 161 LGHGLSYMYPKENRHLYE-VWKEYILLLTEYPP 192 >gi|288932420|ref|YP_003436480.1| SMF family protein [Ferroglobus placidus DSM 10642] gi|288894668|gb|ADC66205.1| SMF family protein [Ferroglobus placidus DSM 10642] Length = 246 Score = 40.7 bits (96), Expect = 0.069, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + L+ YP EN+ L E I +AIS+ P G Sbjct: 108 LGTPLNKFYPAENKPLQELIMKEH-LAISQYPIG 140 >gi|229157410|ref|ZP_04285488.1| DNA protecting protein DprA [Bacillus cereus ATCC 4342] gi|228626137|gb|EEK82886.1| DNA protecting protein DprA [Bacillus cereus ATCC 4342] Length = 211 Score = 40.7 bits (96), Expect = 0.069, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E + + ++E P Sbjct: 94 LGHGLSYIYPKENRCLYEAWNEYI-LLLTEYPP 125 >gi|326803547|ref|YP_004321365.1| DNA protecting protein DprA [Aerococcus urinae ACS-120-V-Col10a] gi|326651685|gb|AEA01868.1| DNA protecting protein DprA [Aerococcus urinae ACS-120-V-Col10a] Length = 294 Score = 40.7 bits (96), Expect = 0.071, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + GL YP E+R L + I N + +S +P Sbjct: 173 IGTGLAKCYPKEHRALQDFIAKNH-LLVSPLP 203 >gi|315924318|ref|ZP_07920541.1| DNA protecting protein DprA [Pseudoramibacter alactolyticus ATCC 23263] gi|315622389|gb|EFV02347.1| DNA protecting protein DprA [Pseudoramibacter alactolyticus ATCC 23263] Length = 302 Score = 40.7 bits (96), Expect = 0.071, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 11/24 (45%) Query: 10 PPENRNLLEEIWDNGGIAISEIPF 33 P N+ L EI GG ISE Sbjct: 188 PSSNQELANEIVKGGGCLISEYSP 211 >gi|78212025|ref|YP_380804.1| Smf family DNA processing protein [Synechococcus sp. CC9605] gi|78196484|gb|ABB34249.1| putative DNA processing protein (Smf family) [Synechococcus sp. CC9605] Length = 338 Score = 40.7 bits (96), Expect = 0.072, Method: Composition-based stats. Identities = 8/29 (27%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAIS 29 + LD +YP +R+L ++ G+ +S Sbjct: 156 LGTPLDRVYPAHHRSLQQQ-VGRQGLLVS 183 >gi|322385533|ref|ZP_08059177.1| DNA processing Smf protein [Streptococcus cristatus ATCC 51100] gi|321270271|gb|EFX53187.1| DNA processing Smf protein [Streptococcus cristatus ATCC 51100] Length = 280 Score = 40.7 bits (96), Expect = 0.077, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP N+ L I N + ++E Sbjct: 163 IGTGLDVFYPKANQKLQAYIGKNH-LLLTEY 192 >gi|332074878|gb|EGI85350.1| DNA protecting protein DprA [Streptococcus pneumoniae GA41301] Length = 282 Score = 40.3 bits (95), Expect = 0.079, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP N+ L + I N +A+SE G Sbjct: 165 IGTGLDVFYPKANKRLQDYI-GNDYLALSEYGPG 197 >gi|228474988|ref|ZP_04059716.1| DNA protecting protein DprA [Staphylococcus hominis SK119] gi|228270973|gb|EEK12361.1| DNA protecting protein DprA [Staphylococcus hominis SK119] Length = 290 Score = 40.3 bits (95), Expect = 0.079, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G YP E R L I + G+ ISE P Sbjct: 170 LGFGHLNHYPKETRKL-RNIIEETGLVISEYPP 201 >gi|307543966|ref|YP_003896445.1| DNA processing protein [Halomonas elongata DSM 2581] gi|307215990|emb|CBV41260.1| K04096 DNA processing protein [Halomonas elongata DSM 2581] Length = 366 Score = 40.3 bits (95), Expect = 0.080, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +R L E + + GG+ +SE P G Sbjct: 172 LGCGVDVIYPARHRRLHERLREPGGLLLSEHPPG 205 >gi|264668112|gb|ACY71500.1| SMF protein [Anabaena circinalis AWQC310F] Length = 208 Score = 40.3 bits (95), Expect = 0.080, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 M G+D +YP +N + +I + GI ISE P Sbjct: 13 MGTGVDVIYPHKNSHKSPQILKS-GIVISEYP 43 >gi|229047520|ref|ZP_04193110.1| DNA protecting protein DprA [Bacillus cereus AH676] gi|228723767|gb|EEL75122.1| DNA protecting protein DprA [Bacillus cereus AH676] Length = 275 Score = 40.3 bits (95), Expect = 0.080, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E +W + ++E P Sbjct: 172 LGHGLSFMYPKENRLLYE-MWKEYILLLTEYPP 203 >gi|314936590|ref|ZP_07843937.1| DNA protecting protein DprA [Staphylococcus hominis subsp. hominis C80] gi|313655209|gb|EFS18954.1| DNA protecting protein DprA [Staphylococcus hominis subsp. hominis C80] Length = 290 Score = 40.3 bits (95), Expect = 0.081, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G YP E R L I + G+ ISE P Sbjct: 170 LGFGHLNHYPKETRKL-RNIIEETGLVISEYPP 201 >gi|118586887|ref|ZP_01544321.1| DNA processing protein DprA [Oenococcus oeni ATCC BAA-1163] gi|118432719|gb|EAV39451.1| DNA processing protein DprA [Oenococcus oeni ATCC BAA-1163] Length = 286 Score = 40.3 bits (95), Expect = 0.085, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G + YP EN+++ + I + G+ +SE Sbjct: 177 IGNGTNISYPAENQSIQKRII-SDGLLLSEYFP 208 >gi|218848091|ref|YP_002454798.1| DNA processing protein, Smf family [Bacillus cereus G9842] gi|218546222|gb|ACK98615.1| DNA processing protein, Smf family [Bacillus cereus G9842] Length = 290 Score = 40.3 bits (95), Expect = 0.088, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 14/31 (45%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + +D + P ++ EI G+ ISE Sbjct: 179 LPSPIDDVTPKSHKPYANEILAKDGLLISEY 209 >gi|89511724|emb|CAI68109.1| DNA processing SMF protein [Lactococcus lactis subsp. cremoris] gi|89511730|emb|CAI68112.1| DNA processing SMF protein [Lactococcus lactis subsp. cremoris] Length = 282 Score = 40.3 bits (95), Expect = 0.088, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR + E + +SE G Sbjct: 164 IGTGLDIFYPLENRKIQEY-LAKYQLVLSEYSLG 196 >gi|229111305|ref|ZP_04240858.1| DNA protecting protein DprA [Bacillus cereus Rock1-15] gi|228672081|gb|EEL27372.1| DNA protecting protein DprA [Bacillus cereus Rock1-15] Length = 289 Score = 40.3 bits (95), Expect = 0.090, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR L E +W + ++E P Sbjct: 172 LGHGLSFMYPKENRLLYE-MWKEYILLLTEYPP 203 >gi|281491734|ref|YP_003353714.1| DNA processing protein [Lactococcus lactis subsp. lactis KF147] gi|89511689|emb|CAI68095.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] gi|89511691|emb|CAI68096.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] gi|89511695|emb|CAI68097.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] gi|89511697|emb|CAI68098.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis bv. diacetylactis] gi|89511701|emb|CAI68099.1| DNA processing SMF protein [Lactococcus lactis subsp. cremoris] gi|89511710|emb|CAI68101.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] gi|89511714|emb|CAI68103.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] gi|89511716|emb|CAI68104.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] gi|281375448|gb|ADA64958.1| DNA processing protein [Lactococcus lactis subsp. lactis KF147] Length = 282 Score = 40.3 bits (95), Expect = 0.094, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR + E + N + +SE G Sbjct: 164 IGTGLDIFYPLENRKIQEYLAKNQ-LILSEYSVG 196 >gi|229174500|ref|ZP_04302032.1| DNA protecting protein DprA [Bacillus cereus MM3] gi|228609060|gb|EEK66350.1| DNA protecting protein DprA [Bacillus cereus MM3] Length = 289 Score = 40.3 bits (95), Expect = 0.095, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR+L E+ + + ++E P Sbjct: 172 LGHGLSYMYPKENRHLYEKWNEYI-LLLTEYPP 203 >gi|167465540|ref|ZP_02330629.1| DNA processing protein DprA, putative [Paenibacillus larvae subsp. larvae BRL-230010] Length = 198 Score = 40.3 bits (95), Expect = 0.095, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNG 24 + G D +YPPEN L +I ++G Sbjct: 175 LGGPADKIYPPENGQLYRQIAESG 198 >gi|116491050|ref|YP_810594.1| Rossmann fold nucleotide-binding protein for DNA uptake [Oenococcus oeni PSU-1] gi|290890531|ref|ZP_06553606.1| hypothetical protein AWRIB429_0996 [Oenococcus oeni AWRIB429] gi|116091775|gb|ABJ56929.1| Rossmann fold nucleotide-binding protein for DNA uptake [Oenococcus oeni PSU-1] gi|290479927|gb|EFD88576.1| hypothetical protein AWRIB429_0996 [Oenococcus oeni AWRIB429] Length = 295 Score = 40.3 bits (95), Expect = 0.095, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G + YP EN+++ + I + G+ +SE Sbjct: 177 IGNGTNISYPAENQSIQKRII-SDGLLLSEYFP 208 >gi|89511712|emb|CAI68102.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] Length = 282 Score = 40.3 bits (95), Expect = 0.095, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + GLD YP ENR + E + N + +SE G Sbjct: 164 IGTGLDIFYPLENRKIQEYLAKNQ-LILSEYSVG 196 >gi|289707068|ref|ZP_06503397.1| conserved hypothetical protein [Micrococcus luteus SK58] gi|289556206|gb|EFD49568.1| conserved hypothetical protein [Micrococcus luteus SK58] Length = 195 Score = 40.3 bits (95), Expect = 0.098, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Query: 9 YPPENRNLLEEIWDNGGIAISEIPFG 34 YP + +LL + G+ +SE+P G Sbjct: 1 YPAGHEDLLRAVMAA-GLLVSEMPPG 25 >gi|218440245|ref|YP_002378574.1| DNA protecting protein DprA [Cyanothece sp. PCC 7424] gi|218172973|gb|ACK71706.1| DNA protecting protein DprA [Cyanothece sp. PCC 7424] Length = 374 Score = 40.3 bits (95), Expect = 0.099, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G+D +YP +R L + G+ +SE G Sbjct: 177 LGTGIDVVYPSSHRQ-LHQQIQQQGLVLSEYAVG 209 >gi|229086387|ref|ZP_04218563.1| DNA protecting protein DprA [Bacillus cereus Rock3-44] gi|228696903|gb|EEL49712.1| DNA protecting protein DprA [Bacillus cereus Rock3-44] Length = 278 Score = 39.9 bits (94), Expect = 0.10, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP EN E IW N + ++E P Sbjct: 161 LGHGLQYMYPKENCRFYE-IWKNDVLLLTEYPP 192 >gi|239636273|ref|ZP_04677275.1| DNA protecting protein DprA [Staphylococcus warneri L37603] gi|239597628|gb|EEQ80123.1| DNA protecting protein DprA [Staphylococcus warneri L37603] Length = 289 Score = 39.9 bits (94), Expect = 0.11, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G YP + +L I + G+ ISE P Sbjct: 172 LGFGHHYYYPRSSVSLRNRI-EKEGLVISEYPP 203 >gi|21910355|ref|NP_664623.1| Smf family DNA processing protein [Streptococcus pyogenes MGAS315] gi|21904552|gb|AAM79426.1| putative DNA processing protein (Smf family) [Streptococcus pyogenes MGAS315] Length = 278 Score = 39.9 bits (94), Expect = 0.11, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP ENR L + + ++E Sbjct: 163 IGTGLDRFYPKENREL-QTFLGKNHLVLTEY 192 >gi|28895932|ref|NP_802282.1| Smf family DNA processing protein [Streptococcus pyogenes SSI-1] gi|28811182|dbj|BAC64115.1| putative DNA processing protein (Smf family) [Streptococcus pyogenes SSI-1] Length = 265 Score = 39.9 bits (94), Expect = 0.11, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP ENR L + + ++E Sbjct: 150 IGTGLDRFYPKENREL-QTFLGKNHLVLTEY 179 >gi|227495325|ref|ZP_03925641.1| DNA-binding/uptake protein [Actinomyces coleocanis DSM 15436] gi|226831195|gb|EEH63578.1| DNA-binding/uptake protein [Actinomyces coleocanis DSM 15436] Length = 402 Score = 39.9 bits (94), Expect = 0.12, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MAGG+ LYP +L + D G+ +SE+P Sbjct: 199 MAGGVGQLYPASQLDLFNRLLD-VGLVVSEVPP 230 >gi|190015972|ref|YP_001965180.1| putative Rossmann fold nucleotide-binding protein involved in DNA uptake [Rhodococcus sp. NS1] gi|114796812|gb|ABI79405.1| putative Rossmann fold nucleotide-binding protein involved in DNA uptake [Rhodococcus sp. NS1] Length = 301 Score = 39.9 bits (94), Expect = 0.12, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A G++ YP +NR+L E I D G+ +S+ Sbjct: 166 ATGVNRTYPAQNRHLHESIAD-LGLVLSQF 194 >gi|19746109|ref|NP_607245.1| DNA processing protein [Streptococcus pyogenes MGAS8232] gi|94994429|ref|YP_602527.1| DNA processing protein [Streptococcus pyogenes MGAS10750] gi|139473749|ref|YP_001128465.1| SMF family protein [Streptococcus pyogenes str. Manfredo] gi|19748283|gb|AAL97744.1| putative DNA processing protein [Streptococcus pyogenes MGAS8232] gi|94547937|gb|ABF37983.1| DNA processing protein [Streptococcus pyogenes MGAS10750] gi|134271996|emb|CAM30234.1| SMF family protein [Streptococcus pyogenes str. Manfredo] Length = 278 Score = 39.9 bits (94), Expect = 0.12, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP ENR L + + ++E Sbjct: 163 IGTGLDRFYPKENREL-QTFLGKNHLVLTEY 192 >gi|89091848|ref|ZP_01164803.1| DNA processing chain A [Oceanospirillum sp. MED92] gi|89083583|gb|EAR62800.1| DNA processing chain A [Oceanospirillum sp. MED92] Length = 325 Score = 39.9 bits (94), Expect = 0.12, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 13/31 (41%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ YP + + I GG +SE Sbjct: 184 LGTGILQNYPKGSEEIRLRIVSEGGTIVSEY 214 >gi|299142975|ref|ZP_07036101.1| DNA protecting protein DprA [Prevotella oris C735] gi|298575591|gb|EFI47471.1| DNA protecting protein DprA [Prevotella oris C735] Length = 334 Score = 39.9 bits (94), Expect = 0.12, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 16/31 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + L + P N+ L +I D GG+ ++E Sbjct: 174 LPSPLTSILPASNKGLAFQIVDEGGLLVTEY 204 >gi|205355484|ref|ZP_03222255.1| SMF family protein [Campylobacter jejuni subsp. jejuni CG8421] gi|205346718|gb|EDZ33350.1| SMF family protein [Campylobacter jejuni subsp. jejuni CG8421] gi|315926752|gb|EFV06126.1| SMF family protein [Campylobacter jejuni subsp. jejuni DFVF1099] Length = 257 Score = 39.9 bits (94), Expect = 0.13, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD +YP N ++++I++N +A+SE Sbjct: 93 ANGLDQIYPRTNEKIIKQIYENA-LALSEY 121 >gi|157414913|ref|YP_001482169.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 81116] gi|157385877|gb|ABV52192.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 81116] gi|307747551|gb|ADN90821.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni M1] gi|315931832|gb|EFV10787.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 327] Length = 257 Score = 39.9 bits (94), Expect = 0.13, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD +YP N ++++I++N +A+SE Sbjct: 93 ANGLDQIYPRTNEKIIKQIYENA-LALSEY 121 >gi|148926621|ref|ZP_01810302.1| SMF family protein [Campylobacter jejuni subsp. jejuni CG8486] gi|145845140|gb|EDK22235.1| SMF family protein [Campylobacter jejuni subsp. jejuni CG8486] Length = 260 Score = 39.9 bits (94), Expect = 0.13, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD +YP N ++++I++N +A+SE Sbjct: 96 ANGLDQIYPRTNEKIIKQIYENA-LALSEY 124 >gi|153952380|ref|YP_001398407.1| DNA processing protein A [Campylobacter jejuni subsp. doylei 269.97] gi|152939826|gb|ABS44567.1| DNA processing protein A [Campylobacter jejuni subsp. doylei 269.97] Length = 257 Score = 39.9 bits (94), Expect = 0.13, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD +YP N ++++I++N +A+SE Sbjct: 93 ANGLDQIYPRTNEKIIKQIYENA-LALSEY 121 >gi|50914226|ref|YP_060198.1| Smf protein [Streptococcus pyogenes MGAS10394] gi|50903300|gb|AAT87015.1| Smf protein [Streptococcus pyogenes MGAS10394] Length = 278 Score = 39.9 bits (94), Expect = 0.13, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP ENR L + + ++E Sbjct: 163 IGTGLDRFYPKENREL-QTFLGKNHLVLTEY 192 >gi|57236947|ref|YP_178748.1| DNA processing protein A [Campylobacter jejuni RM1221] gi|57165751|gb|AAW34530.1| DNA processing protein A [Campylobacter jejuni RM1221] gi|315058048|gb|ADT72377.1| SMF family protein, DNA processing chain A (dprA) [Campylobacter jejuni subsp. jejuni S3] Length = 257 Score = 39.9 bits (94), Expect = 0.13, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD +YP N ++++I++N +A+SE Sbjct: 93 ANGLDQIYPRTNEKIIKQIYENA-LALSEY 121 >gi|218562284|ref|YP_002344063.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni NCTC 11168] gi|112359990|emb|CAL34779.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni NCTC 11168] Length = 257 Score = 39.9 bits (94), Expect = 0.13, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD +YP N ++++I++N +A+SE Sbjct: 93 ANGLDQIYPRTNEKIIKQIYENA-LALSEY 121 >gi|88597111|ref|ZP_01100347.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 84-25] gi|88190800|gb|EAQ94773.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 84-25] gi|284925894|gb|ADC28246.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni IA3902] gi|315930931|gb|EFV09910.1| SMF family protein [Campylobacter jejuni subsp. jejuni 305] Length = 257 Score = 39.9 bits (94), Expect = 0.13, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD +YP N ++++I++N +A+SE Sbjct: 93 ANGLDQIYPRTNEKIIKQIYENA-LALSEY 121 >gi|86151760|ref|ZP_01069974.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 260.94] gi|315124149|ref|YP_004066153.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni ICDCCJ07001] gi|85841389|gb|EAQ58637.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 260.94] gi|315017871|gb|ADT65964.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni ICDCCJ07001] Length = 257 Score = 39.9 bits (94), Expect = 0.13, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD +YP N ++++I++N +A+SE Sbjct: 93 ANGLDQIYPRTNEKIIKQIYENA-LALSEY 121 >gi|86153584|ref|ZP_01071788.1| SMF family protein [Campylobacter jejuni subsp. jejuni HB93-13] gi|121612378|ref|YP_001000335.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 81-176] gi|85843310|gb|EAQ60521.1| SMF family protein [Campylobacter jejuni subsp. jejuni HB93-13] gi|87250450|gb|EAQ73408.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 81-176] Length = 257 Score = 39.9 bits (94), Expect = 0.13, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD +YP N ++++I++N +A+SE Sbjct: 93 ANGLDQIYPRTNEKIIKQIYENA-LALSEY 121 >gi|86149889|ref|ZP_01068118.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni CF93-6] gi|85839707|gb|EAQ56967.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni CF93-6] Length = 257 Score = 39.9 bits (94), Expect = 0.13, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD +YP N ++++I++N +A+SE Sbjct: 93 ANGLDQIYPRTNEKIIKQIYENA-LALSEY 121 >gi|313681722|ref|YP_004059460.1| smf family protein [Sulfuricurvum kujiense DSM 16994] gi|313154582|gb|ADR33260.1| SMF family protein [Sulfuricurvum kujiense DSM 16994] Length = 256 Score = 39.6 bits (93), Expect = 0.14, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D YP N L+E I + G+ IS Sbjct: 89 LPCGIDHRYPASNGILIESI-EKNGLIISPFEP 120 >gi|228471774|ref|ZP_04056547.1| DNA processing chain A [Capnocytophaga gingivalis ATCC 33624] gi|228276927|gb|EEK15622.1| DNA processing chain A [Capnocytophaga gingivalis ATCC 33624] Length = 371 Score = 39.6 bits (93), Expect = 0.14, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP ++ + + G I+E Sbjct: 175 LAHGLDIIYPASHKK-YTKEVEAYGGFITEF 204 >gi|78185425|ref|YP_377860.1| SMF protein [Synechococcus sp. CC9902] gi|78169719|gb|ABB26816.1| SMF protein [Synechococcus sp. CC9902] Length = 355 Score = 39.6 bits (93), Expect = 0.15, Method: Composition-based stats. Identities = 8/34 (23%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + L+ +YP + E G+ +SE G Sbjct: 175 LGTSLERVYPRHHETFQAE-VGRNGLLLSEFSLG 207 >gi|152990902|ref|YP_001356624.1| DNA processing protein A [Nitratiruptor sp. SB155-2] gi|151422763|dbj|BAF70267.1| DNA processing protein A [Nitratiruptor sp. SB155-2] Length = 239 Score = 39.6 bits (93), Expect = 0.17, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GLD YP N L+E+I + G+ +S Sbjct: 79 ATGLDIRYPAVNAGLIEKI-EKEGLVLSRF 107 >gi|313889459|ref|ZP_07823107.1| DNA protecting protein DprA [Streptococcus pseudoporcinus SPIN 20026] gi|313122291|gb|EFR45382.1| DNA protecting protein DprA [Streptococcus pseudoporcinus SPIN 20026] Length = 279 Score = 39.6 bits (93), Expect = 0.17, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G + YP EN+ L + I N + ++E Sbjct: 163 IGSGFNHYYPKENQRLQKFIASNH-LLLTEY 192 >gi|89055649|ref|YP_511100.1| DNA processing protein DprA, putative [Jannaschia sp. CCS1] gi|88865198|gb|ABD56075.1| DNA protecting protein DprA [Jannaschia sp. CCS1] Length = 402 Score = 39.6 bits (93), Expect = 0.17, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Query: 9 YPPENRNLLEEIWDNGGIAISEIPFG 34 YP EN L +I + G+ +SE P G Sbjct: 212 YPTENAELAAQISET-GLCLSEQPLG 236 >gi|300727517|ref|ZP_07060908.1| DNA processing chain A [Prevotella bryantii B14] gi|299775220|gb|EFI71821.1| DNA processing chain A [Prevotella bryantii B14] Length = 375 Score = 39.6 bits (93), Expect = 0.17, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD LYP ++ +++ + GG+ +E Sbjct: 177 LAHGLDTLYPRQHITTSKKMVNQGGLL-TEF 206 >gi|70726666|ref|YP_253580.1| hypothetical protein SH1665 [Staphylococcus haemolyticus JCSC1435] gi|68447390|dbj|BAE04974.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] Length = 288 Score = 39.6 bits (93), Expect = 0.17, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G YP E + L I + G+ ISE P Sbjct: 172 LGFGHMMHYPRETQKL-RNIIEVKGLVISEYPP 203 >gi|288947786|ref|YP_003445169.1| SMF family protein [Allochromatium vinosum DSM 180] gi|288898302|gb|ADC64137.1| SMF family protein [Allochromatium vinosum DSM 180] Length = 228 Score = 39.2 bits (92), Expect = 0.18, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + LD YP EN L I + IS+ G Sbjct: 97 IGTPLDRSYPRENELLQARIATEH-LLISQFTPG 129 >gi|30024029|ref|NP_835316.1| hypothetical protein L200051 [Lactococcus lactis subsp. lactis Il1403] Length = 155 Score = 39.2 bits (92), Expect = 0.18, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP ENR + E + N + +SE Sbjct: 126 IGTGLDIFYPLENRKIQEYLAKNQ-LILSEY 155 >gi|219871968|ref|YP_002476343.1| DNA uptake Rossmann fold nucleotide-binding protein [Haemophilus parasuis SH0165] gi|219692172|gb|ACL33395.1| Rossmann fold nucleotide-binding protein involved in DNA uptake [Haemophilus parasuis SH0165] Length = 331 Score = 39.2 bits (92), Expect = 0.20, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + L+ + P ++R ++I++ GG+ I+E Sbjct: 175 LPSPLNNIMPVKHREFAQQIFETGGLLITEY 205 >gi|154509162|ref|ZP_02044804.1| hypothetical protein ACTODO_01683 [Actinomyces odontolyticus ATCC 17982] gi|153798796|gb|EDN81216.1| hypothetical protein ACTODO_01683 [Actinomyces odontolyticus ATCC 17982] Length = 386 Score = 39.2 bits (92), Expect = 0.20, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG+ YP + + D GG ISE+ Sbjct: 184 LAGGVCNPYPACHGGDFRAVIDGGGALISEVAP 216 >gi|255972710|ref|ZP_05423296.1| predicted protein [Enterococcus faecalis T1] gi|255963728|gb|EET96204.1| predicted protein [Enterococcus faecalis T1] Length = 293 Score = 39.2 bits (92), Expect = 0.21, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 178 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 207 >gi|242373540|ref|ZP_04819114.1| SMF family nucleotide-binding protein [Staphylococcus epidermidis M23864:W1] gi|242348903|gb|EES40505.1| SMF family nucleotide-binding protein [Staphylococcus epidermidis M23864:W1] Length = 292 Score = 39.2 bits (92), Expect = 0.21, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G D YP L ++I + G+ +SE P Sbjct: 175 LGFGHDYHYPQSTYQLRDKI-EKSGLVLSEYPP 206 >gi|307273139|ref|ZP_07554385.1| DNA protecting protein DprA [Enterococcus faecalis TX0855] gi|306510124|gb|EFM79148.1| DNA protecting protein DprA [Enterococcus faecalis TX0855] Length = 287 Score = 39.2 bits (92), Expect = 0.21, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 172 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 201 >gi|326334729|ref|ZP_08200936.1| SMF family DNA processing protein [Capnocytophaga sp. oral taxon 338 str. F0234] gi|325693179|gb|EGD35111.1| SMF family DNA processing protein [Capnocytophaga sp. oral taxon 338 str. F0234] Length = 369 Score = 39.2 bits (92), Expect = 0.22, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GLD +YP ++ N G I+E Sbjct: 175 LAHGLDIIYPASHKK-YVSEVKNNGGFITEF 204 >gi|322378431|ref|ZP_08052884.1| dNA processing proteinDprA [Helicobacter suis HS1] gi|322380509|ref|ZP_08054697.1| DNA processing protein DprA [Helicobacter suis HS5] gi|321147064|gb|EFX41776.1| DNA processing protein DprA [Helicobacter suis HS5] gi|321149122|gb|EFX43569.1| dNA processing proteinDprA [Helicobacter suis HS1] Length = 269 Score = 39.2 bits (92), Expect = 0.22, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YPP N + I G+ +SE Sbjct: 99 PCSLDLIYPPSNHATITRIAKE-GLLVSEY 127 >gi|315145131|gb|EFT89147.1| DNA protecting protein DprA [Enterococcus faecalis TX2141] gi|315160535|gb|EFU04552.1| DNA protecting protein DprA [Enterococcus faecalis TX0645] gi|323480813|gb|ADX80252.1| DNA protecting protein DprA [Enterococcus faecalis 62] Length = 287 Score = 39.2 bits (92), Expect = 0.22, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 172 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 201 >gi|257082467|ref|ZP_05576828.1| predicted protein [Enterococcus faecalis E1Sol] gi|256990497|gb|EEU77799.1| predicted protein [Enterococcus faecalis E1Sol] Length = 288 Score = 39.2 bits (92), Expect = 0.22, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 173 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 202 >gi|256965041|ref|ZP_05569212.1| smf [Enterococcus faecalis HIP11704] gi|256955537|gb|EEU72169.1| smf [Enterococcus faecalis HIP11704] Length = 288 Score = 39.2 bits (92), Expect = 0.22, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 173 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 202 >gi|256959063|ref|ZP_05563234.1| protein smf [Enterococcus faecalis DS5] gi|257079094|ref|ZP_05573455.1| conserved hypothetical protein [Enterococcus faecalis JH1] gi|256949559|gb|EEU66191.1| protein smf [Enterococcus faecalis DS5] gi|256987124|gb|EEU74426.1| conserved hypothetical protein [Enterococcus faecalis JH1] Length = 288 Score = 39.2 bits (92), Expect = 0.22, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 173 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 202 >gi|300861025|ref|ZP_07107112.1| DNA protecting protein DprA [Enterococcus faecalis TUSoD Ef11] gi|300850064|gb|EFK77814.1| DNA protecting protein DprA [Enterococcus faecalis TUSoD Ef11] gi|315034055|gb|EFT45987.1| DNA protecting protein DprA [Enterococcus faecalis TX0017] Length = 287 Score = 39.2 bits (92), Expect = 0.22, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 172 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 201 >gi|229549927|ref|ZP_04438652.1| DNA processing protein DprA [Enterococcus faecalis ATCC 29200] gi|294781635|ref|ZP_06746971.1| DNA protecting protein DprA [Enterococcus faecalis PC1.1] gi|307270934|ref|ZP_07552217.1| DNA protecting protein DprA [Enterococcus faecalis TX4248] gi|312951582|ref|ZP_07770478.1| DNA protecting protein DprA [Enterococcus faecalis TX0102] gi|229304940|gb|EEN70936.1| DNA processing protein DprA [Enterococcus faecalis ATCC 29200] gi|294451331|gb|EFG19797.1| DNA protecting protein DprA [Enterococcus faecalis PC1.1] gi|306512432|gb|EFM81081.1| DNA protecting protein DprA [Enterococcus faecalis TX4248] gi|310630548|gb|EFQ13831.1| DNA protecting protein DprA [Enterococcus faecalis TX0102] gi|315037064|gb|EFT48996.1| DNA protecting protein DprA [Enterococcus faecalis TX0027] gi|315147348|gb|EFT91364.1| DNA protecting protein DprA [Enterococcus faecalis TX4244] gi|315152396|gb|EFT96412.1| DNA protecting protein DprA [Enterococcus faecalis TX0031] gi|315158161|gb|EFU02178.1| DNA protecting protein DprA [Enterococcus faecalis TX0312] gi|327535217|gb|AEA94051.1| DNA protecting protein DprA [Enterococcus faecalis OG1RF] gi|329571611|gb|EGG53292.1| DNA protecting protein DprA [Enterococcus faecalis TX1467] Length = 287 Score = 39.2 bits (92), Expect = 0.22, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 172 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 201 >gi|315168950|gb|EFU12967.1| DNA protecting protein DprA [Enterococcus faecalis TX1341] Length = 287 Score = 39.2 bits (92), Expect = 0.22, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 172 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 201 >gi|124023899|ref|YP_001018206.1| SMF family protein [Prochlorococcus marinus str. MIT 9303] gi|123964185|gb|ABM78941.1| SMF family protein [Prochlorococcus marinus str. MIT 9303] Length = 378 Score = 39.2 bits (92), Expect = 0.23, Method: Composition-based stats. Identities = 8/32 (25%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + L +YP +N L + + G+ ++E P Sbjct: 182 LGTPLQKVYPRQNEGL-QALVAAQGLLVTEQP 212 >gi|312903392|ref|ZP_07762572.1| DNA protecting protein DprA [Enterococcus faecalis TX0635] gi|310633268|gb|EFQ16551.1| DNA protecting protein DprA [Enterococcus faecalis TX0635] gi|315150452|gb|EFT94468.1| DNA protecting protein DprA [Enterococcus faecalis TX0012] gi|315155668|gb|EFT99684.1| DNA protecting protein DprA [Enterococcus faecalis TX0043] gi|315577622|gb|EFU89813.1| DNA protecting protein DprA [Enterococcus faecalis TX0630] Length = 287 Score = 39.2 bits (92), Expect = 0.23, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 172 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 201 >gi|283458211|ref|YP_003362829.1| putative Rossmann fold nucleotide-binding protein [Rothia mucilaginosa DY-18] gi|283134244|dbj|BAI65009.1| predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Rothia mucilaginosa DY-18] Length = 613 Score = 39.2 bits (92), Expect = 0.23, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGGLD LYP +N + L I D G+ +SE+ G Sbjct: 408 MAGGLDRLYPAQNSDALNMIVDR-GLIMSEVSVG 440 >gi|227553454|ref|ZP_03983503.1| DNA processing protein DprA [Enterococcus faecalis HH22] gi|227177411|gb|EEI58383.1| DNA processing protein DprA [Enterococcus faecalis HH22] Length = 287 Score = 39.2 bits (92), Expect = 0.23, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 172 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 201 >gi|29376206|ref|NP_815360.1| DNA processing protein DprA, putative [Enterococcus faecalis V583] gi|227518837|ref|ZP_03948886.1| DNA processing protein DprA [Enterococcus faecalis TX0104] gi|229545738|ref|ZP_04434463.1| DNA processing protein DprA [Enterococcus faecalis TX1322] gi|293382909|ref|ZP_06628827.1| DNA protecting protein DprA [Enterococcus faecalis R712] gi|293389602|ref|ZP_06634059.1| DNA protecting protein DprA [Enterococcus faecalis S613] gi|307274874|ref|ZP_07556037.1| DNA protecting protein DprA [Enterococcus faecalis TX2134] gi|307277981|ref|ZP_07559065.1| DNA protecting protein DprA [Enterococcus faecalis TX0860] gi|307289191|ref|ZP_07569147.1| DNA protecting protein DprA [Enterococcus faecalis TX0109] gi|307291912|ref|ZP_07571781.1| DNA protecting protein DprA [Enterococcus faecalis TX0411] gi|312907621|ref|ZP_07766612.1| DNA protecting protein DprA [Enterococcus faecalis DAPTO 512] gi|312910238|ref|ZP_07769085.1| DNA protecting protein DprA [Enterococcus faecalis DAPTO 516] gi|29343669|gb|AAO81430.1| DNA processing protein DprA, putative [Enterococcus faecalis V583] gi|227073708|gb|EEI11671.1| DNA processing protein DprA [Enterococcus faecalis TX0104] gi|229309188|gb|EEN75175.1| DNA processing protein DprA [Enterococcus faecalis TX1322] gi|291079574|gb|EFE16938.1| DNA protecting protein DprA [Enterococcus faecalis R712] gi|291081219|gb|EFE18182.1| DNA protecting protein DprA [Enterococcus faecalis S613] gi|306496910|gb|EFM66458.1| DNA protecting protein DprA [Enterococcus faecalis TX0411] gi|306499900|gb|EFM69261.1| DNA protecting protein DprA [Enterococcus faecalis TX0109] gi|306505378|gb|EFM74564.1| DNA protecting protein DprA [Enterococcus faecalis TX0860] gi|306508322|gb|EFM77429.1| DNA protecting protein DprA [Enterococcus faecalis TX2134] gi|310626649|gb|EFQ09932.1| DNA protecting protein DprA [Enterococcus faecalis DAPTO 512] gi|311289511|gb|EFQ68067.1| DNA protecting protein DprA [Enterococcus faecalis DAPTO 516] gi|315027182|gb|EFT39114.1| DNA protecting protein DprA [Enterococcus faecalis TX2137] gi|315029299|gb|EFT41231.1| DNA protecting protein DprA [Enterococcus faecalis TX4000] gi|315164100|gb|EFU08117.1| DNA protecting protein DprA [Enterococcus faecalis TX1302] gi|315169816|gb|EFU13833.1| DNA protecting protein DprA [Enterococcus faecalis TX1342] gi|315575780|gb|EFU87971.1| DNA protecting protein DprA [Enterococcus faecalis TX0309B] gi|315580432|gb|EFU92623.1| DNA protecting protein DprA [Enterococcus faecalis TX0309A] Length = 287 Score = 39.2 bits (92), Expect = 0.23, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 172 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 201 >gi|156935164|ref|YP_001439080.1| hypothetical protein ESA_03015 [Cronobacter sakazakii ATCC BAA-894] gi|156533418|gb|ABU78244.1| hypothetical protein ESA_03015 [Cronobacter sakazakii ATCC BAA-894] Length = 325 Score = 38.8 bits (91), Expect = 0.23, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 16/31 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ YP + L E+I +GG I+E Sbjct: 187 LGNGIFNEYPKGSNILREQIVKHGGTVITEY 217 >gi|150020268|ref|YP_001305622.1| SMF family protein [Thermosipho melanesiensis BI429] gi|149792789|gb|ABR30237.1| SMF family protein [Thermosipho melanesiensis BI429] Length = 323 Score = 38.8 bits (91), Expect = 0.23, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 5/37 (13%) Query: 1 MAGGLDCL----YPPENRNLLEEIWDNGGIAISEIPF 33 + GL + YP EN LL +I N GI +SEIP Sbjct: 198 LGQGLSKIEKRLYPKENIKLLFDIL-NKGIVLSEIPP 233 >gi|21673094|ref|NP_661159.1| DprA/SMF protein, putative DNA processing factor [Chlorobium tepidum TLS] gi|21646166|gb|AAM71501.1| DprA/SMF protein, putative DNA processing factor [Chlorobium tepidum TLS] Length = 399 Score = 38.8 bits (91), Expect = 0.23, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 14/32 (43%), Gaps = 5/32 (15%) Query: 1 MAGGLDCLY--PPENRNLLEEIWDNGGIAISE 30 + G+D +Y P L I + G +SE Sbjct: 205 LGCGIDRIYTDPAG--RLWPRILER-GAIVSE 233 >gi|257089968|ref|ZP_05584329.1| conserved hypothetical protein [Enterococcus faecalis CH188] gi|257422527|ref|ZP_05599517.1| conserved hypothetical protein [Enterococcus faecalis X98] gi|256998780|gb|EEU85300.1| conserved hypothetical protein [Enterococcus faecalis CH188] gi|257164351|gb|EEU94311.1| conserved hypothetical protein [Enterococcus faecalis X98] Length = 288 Score = 38.8 bits (91), Expect = 0.24, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 173 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 202 >gi|255975762|ref|ZP_05426348.1| predicted protein [Enterococcus faecalis T2] gi|256619147|ref|ZP_05475993.1| protein smf [Enterococcus faecalis ATCC 4200] gi|256762583|ref|ZP_05503163.1| conserved hypothetical protein [Enterococcus faecalis T3] gi|256853209|ref|ZP_05558579.1| conserved hypothetical protein [Enterococcus faecalis T8] gi|256961844|ref|ZP_05566015.1| smf [Enterococcus faecalis Merz96] gi|257085099|ref|ZP_05579460.1| DNA processing protein DprA [Enterococcus faecalis Fly1] gi|257086660|ref|ZP_05581021.1| predicted protein [Enterococcus faecalis D6] gi|257416177|ref|ZP_05593171.1| protein smf [Enterococcus faecalis AR01/DG] gi|257419379|ref|ZP_05596373.1| conserved hypothetical protein [Enterococcus faecalis T11] gi|255968634|gb|EET99256.1| predicted protein [Enterococcus faecalis T2] gi|256598674|gb|EEU17850.1| protein smf [Enterococcus faecalis ATCC 4200] gi|256683834|gb|EEU23529.1| conserved hypothetical protein [Enterococcus faecalis T3] gi|256711668|gb|EEU26706.1| conserved hypothetical protein [Enterococcus faecalis T8] gi|256952340|gb|EEU68972.1| smf [Enterococcus faecalis Merz96] gi|256993129|gb|EEU80431.1| DNA processing protein DprA [Enterococcus faecalis Fly1] gi|256994690|gb|EEU81992.1| predicted protein [Enterococcus faecalis D6] gi|257158005|gb|EEU87965.1| protein smf [Enterococcus faecalis ARO1/DG] gi|257161207|gb|EEU91167.1| conserved hypothetical protein [Enterococcus faecalis T11] Length = 288 Score = 38.8 bits (91), Expect = 0.24, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 173 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 202 >gi|75675025|ref|YP_317446.1| SMF protein [Nitrobacter winogradskyi Nb-255] gi|74419895|gb|ABA04094.1| SMF protein [Nitrobacter winogradskyi Nb-255] Length = 302 Score = 38.8 bits (91), Expect = 0.24, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + L YP N L ++I ++ + IS++P Sbjct: 174 LGTPLSKSYPASNAKLQQQIAEHH-LLISQVP 204 >gi|255326005|ref|ZP_05367093.1| DNA protecting protein DprA [Rothia mucilaginosa ATCC 25296] gi|255296896|gb|EET76225.1| DNA protecting protein DprA [Rothia mucilaginosa ATCC 25296] Length = 588 Score = 38.8 bits (91), Expect = 0.24, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 MAGGLD LYP +N + L I D G+ +SE+ G Sbjct: 383 MAGGLDRLYPAQNSDALNMIVDR-GLIMSEVSVG 415 >gi|134299778|ref|YP_001113274.1| DNA uptake Rossmann fold nucleotide-binding protein [Desulfotomaculum reducens MI-1] gi|134052478|gb|ABO50449.1| Rossmann fold nucleotide-binding protein involved in DNA uptake-like protein [Desulfotomaculum reducens MI-1] Length = 192 Score = 38.8 bits (91), Expect = 0.24, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 10 PPENRNLLEEIWDNGGIAISEIPF 33 P ENR+L +I GG +S+ Sbjct: 93 PAENRSLFHQIVHKGGCIVSQFKP 116 >gi|312899499|ref|ZP_07758829.1| DNA protecting protein DprA [Enterococcus faecalis TX0470] gi|311293369|gb|EFQ71925.1| DNA protecting protein DprA [Enterococcus faecalis TX0470] Length = 286 Score = 38.8 bits (91), Expect = 0.24, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 172 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 201 >gi|229019029|ref|ZP_04175870.1| DNA protecting protein DprA [Bacillus cereus AH1273] gi|228742269|gb|EEL92428.1| DNA protecting protein DprA [Bacillus cereus AH1273] Length = 278 Score = 38.8 bits (91), Expect = 0.25, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 9/37 (24%) Query: 1 MAGGLDCLYPPENRNLLEE----IWDNGGIAISEIPF 33 + GL +YP ENR L + I + ++E P Sbjct: 161 LGHGLSYMYPKENRRLYDTWKDYI-----LLLTEYPP 192 >gi|108562762|ref|YP_627078.1| DNA processing chain A [Helicobacter pylori HPAG1] gi|107836535|gb|ABF84404.1| DNA processing chain A [Helicobacter pylori HPAG1] Length = 266 Score = 38.8 bits (91), Expect = 0.25, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDLIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|317181676|dbj|BAJ59460.1| hypothetical protein HPF57_0386 [Helicobacter pylori F57] Length = 266 Score = 38.8 bits (91), Expect = 0.25, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDLIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|220931596|ref|YP_002508504.1| DNA protecting protein DprA [Halothermothrix orenii H 168] gi|219992906|gb|ACL69509.1| DNA protecting protein DprA [Halothermothrix orenii H 168] Length = 409 Score = 38.8 bits (91), Expect = 0.25, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YPPEN+ L + + G +SE+ Sbjct: 200 LGTGLNRIYPPENKKL-TGLVTDSGYLLSELTP 231 >gi|312143685|ref|YP_003995131.1| DNA protecting protein DprA [Halanaerobium sp. 'sapolanicus'] gi|311904336|gb|ADQ14777.1| DNA protecting protein DprA [Halanaerobium sp. 'sapolanicus'] Length = 381 Score = 38.8 bits (91), Expect = 0.25, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G + +YP EN L ++I G+ I+E Sbjct: 174 ANGFNYIYPSENNYLAKKI-KKEGLLITEFNP 204 >gi|241889131|ref|ZP_04776435.1| DNA protecting protein DprA [Gemella haemolysans ATCC 10379] gi|241864380|gb|EER68758.1| DNA protecting protein DprA [Gemella haemolysans ATCC 10379] Length = 296 Score = 38.8 bits (91), Expect = 0.26, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G + +YP ++ L +E + + ISE Sbjct: 179 IAHGHNIIYPEQSYKLYKE-LERNHLIISEYFP 210 >gi|317012174|gb|ADU82782.1| hypothetical protein HPLT_01710 [Helicobacter pylori Lithuania75] Length = 266 Score = 38.8 bits (91), Expect = 0.27, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDLIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|317179271|dbj|BAJ57059.1| hypothetical protein HPF30_0962 [Helicobacter pylori F30] Length = 266 Score = 38.8 bits (91), Expect = 0.28, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDLIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|315172219|gb|EFU16236.1| putative DNA protecting protein DprA [Enterococcus faecalis TX1346] Length = 223 Score = 38.8 bits (91), Expect = 0.28, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP E + L ++ + ++E Sbjct: 172 LGTGLDVYYPYEKKEL-QQTMKQNQLVLTEY 201 >gi|332673179|gb|AEE69996.1| DNA protecting protein DprA [Helicobacter pylori 83] Length = 266 Score = 38.8 bits (91), Expect = 0.28, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDLIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|261839185|gb|ACX98950.1| hypothetical protein HPKB_0341 [Helicobacter pylori 52] Length = 266 Score = 38.8 bits (91), Expect = 0.28, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDLIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|257460561|ref|ZP_05625662.1| SMF family protein [Campylobacter gracilis RM3268] gi|257441892|gb|EEV17034.1| SMF family protein [Campylobacter gracilis RM3268] Length = 262 Score = 38.8 bits (91), Expect = 0.28, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GLD +YP +N ++ +I++ +A+SE Sbjct: 94 GNGLDQIYPAQNAAMIGKIYERS-LALSEY 122 >gi|87200214|ref|YP_497471.1| SMF protein [Novosphingobium aromaticivorans DSM 12444] gi|87135895|gb|ABD26637.1| SMF protein [Novosphingobium aromaticivorans DSM 12444] Length = 295 Score = 38.8 bits (91), Expect = 0.29, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + L YP EN +L EEI + IS++P Sbjct: 173 IGTPLGSCYPKENADLQEEI-ARDHLLISQVP 203 >gi|254779031|ref|YP_003057136.1| DNA processing chain A (DprA) [Helicobacter pylori B38] gi|254000942|emb|CAX28880.1| DNA processing chain A (DprA) [Helicobacter pylori B38] Length = 266 Score = 38.8 bits (91), Expect = 0.30, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDLIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|323701898|ref|ZP_08113568.1| SMF family protein [Desulfotomaculum nigrificans DSM 574] gi|323533202|gb|EGB23071.1| SMF family protein [Desulfotomaculum nigrificans DSM 574] Length = 191 Score = 38.4 bits (90), Expect = 0.30, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 8 LYPPENRNLLEEIWDNGGIAISEIPF 33 +YPPE+ L ++I GG +S+ Sbjct: 91 VYPPESEKLAKDIISYGGCLVSQFAP 116 >gi|317013780|gb|ADU81216.1| DNA processing chain A (dprA) [Helicobacter pylori Gambia94/24] Length = 266 Score = 38.4 bits (90), Expect = 0.32, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDLIYPTNNHKVIQEI-AQKGLILSEY 125 >gi|190015116|ref|YP_001966546.1| SMF family protein [Bacillus cereus] gi|190015382|ref|YP_001966872.1| SMF family protein [Bacillus cereus] gi|218848316|ref|YP_002454889.1| SMF family protein [Bacillus cereus AH820] gi|116584792|gb|ABK00907.1| SMF family protein [Bacillus cereus] gi|116585063|gb|ABK01172.1| SMF family protein [Bacillus cereus] gi|218540367|gb|ACK92763.1| SMF family protein [Bacillus cereus AH820] Length = 284 Score = 38.4 bits (90), Expect = 0.32, Method: Composition-based stats. Identities = 9/29 (31%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAIS 29 + + +YP EN+ L ++I D GG+ ++ Sbjct: 181 LPTNFNKIYPRENQELAKKILD-GGLLVT 208 >gi|109947528|ref|YP_664756.1| DNA processing protein DprA [Helicobacter acinonychis str. Sheeba] gi|109714749|emb|CAJ99757.1| DNA processing protein DprA [Helicobacter acinonychis str. Sheeba] Length = 266 Score = 38.4 bits (90), Expect = 0.32, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDLIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|238063219|ref|ZP_04607928.1| nucleotide-binding protein [Micromonospora sp. ATCC 39149] gi|237885030|gb|EEP73858.1| nucleotide-binding protein [Micromonospora sp. ATCC 39149] Length = 345 Score = 38.4 bits (90), Expect = 0.33, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ YP N+ L E I + G+ IS+ Sbjct: 210 IGTGIRRHYPAANQALQEHIAE-VGLVISQF 239 >gi|329117325|ref|ZP_08246042.1| DNA protecting protein DprA [Streptococcus parauberis NCFD 2020] gi|326907730|gb|EGE54644.1| DNA protecting protein DprA [Streptococcus parauberis NCFD 2020] Length = 279 Score = 38.4 bits (90), Expect = 0.33, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ YP EN L + I N + ISE Sbjct: 163 IGSGMTKFYPKENHRLQKYI-ANNHLLISEY 192 >gi|229025275|ref|ZP_04181695.1| DNA protecting protein DprA [Bacillus cereus AH1272] gi|228736028|gb|EEL86603.1| DNA protecting protein DprA [Bacillus cereus AH1272] Length = 211 Score = 38.4 bits (90), Expect = 0.33, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 9/37 (24%) Query: 1 MAGGLDCLYPPENRNLLEE----IWDNGGIAISEIPF 33 + GL +YP ENR L + I + ++E P Sbjct: 94 LGHGLSYMYPKENRRLYDTWKDYI-----LLLTEYPP 125 >gi|229061437|ref|ZP_04198782.1| DNA protecting protein DprA [Bacillus cereus AH603] gi|228717860|gb|EEL69508.1| DNA protecting protein DprA [Bacillus cereus AH603] Length = 278 Score = 38.4 bits (90), Expect = 0.34, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 9/37 (24%) Query: 1 MAGGLDCLYPPENRNLLEE----IWDNGGIAISEIPF 33 + GL +YP ENR L + I + ++E P Sbjct: 161 LGHGLSYMYPKENRGLYDTWKDYI-----LLLTEYPP 192 >gi|317177149|dbj|BAJ54938.1| hypothetical protein HPF16_0341 [Helicobacter pylori F16] Length = 266 Score = 38.4 bits (90), Expect = 0.36, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDLIYPTNNHKVIQEIV-QNGLILSEY 125 >gi|163941572|ref|YP_001646456.1| DNA protecting protein DprA [Bacillus weihenstephanensis KBAB4] gi|163863769|gb|ABY44828.1| DNA protecting protein DprA [Bacillus weihenstephanensis KBAB4] Length = 289 Score = 38.4 bits (90), Expect = 0.37, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 9/37 (24%) Query: 1 MAGGLDCLYPPENRNLLEE----IWDNGGIAISEIPF 33 + GL +YP ENR L + I + ++E P Sbjct: 172 LGHGLSYMYPKENRGLYDTWKDYI-----LLLTEYPP 203 >gi|117624288|ref|YP_853201.1| hypothetical protein APECO1_1182 [Escherichia coli APEC O1] gi|115513412|gb|ABJ01487.1| hypothetical protein APECO1_1182 [Escherichia coli APEC O1] Length = 349 Score = 38.4 bits (90), Expect = 0.37, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G++ YP + + I +NGG+ ++E Sbjct: 212 LGTGVNSNYPKNSGEMRGHIVNNGGLILTEY 242 >gi|307637028|gb|ADN79478.1| DNA processing chain A [Helicobacter pylori 908] gi|325995621|gb|ADZ51026.1| DNA processing chain A [Helicobacter pylori 2018] gi|325997217|gb|ADZ49425.1| putative DNA processing chain A [Helicobacter pylori 2017] Length = 266 Score = 38.4 bits (90), Expect = 0.38, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDLIYPTNNHKVIQEIV-QNGLILSEY 125 >gi|229021502|ref|ZP_04178103.1| SMF [Bacillus cereus AH1273] gi|229027217|ref|ZP_04183487.1| SMF [Bacillus cereus AH1272] gi|229113436|ref|ZP_04242886.1| SMF [Bacillus cereus Rock1-15] gi|229164874|ref|ZP_04292692.1| SMF [Bacillus cereus R309803] gi|228618595|gb|EEK75603.1| SMF [Bacillus cereus R309803] gi|228669954|gb|EEL25347.1| SMF [Bacillus cereus Rock1-15] gi|228734068|gb|EEL84792.1| SMF [Bacillus cereus AH1272] gi|228739786|gb|EEL90182.1| SMF [Bacillus cereus AH1273] Length = 284 Score = 38.4 bits (90), Expect = 0.38, Method: Composition-based stats. Identities = 9/29 (31%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAIS 29 + + +YP EN+ L ++I D GG+ ++ Sbjct: 181 LPTNFNKIYPKENQELAKKILD-GGLLVT 208 >gi|317180767|dbj|BAJ58553.1| hypothetical protein HPF32_0971 [Helicobacter pylori F32] Length = 266 Score = 38.0 bits (89), Expect = 0.39, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|229168573|ref|ZP_04296296.1| DNA protecting protein DprA [Bacillus cereus AH621] gi|228614979|gb|EEK72081.1| DNA protecting protein DprA [Bacillus cereus AH621] Length = 289 Score = 38.0 bits (89), Expect = 0.39, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 9/37 (24%) Query: 1 MAGGLDCLYPPENRNLLEE----IWDNGGIAISEIPF 33 + GL +YP ENR L + I + ++E P Sbjct: 172 LGHGLSYMYPKENRGLYDTWKDYI-----LLLTEYPP 203 >gi|188527139|ref|YP_001909826.1| hypothetical protein HPSH_01730 [Helicobacter pylori Shi470] gi|188143379|gb|ACD47796.1| hypothetical protein HPSH_01730 [Helicobacter pylori Shi470] Length = 266 Score = 38.0 bits (89), Expect = 0.39, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHQVIQEI-AQNGLILSEY 125 >gi|15644961|ref|NP_207131.1| DNA processing chain A (dprA) [Helicobacter pylori 26695] gi|2313434|gb|AAD07402.1| DNA processing chain A (dprA) [Helicobacter pylori 26695] Length = 270 Score = 38.0 bits (89), Expect = 0.39, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 101 PCSLDFIYPTNNHKVIQEI-AQNGLILSEY 129 >gi|148259743|ref|YP_001233870.1| DNA protecting protein DprA [Acidiphilium cryptum JF-5] gi|146401424|gb|ABQ29951.1| DNA protecting protein DprA [Acidiphilium cryptum JF-5] Length = 373 Score = 38.0 bits (89), Expect = 0.40, Method: Composition-based stats. Identities = 11/20 (55%), Positives = 15/20 (75%) Query: 1 MAGGLDCLYPPENRNLLEEI 20 + GGLD +YPPE+R+L I Sbjct: 165 IPGGLDVVYPPEHRDLQARI 184 >gi|313673068|ref|YP_004051179.1| DNA protecting protein dpra [Calditerrivibrio nitroreducens DSM 19672] gi|312939824|gb|ADR19016.1| DNA protecting protein DprA [Calditerrivibrio nitroreducens DSM 19672] Length = 370 Score = 38.0 bits (89), Expect = 0.40, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GL +YP ++ L EI+ N G +SE+P Sbjct: 175 GNGLLNVYPAHHKKFLPEIYKN-GCILSELPL 205 >gi|254440562|ref|ZP_05054056.1| DNA protecting protein DprA, putative [Octadecabacter antarcticus 307] gi|198256008|gb|EDY80322.1| DNA protecting protein DprA, putative [Octadecabacter antarcticus 307] Length = 344 Score = 38.0 bits (89), Expect = 0.41, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Query: 8 LYPPENRNLLEEIWDNGGIAISEIPFG 34 +YP EN NL ++I +N G+ +S+ P G Sbjct: 155 IYPAENTNLAQKITEN-GLRVSDQPIG 180 >gi|203284218|ref|YP_002221958.1| smf protein [Borrelia duttonii Ly] gi|201083661|gb|ACH93252.1| smf protein [Borrelia duttonii Ly] Length = 314 Score = 38.0 bits (89), Expect = 0.41, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 +A +D +YP +NR + + +NGG ++E Sbjct: 165 IATDIDNIYPKQNRKYVARLLENGGGILTE 194 >gi|34558178|ref|NP_907993.1| nucleotide binding protein [Wolinella succinogenes DSM 1740] gi|34483897|emb|CAE10893.1| conserved hypothetical protein-Nucleotide binding protein [Wolinella succinogenes] Length = 259 Score = 38.0 bits (89), Expect = 0.41, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD YPP ++ ++E I G+ +SE Sbjct: 91 PSSLDLPYPPSHKPIIERIAKE-GLLLSEY 119 >gi|297379555|gb|ADI34442.1| DNA protecting protein DprA [Helicobacter pylori v225d] Length = 266 Score = 38.0 bits (89), Expect = 0.43, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|308182506|ref|YP_003926633.1| DNA processing chain A [Helicobacter pylori PeCan4] gi|308064691|gb|ADO06583.1| DNA processing chain A [Helicobacter pylori PeCan4] Length = 266 Score = 38.0 bits (89), Expect = 0.44, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|261837773|gb|ACX97539.1| DNA processing chain A [Helicobacter pylori 51] Length = 266 Score = 38.0 bits (89), Expect = 0.44, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|208434281|ref|YP_002265947.1| DNA processing chain A [Helicobacter pylori G27] gi|208432210|gb|ACI27081.1| DNA processing chain A [Helicobacter pylori G27] Length = 266 Score = 38.0 bits (89), Expect = 0.44, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|229031464|ref|ZP_04187464.1| DNA protecting protein DprA [Bacillus cereus AH1271] gi|228729753|gb|EEL80733.1| DNA protecting protein DprA [Bacillus cereus AH1271] Length = 211 Score = 38.0 bits (89), Expect = 0.45, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ENR+L E + + ++E P Sbjct: 94 LGHGLSYMYPKENRHLYETWNEYI-LLLTEYPP 125 >gi|293189842|ref|ZP_06608556.1| DNA protecting protein DprA [Actinomyces odontolyticus F0309] gi|292821257|gb|EFF80202.1| DNA protecting protein DprA [Actinomyces odontolyticus F0309] Length = 386 Score = 38.0 bits (89), Expect = 0.45, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG+ YP + + D GG ISE+ Sbjct: 184 LAGGVCNPYPACHGGDFRTVIDGGGALISEVAP 216 >gi|229013017|ref|ZP_04170182.1| DNA protecting protein DprA [Bacillus mycoides DSM 2048] gi|228748271|gb|EEL98131.1| DNA protecting protein DprA [Bacillus mycoides DSM 2048] Length = 264 Score = 38.0 bits (89), Expect = 0.45, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 9/37 (24%) Query: 1 MAGGLDCLYPPENRNLLEE----IWDNGGIAISEIPF 33 + GL +YP ENR L + I + ++E P Sbjct: 172 LGHGLSYMYPKENRGLYDTWKDYI-----LLLTEYPP 203 >gi|210134528|ref|YP_002300967.1| DNA processing protein [Helicobacter pylori P12] gi|210132496|gb|ACJ07487.1| DNA processing protein [Helicobacter pylori P12] Length = 266 Score = 38.0 bits (89), Expect = 0.45, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|317496197|ref|ZP_07954557.1| DNA recombination-mediator protein A [Gemella moribillum M424] gi|316913772|gb|EFV35258.1| DNA recombination-mediator protein A [Gemella moribillum M424] Length = 296 Score = 38.0 bits (89), Expect = 0.46, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G + +YP ++R L + + + ISE Sbjct: 179 IAQGHNIVYPEQSRELYRQ-LEANHLIISEYFP 210 >gi|308063195|gb|ADO05082.1| hypothetical protein HPSAT_01665 [Helicobacter pylori Sat464] Length = 266 Score = 38.0 bits (89), Expect = 0.46, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|308184137|ref|YP_003928270.1| hypothetical protein HPSJM_01785 [Helicobacter pylori SJM180] gi|308060057|gb|ADO01953.1| hypothetical protein HPSJM_01785 [Helicobacter pylori SJM180] Length = 266 Score = 38.0 bits (89), Expect = 0.48, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|149193945|ref|ZP_01871043.1| DNA processing protein A [Caminibacter mediatlanticus TB-2] gi|149135898|gb|EDM24376.1| DNA processing protein A [Caminibacter mediatlanticus TB-2] Length = 236 Score = 38.0 bits (89), Expect = 0.48, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N NL++ I+ G+A+SE Sbjct: 79 PSSLDIIYPKSNENLIKNIYKE-GLALSEY 107 >gi|15611384|ref|NP_223035.1| hypothetical protein jhp0316 [Helicobacter pylori J99] gi|4154854|gb|AAD05907.1| putative [Helicobacter pylori J99] Length = 266 Score = 38.0 bits (89), Expect = 0.48, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|308061684|gb|ADO03572.1| DNA processing chain A [Helicobacter pylori Cuz20] Length = 266 Score = 38.0 bits (89), Expect = 0.49, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHQVIQEI-AQNGLILSEY 125 >gi|224373178|ref|YP_002607550.1| DNA processing protein A [Nautilia profundicola AmH] gi|223589312|gb|ACM93048.1| DNA processing protein A [Nautilia profundicola AmH] Length = 235 Score = 37.6 bits (88), Expect = 0.51, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N++L++ I++N +AISE Sbjct: 81 PSSLDIIYPKSNKSLIQNIYENP-LAISEY 109 >gi|260575925|ref|ZP_05843920.1| DNA protecting protein DprA [Rhodobacter sp. SW2] gi|259021851|gb|EEW25152.1| DNA protecting protein DprA [Rhodobacter sp. SW2] Length = 378 Score = 37.6 bits (88), Expect = 0.52, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L G ISE P G Sbjct: 178 AGGVDVIYPVENAA-LAAEIAAKGCRISEQPPG 209 >gi|217031560|ref|ZP_03437065.1| hypothetical protein HPB128_21g118 [Helicobacter pylori B128] gi|298736722|ref|YP_003729252.1| DNA processing protein chain A [Helicobacter pylori B8] gi|216946760|gb|EEC25356.1| hypothetical protein HPB128_21g118 [Helicobacter pylori B128] gi|298355916|emb|CBI66788.1| DNA processing protein chain A (DprA) [Helicobacter pylori B8] Length = 266 Score = 37.6 bits (88), Expect = 0.54, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHKVIQEI-AQNGLILSEY 125 >gi|229134641|ref|ZP_04263451.1| DNA protecting protein DprA [Bacillus cereus BDRD-ST196] gi|228648902|gb|EEL04927.1| DNA protecting protein DprA [Bacillus cereus BDRD-ST196] Length = 159 Score = 37.6 bits (88), Expect = 0.55, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 9/37 (24%) Query: 1 MAGGLDCLYPPENRNLLEE----IWDNGGIAISEIPF 33 + GL +YP ENR L + I + ++E P Sbjct: 42 LGHGLSYMYPKENRGLYDTWKDYI-----LLLTEYPP 73 >gi|329768266|ref|ZP_08259767.1| hypothetical protein HMPREF0428_01464 [Gemella haemolysans M341] gi|328837465|gb|EGF87094.1| hypothetical protein HMPREF0428_01464 [Gemella haemolysans M341] Length = 296 Score = 37.6 bits (88), Expect = 0.56, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G + +YP ++ L +E + + ISE Sbjct: 179 IAHGHNIIYPEKSYKLYKE-LERNHLIISEYFP 210 >gi|255321386|ref|ZP_05362546.1| DNA protecting protein DprA [Campylobacter showae RM3277] gi|255301539|gb|EET80796.1| DNA protecting protein DprA [Campylobacter showae RM3277] Length = 255 Score = 37.6 bits (88), Expect = 0.57, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GL+ +YPP N +++EI+ N +A+SE Sbjct: 90 GNGLNKIYPPSNAKIIKEIYQNA-LALSEYAP 120 >gi|254449997|ref|ZP_05063434.1| DNA protecting protein DprA [Octadecabacter antarcticus 238] gi|198264403|gb|EDY88673.1| DNA protecting protein DprA [Octadecabacter antarcticus 238] Length = 336 Score = 37.6 bits (88), Expect = 0.58, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 8 LYPPENRNLLEEIWDNGGIAISEIPFG 34 +YP EN NL ++I N G+ +S+ P G Sbjct: 147 IYPAENANLAQKITKN-GLRVSDQPIG 172 >gi|207092057|ref|ZP_03239844.1| DNA processing chain A [Helicobacter pylori HPKX_438_AG0C1] Length = 266 Score = 37.6 bits (88), Expect = 0.58, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNYKVIQEI-AQNGLILSEY 125 >gi|315453491|ref|YP_004073761.1| putative DNA processing chain A, DprA [Helicobacter felis ATCC 49179] gi|315132543|emb|CBY83171.1| putative DNA processing chain A, DprA [Helicobacter felis ATCC 49179] Length = 251 Score = 37.6 bits (88), Expect = 0.59, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD LYPP N ++E+I G+ +SE Sbjct: 81 PCSLDYLYPPSNARVIEQI-ATEGLILSEY 109 >gi|256379589|ref|YP_003103249.1| hypothetical protein Amir_5585 [Actinosynnema mirum DSM 43827] gi|255923892|gb|ACU39403.1| SMF family protein [Actinosynnema mirum DSM 43827] Length = 314 Score = 37.6 bits (88), Expect = 0.61, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIW-DNGGIAISEI 31 + G++ +P ENR L ++I D G +S+ Sbjct: 177 IGTGINRYFPAENRVLTDKIATDGQGAVVSQF 208 >gi|120437576|ref|YP_863262.1| Smf family protein [Gramella forsetii KT0803] gi|117579726|emb|CAL68195.1| Smf family protein [Gramella forsetii KT0803] Length = 366 Score = 37.6 bits (88), Expect = 0.62, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 17/25 (68%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGG 25 +A GL+ +YP ++ + EI DNGG Sbjct: 174 LAHGLNQIYPKSHKKYMSEIEDNGG 198 >gi|187918171|ref|YP_001883734.1| Smf protein [Borrelia hermsii DAH] gi|119861019|gb|AAX16814.1| Smf protein [Borrelia hermsii DAH] Length = 314 Score = 37.6 bits (88), Expect = 0.64, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 +A +D +YP +NR + + +NGG ++E Sbjct: 165 IATDIDNIYPKQNRKYVTRLLENGGGVLTE 194 >gi|217033374|ref|ZP_03438805.1| hypothetical protein HP9810_9g127 [Helicobacter pylori 98-10] gi|216944315|gb|EEC23740.1| hypothetical protein HP9810_9g127 [Helicobacter pylori 98-10] Length = 266 Score = 37.6 bits (88), Expect = 0.66, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFVYPTNNHKVIQEI-AQNGLILSEY 125 >gi|268679506|ref|YP_003303937.1| SMF family protein [Sulfurospirillum deleyianum DSM 6946] gi|268617537|gb|ACZ11902.1| SMF family protein [Sulfurospirillum deleyianum DSM 6946] Length = 256 Score = 37.2 bits (87), Expect = 0.67, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP + ++E I +N G+ +S+ G Sbjct: 92 GTGLDRRYPAIHAKMIEGI-ENEGLVLSQFEAG 123 >gi|51598558|ref|YP_072746.1| smg protein [Borrelia garinii PBi] gi|51573129|gb|AAU07154.1| smg protein [Borrelia garinii PBi] Length = 285 Score = 37.2 bits (87), Expect = 0.68, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG ISE Sbjct: 169 IDNIYPKQNRKYVFKLLEQGGGIISE 194 >gi|317008981|gb|ADU79561.1| hypothetical protein HPIN_01525 [Helicobacter pylori India7] Length = 266 Score = 37.2 bits (87), Expect = 0.71, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFVYPTNNHKVIQEI-AQNGLILSEY 125 >gi|305433167|ref|ZP_07402323.1| DNA protecting protein DprA [Campylobacter coli JV20] gi|304443868|gb|EFM36525.1| DNA protecting protein DprA [Campylobacter coli JV20] Length = 256 Score = 37.2 bits (87), Expect = 0.71, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 A GLD +YP N ++++I++N +A+SE Sbjct: 92 ANGLDEIYPRSNEKIIKQIYENA-LALSE 119 >gi|57167660|ref|ZP_00366800.1| DNA processing chain A (dprA) [Campylobacter coli RM2228] gi|57020782|gb|EAL57446.1| DNA processing chain A (dprA) [Campylobacter coli RM2228] Length = 256 Score = 37.2 bits (87), Expect = 0.71, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 A GLD +YP N ++++I++N +A+SE Sbjct: 92 ANGLDEIYPRSNEKIIKQIYENA-LALSE 119 >gi|317010614|gb|ADU84361.1| DNA processing protein DprA [Helicobacter pylori SouthAfrica7] Length = 266 Score = 37.2 bits (87), Expect = 0.73, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N +++EI G+ +SE Sbjct: 97 PCSLDFVYPTNNHKVIQEI-AQNGLILSEY 125 >gi|183220102|ref|YP_001838098.1| DNA processing chain DprA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] gi|189910222|ref|YP_001961777.1| DNA processing protein A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] gi|167774898|gb|ABZ93199.1| DNA processing protein A [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] gi|167778524|gb|ABZ96822.1| Putative DNA processing chain A DprA, SMF family [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] Length = 308 Score = 37.2 bits (87), Expect = 0.76, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEI-WDNGGIAISEI 31 + L YPP NR+L + I D + ISE Sbjct: 157 LGTTLGMEYPPGNRDLYKRIKSDTKQLLISEF 188 >gi|242309712|ref|ZP_04808867.1| DNA processing protein DprA [Helicobacter pullorum MIT 98-5489] gi|239523713|gb|EEQ63579.1| DNA processing protein DprA [Helicobacter pullorum MIT 98-5489] Length = 255 Score = 37.2 bits (87), Expect = 0.79, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 LD +YP N+ +++EI+ N + +S+ P Sbjct: 90 PSSLDIIYPKTNQKIIQEIYKNA-LILSQFPP 120 >gi|302060149|ref|ZP_07251690.1| DNA processing protein DprA, putative [Pseudomonas syringae pv. tomato K40] Length = 372 Score = 37.2 bits (87), Expect = 0.82, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 182 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 214 >gi|213968423|ref|ZP_03396566.1| DNA processing protein DprA [Pseudomonas syringae pv. tomato T1] gi|301384289|ref|ZP_07232707.1| DNA processing protein DprA, putative [Pseudomonas syringae pv. tomato Max13] gi|302130422|ref|ZP_07256412.1| DNA processing protein DprA, putative [Pseudomonas syringae pv. tomato NCPPB 1108] gi|213926711|gb|EEB60263.1| DNA processing protein DprA [Pseudomonas syringae pv. tomato T1] gi|331017685|gb|EGH97741.1| DNA processing protein DprA, putative [Pseudomonas syringae pv. lachrymans str. M302278PT] Length = 371 Score = 37.2 bits (87), Expect = 0.82, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|312149281|gb|ADQ29352.1| protein smf [Borrelia burgdorferi N40] Length = 314 Score = 37.2 bits (87), Expect = 0.84, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 168 IDNIYPRQNRKYVSKLLEQGGGIITE 193 >gi|225549131|ref|ZP_03770106.1| protein smf [Borrelia burgdorferi 94a] gi|225370357|gb|EEG99795.1| protein smf [Borrelia burgdorferi 94a] Length = 315 Score = 37.2 bits (87), Expect = 0.84, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 169 IDNIYPRQNRKYVSKLLEQGGGIITE 194 >gi|224533716|ref|ZP_03674304.1| protein smf [Borrelia burgdorferi CA-11.2a] gi|224513009|gb|EEF83372.1| protein smf [Borrelia burgdorferi CA-11.2a] Length = 314 Score = 37.2 bits (87), Expect = 0.84, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 168 IDNIYPRQNRKYVSKLLEQGGGIITE 193 >gi|226320598|ref|ZP_03796158.1| protein smf [Borrelia burgdorferi 29805] gi|226234017|gb|EEH32738.1| protein smf [Borrelia burgdorferi 29805] Length = 314 Score = 37.2 bits (87), Expect = 0.84, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 168 IDNIYPRQNRKYVSKLLEQGGGIITE 193 >gi|224533106|ref|ZP_03673706.1| protein smf [Borrelia burgdorferi WI91-23] gi|224511833|gb|EEF82234.1| protein smf [Borrelia burgdorferi WI91-23] Length = 314 Score = 37.2 bits (87), Expect = 0.84, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 168 IDNIYPRQNRKYVSKLLEQGGGIITE 193 >gi|195941349|ref|ZP_03086731.1| smg protein [Borrelia burgdorferi 80a] Length = 314 Score = 37.2 bits (87), Expect = 0.84, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 168 IDNIYPRQNRKYVSKLLEQGGGIITE 193 >gi|221217656|ref|ZP_03589124.1| protein smf [Borrelia burgdorferi 72a] gi|221192333|gb|EEE18552.1| protein smf [Borrelia burgdorferi 72a] Length = 314 Score = 37.2 bits (87), Expect = 0.84, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 168 IDNIYPRQNRKYVSKLLEQGGGIITE 193 >gi|218249856|ref|YP_002374820.1| protein smf [Borrelia burgdorferi ZS7] gi|223888920|ref|ZP_03623511.1| protein smf [Borrelia burgdorferi 64b] gi|226321615|ref|ZP_03797141.1| protein smf [Borrelia burgdorferi Bol26] gi|218165044|gb|ACK75105.1| protein smf [Borrelia burgdorferi ZS7] gi|223885736|gb|EEF56835.1| protein smf [Borrelia burgdorferi 64b] gi|226232804|gb|EEH31557.1| protein smf [Borrelia burgdorferi Bol26] gi|312148335|gb|ADQ30994.1| protein smf [Borrelia burgdorferi JD1] Length = 314 Score = 37.2 bits (87), Expect = 0.84, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 168 IDNIYPRQNRKYVSKLLEQGGGIITE 193 >gi|216264155|ref|ZP_03436147.1| protein smf [Borrelia burgdorferi 156a] gi|215980628|gb|EEC21435.1| protein smf [Borrelia burgdorferi 156a] Length = 314 Score = 37.2 bits (87), Expect = 0.84, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 168 IDNIYPRQNRKYVSKLLEQGGGIITE 193 >gi|1196312|gb|AAB51404.1| putative [Borrelia burgdorferi] gi|1234878|emb|CAA65466.1| smf [Borrelia burgdorferi] Length = 314 Score = 37.2 bits (87), Expect = 0.84, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 169 IDNIYPRQNRKYVSKLLEQGGGIITE 194 >gi|15594642|ref|NP_212431.1| smg protein [Borrelia burgdorferi B31] gi|3914980|sp|Q44773|SMF_BORBU RecName: Full=Protein smf gi|1165281|gb|AAA85620.1| Smg [Borrelia burgdorferi] gi|2688169|gb|AAC66651.1| smg protein [Borrelia burgdorferi B31] Length = 315 Score = 37.2 bits (87), Expect = 0.84, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 169 IDNIYPRQNRKYVSKLLEQGGGIITE 194 >gi|325570946|ref|ZP_08146565.1| DNA protecting protein DprA [Enterococcus casseliflavus ATCC 12755] gi|325156272|gb|EGC68456.1| DNA protecting protein DprA [Enterococcus casseliflavus ATCC 12755] Length = 292 Score = 37.2 bits (87), Expect = 0.85, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GL+ YP L ++I + +SE Sbjct: 174 IASGLEHCYPTSAYPLFQQIRQEH-LVLSEY 203 >gi|320326684|gb|EFW82729.1| DNA processing protein DprA [Pseudomonas syringae pv. glycinea str. B076] gi|320331342|gb|EFW87285.1| DNA processing protein DprA [Pseudomonas syringae pv. glycinea str. race 4] Length = 372 Score = 37.2 bits (87), Expect = 0.86, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|289627011|ref|ZP_06459965.1| DNA processing protein DprA [Pseudomonas syringae pv. aesculi str. NCPPB3681] gi|289647924|ref|ZP_06479267.1| DNA processing protein DprA [Pseudomonas syringae pv. aesculi str. 2250] gi|330867903|gb|EGH02612.1| DNA processing protein DprA [Pseudomonas syringae pv. aesculi str. 0893_23] Length = 372 Score = 37.2 bits (87), Expect = 0.86, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|146280385|ref|YP_001170539.1| SMF family protein [Rhodobacter sphaeroides ATCC 17025] gi|145558626|gb|ABP73234.1| SMF family protein [Rhodobacter sphaeroides ATCC 17025] Length = 226 Score = 37.2 bits (87), Expect = 0.86, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + L YP +NR LL +I +AIS+ P G Sbjct: 98 LGTPLSQAYPAKNRRLL-DIIKKDHLAISQFPEG 130 >gi|66043292|ref|YP_233133.1| SMF protein [Pseudomonas syringae pv. syringae B728a] gi|63253999|gb|AAY35095.1| SMF protein [Pseudomonas syringae pv. syringae B728a] Length = 372 Score = 37.2 bits (87), Expect = 0.86, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L +I GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQIAAQGGAVISEFPL 213 >gi|293367866|ref|ZP_06614510.1| DNA processing SMF protein [Staphylococcus epidermidis M23864:W2(grey)] gi|291318001|gb|EFE58403.1| DNA processing SMF protein [Staphylococcus epidermidis M23864:W2(grey)] Length = 283 Score = 36.9 bits (86), Expect = 0.87, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 6 DCLYPPENRNLLEEIWDNGGIAIS 29 + +YP EN L +EI + G+ +S Sbjct: 185 NKIYPKENHKLAKEI-ASKGLLLS 207 >gi|228992562|ref|ZP_04152489.1| DNA protecting protein DprA [Bacillus pseudomycoides DSM 12442] gi|228767196|gb|EEM15832.1| DNA protecting protein DprA [Bacillus pseudomycoides DSM 12442] Length = 291 Score = 36.9 bits (86), Expect = 0.87, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP EN + IW N + ++E P Sbjct: 174 LGHGLQYMYPKENCYFYK-IWKNTVLLLTEYPP 205 >gi|330881836|gb|EGH15985.1| DNA processing protein DprA [Pseudomonas syringae pv. glycinea str. race 4] Length = 305 Score = 36.9 bits (86), Expect = 0.88, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|257485582|ref|ZP_05639623.1| DNA processing protein DprA [Pseudomonas syringae pv. tabaci ATCC 11528] gi|330985721|gb|EGH83824.1| DNA processing protein DprA [Pseudomonas syringae pv. lachrymans str. M301315] Length = 372 Score = 36.9 bits (86), Expect = 0.88, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|330970345|gb|EGH70411.1| SMF protein [Pseudomonas syringae pv. aceris str. M302273PT] Length = 372 Score = 36.9 bits (86), Expect = 0.89, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L +I GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQIAAQGGAVISEFPL 213 >gi|330901112|gb|EGH32531.1| SMF protein [Pseudomonas syringae pv. japonica str. M301072PT] Length = 372 Score = 36.9 bits (86), Expect = 0.89, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|229815418|ref|ZP_04445750.1| hypothetical protein COLINT_02466 [Collinsella intestinalis DSM 13280] gi|229808951|gb|EEP44721.1| hypothetical protein COLINT_02466 [Collinsella intestinalis DSM 13280] Length = 308 Score = 36.9 bits (86), Expect = 0.89, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 16/34 (47%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP L++ GG +S P+G Sbjct: 102 LGTGADVVYPSSAGRLIDRSLLQGGCVLSLEPWG 135 >gi|330876382|gb|EGH10531.1| DNA processing protein DprA [Pseudomonas syringae pv. morsprunorum str. M302280PT] gi|330965120|gb|EGH65380.1| DNA processing protein DprA [Pseudomonas syringae pv. actinidiae str. M302091] Length = 371 Score = 36.9 bits (86), Expect = 0.90, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|330952312|gb|EGH52572.1| SMF protein [Pseudomonas syringae Cit 7] Length = 337 Score = 36.9 bits (86), Expect = 0.91, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|326403290|ref|YP_004283371.1| putative DNA processing protein [Acidiphilium multivorum AIU301] gi|325050151|dbj|BAJ80489.1| putative DNA processing protein [Acidiphilium multivorum AIU301] Length = 373 Score = 36.9 bits (86), Expect = 0.91, Method: Composition-based stats. Identities = 11/20 (55%), Positives = 15/20 (75%) Query: 1 MAGGLDCLYPPENRNLLEEI 20 + GGLD +YPPE+R+L I Sbjct: 165 IPGGLDVVYPPEHRDLQAHI 184 >gi|302186430|ref|ZP_07263103.1| SMF protein [Pseudomonas syringae pv. syringae 642] Length = 372 Score = 36.9 bits (86), Expect = 0.92, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|315635655|ref|ZP_07890918.1| DNA protecting protein DprA [Arcobacter butzleri JV22] gi|315479952|gb|EFU70622.1| DNA protecting protein DprA [Arcobacter butzleri JV22] Length = 258 Score = 36.9 bits (86), Expect = 0.93, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAIS 29 A GLD YP N+NL+ +I +N G+ +S Sbjct: 92 ANGLDIRYPSVNKNLIIDI-ENNGLILS 118 >gi|228998610|ref|ZP_04158197.1| DNA protecting protein DprA [Bacillus mycoides Rock3-17] gi|229006110|ref|ZP_04163798.1| DNA protecting protein DprA [Bacillus mycoides Rock1-4] gi|228755186|gb|EEM04543.1| DNA protecting protein DprA [Bacillus mycoides Rock1-4] gi|228761078|gb|EEM10037.1| DNA protecting protein DprA [Bacillus mycoides Rock3-17] Length = 291 Score = 36.9 bits (86), Expect = 0.93, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP EN + IW N + ++E P Sbjct: 174 LGHGLQYMYPKENCYFYK-IWKNTVLLLTEYPP 205 >gi|291542637|emb|CBL15747.1| DNA protecting protein DprA [Ruminococcus bromii L2-63] Length = 419 Score = 36.9 bits (86), Expect = 0.94, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GL+C Y EN ++ I G I+E P Sbjct: 175 GCGLNCSYLRENSDIRSTIPKR-GAVITEYPP 205 >gi|331011871|gb|EGH91927.1| DNA processing protein DprA [Pseudomonas syringae pv. tabaci ATCC 11528] Length = 247 Score = 36.9 bits (86), Expect = 0.96, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|330976424|gb|EGH76480.1| SMF protein [Pseudomonas syringae pv. aptata str. DSM 50252] Length = 372 Score = 36.9 bits (86), Expect = 0.96, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|330937248|gb|EGH41264.1| SMF protein [Pseudomonas syringae pv. pisi str. 1704B] Length = 372 Score = 36.9 bits (86), Expect = 0.96, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|225550061|ref|ZP_03771021.1| protein smf [Borrelia burgdorferi 118a] gi|225369173|gb|EEG98626.1| protein smf [Borrelia burgdorferi 118a] Length = 314 Score = 36.9 bits (86), Expect = 1.0, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 168 IDNIYPKQNRKYVSKLLEQGGGIITE 193 >gi|33863928|ref|NP_895488.1| SMF family protein [Prochlorococcus marinus str. MIT 9313] gi|33635512|emb|CAE21836.1| SMF family [Prochlorococcus marinus str. MIT 9313] Length = 352 Score = 36.9 bits (86), Expect = 1.0, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 L +YP +N L + + G+ ++E P Sbjct: 157 GTPLHKVYPRQNEGL-QALVAAQGLLVTEQP 186 >gi|289677571|ref|ZP_06498461.1| SMF protein [Pseudomonas syringae pv. syringae FF5] Length = 247 Score = 36.9 bits (86), Expect = 1.0, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|298484629|ref|ZP_07002733.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|298160853|gb|EFI01870.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] Length = 372 Score = 36.9 bits (86), Expect = 1.1, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|330890230|gb|EGH22891.1| DNA processing protein DprA [Pseudomonas syringae pv. mori str. 301020] Length = 372 Score = 36.9 bits (86), Expect = 1.1, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAAQGGAVISEFPL 213 >gi|39841569|gb|AAR31191.1| unknown [Burkholderia pseudomallei 1026b] Length = 108 Score = 36.9 bits (86), Expect = 1.1, Method: Composition-based stats. Identities = 8/32 (25%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + + +YP EN L +I + + +S++P Sbjct: 5 IGTPISEVYPRENAELQRKIAEEY-LVVSQVP 35 >gi|332522868|ref|ZP_08399120.1| DNA protecting protein DprA [Streptococcus porcinus str. Jelinkova 176] gi|332314132|gb|EGJ27117.1| DNA protecting protein DprA [Streptococcus porcinus str. Jelinkova 176] Length = 279 Score = 36.9 bits (86), Expect = 1.1, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G YP EN+ L + I N + ++E Sbjct: 163 IGSGFTHYYPKENQRLQKFIASNH-LLLTEY 192 >gi|325971946|ref|YP_004248137.1| SMF family protein [Spirochaeta sp. Buddy] gi|324027184|gb|ADY13943.1| SMF family protein [Spirochaeta sp. Buddy] Length = 312 Score = 36.5 bits (85), Expect = 1.1, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + ++ YPPE+ L +EI G +S Sbjct: 173 IGTPINAYYPPEHCALQQEI-AKVGAVVSRFSP 204 >gi|167561070|ref|ZP_02353986.1| SMF protein [Burkholderia oklahomensis EO147] Length = 304 Score = 36.5 bits (85), Expect = 1.1, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + + +YP EN L +EI + +S++P Sbjct: 176 IGTPITEVYPRENSEL-QEIIAREHLVVSQVPI 207 >gi|330685677|gb|EGG97318.1| DNA protecting protein DprA [Staphylococcus epidermidis VCU121] Length = 258 Score = 36.5 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G YP +L + I + G+ ISE P Sbjct: 141 LGFGHHYYYPRNLVSLRKNI-EEKGLVISEYPP 172 >gi|87124891|ref|ZP_01080738.1| SMF protein [Synechococcus sp. RS9917] gi|86167211|gb|EAQ68471.1| SMF protein [Synechococcus sp. RS9917] Length = 369 Score = 36.5 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 9/29 (31%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 L +YPPE+ L + G+ +SE Sbjct: 177 GTPLTRVYPPEHERLQAA-VASQGLLLSE 204 >gi|329733683|gb|EGG70011.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus 21193] Length = 290 Score = 36.5 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 173 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 204 >gi|283770313|ref|ZP_06343205.1| DNA processing protein [Staphylococcus aureus subsp. aureus H19] gi|283460460|gb|EFC07550.1| DNA processing protein [Staphylococcus aureus subsp. aureus H19] gi|283470464|emb|CAQ49675.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus ST398] Length = 290 Score = 36.5 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 173 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 204 >gi|258423910|ref|ZP_05686795.1| SMF family protein [Staphylococcus aureus A9635] gi|257845939|gb|EEV69968.1| SMF family protein [Staphylococcus aureus A9635] Length = 290 Score = 36.5 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 173 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 204 >gi|82750850|ref|YP_416591.1| DNA processing protein [Staphylococcus aureus RF122] gi|82656381|emb|CAI80800.1| DNA processing protein [Staphylococcus aureus RF122] Length = 290 Score = 36.5 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 173 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 204 >gi|15924239|ref|NP_371773.1| DNA processing Smf protein [Staphylococcus aureus subsp. aureus Mu50] gi|15926832|ref|NP_374365.1| hypothetical protein SA1092 [Staphylococcus aureus subsp. aureus N315] gi|156979570|ref|YP_001441829.1| hypothetical protein SAHV_1239 [Staphylococcus aureus subsp. aureus Mu3] gi|253315606|ref|ZP_04838819.1| hypothetical protein SauraC_05567 [Staphylococcus aureus subsp. aureus str. CF-Marseille] gi|255006036|ref|ZP_05144637.2| hypothetical protein SauraM_06185 [Staphylococcus aureus subsp. aureus Mu50-omega] gi|258434837|ref|ZP_05688911.1| DNA processing Smf protein [Staphylococcus aureus A9299] gi|258444587|ref|ZP_05692916.1| DNA processing Smf protein [Staphylococcus aureus A8115] gi|282892737|ref|ZP_06300972.1| DNA processing protein [Staphylococcus aureus A8117] gi|13701049|dbj|BAB42344.1| SA1092 [Staphylococcus aureus subsp. aureus N315] gi|14247019|dbj|BAB57411.1| similar to DNA processing Smf protein [Staphylococcus aureus subsp. aureus Mu50] gi|156721705|dbj|BAF78122.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] gi|257849198|gb|EEV73180.1| DNA processing Smf protein [Staphylococcus aureus A9299] gi|257850080|gb|EEV74033.1| DNA processing Smf protein [Staphylococcus aureus A8115] gi|282764734|gb|EFC04859.1| DNA processing protein [Staphylococcus aureus A8117] Length = 290 Score = 36.5 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 173 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 204 >gi|21282861|ref|NP_645949.1| hypothetical protein MW1132 [Staphylococcus aureus subsp. aureus MW2] gi|49486088|ref|YP_043309.1| SMF family protein [Staphylococcus aureus subsp. aureus MSSA476] gi|57651818|ref|YP_186124.1| DNA processing protein DprA, putative [Staphylococcus aureus subsp. aureus COL] gi|87160701|ref|YP_493839.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus USA300_FPR3757] gi|151221371|ref|YP_001332193.1| hypothetical protein NWMN_1159 [Staphylococcus aureus subsp. aureus str. Newman] gi|161509415|ref|YP_001575074.1| SMF family nucleotide-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] gi|221142039|ref|ZP_03566532.1| SMF family nucleotide-binding protein [Staphylococcus aureus subsp. aureus str. JKD6009] gi|253733513|ref|ZP_04867678.1| DNA processing protein [Staphylococcus aureus subsp. aureus TCH130] gi|258452548|ref|ZP_05700554.1| DNA protecting protein DprA [Staphylococcus aureus A5948] gi|262048145|ref|ZP_06021032.1| hypothetical protein SAD30_1921 [Staphylococcus aureus D30] gi|282920493|ref|ZP_06328214.1| DNA processing protein [Staphylococcus aureus A9765] gi|284024242|ref|ZP_06378640.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus 132] gi|294848244|ref|ZP_06788991.1| DNA processing protein [Staphylococcus aureus A9754] gi|297208105|ref|ZP_06924536.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus ATCC 51811] gi|300912186|ref|ZP_07129629.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus TCH70] gi|21204300|dbj|BAB94997.1| MW1132 [Staphylococcus aureus subsp. aureus MW2] gi|49244531|emb|CAG42960.1| SMF family protein [Staphylococcus aureus subsp. aureus MSSA476] gi|57286004|gb|AAW38098.1| DNA processing protein DprA, putative [Staphylococcus aureus subsp. aureus COL] gi|87126675|gb|ABD21189.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus USA300_FPR3757] gi|150374171|dbj|BAF67431.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] gi|160368224|gb|ABX29195.1| SMF family nucleotide-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] gi|253728567|gb|EES97296.1| DNA processing protein [Staphylococcus aureus subsp. aureus TCH130] gi|257859766|gb|EEV82608.1| DNA protecting protein DprA [Staphylococcus aureus A5948] gi|259163711|gb|EEW48266.1| hypothetical protein SAD30_1921 [Staphylococcus aureus D30] gi|269940740|emb|CBI49122.1| SMF family protein [Staphylococcus aureus subsp. aureus TW20] gi|282594155|gb|EFB99142.1| DNA processing protein [Staphylococcus aureus A9765] gi|294825044|gb|EFG41466.1| DNA processing protein [Staphylococcus aureus A9754] gi|296887348|gb|EFH26250.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus ATCC 51811] gi|300886432|gb|EFK81634.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus TCH70] gi|302751072|gb|ADL65249.1| DNA recombination-mediator protein [Staphylococcus aureus subsp. aureus str. JKD6008] gi|315198489|gb|EFU28818.1| SMF family nucleotide-binding protein [Staphylococcus aureus subsp. aureus CGS01] gi|329313919|gb|AEB88332.1| SMF family nucleotide-binding protein [Staphylococcus aureus subsp. aureus T0131] gi|329727849|gb|EGG64300.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus 21189] Length = 290 Score = 36.5 bits (85), Expect = 1.2, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 173 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 204 >gi|223039655|ref|ZP_03609941.1| DNA protecting protein DprA [Campylobacter rectus RM3267] gi|222879038|gb|EEF14133.1| DNA protecting protein DprA [Campylobacter rectus RM3267] Length = 255 Score = 36.5 bits (85), Expect = 1.3, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GL+ +YPP N +++EI+ N +A+SE Sbjct: 90 GNGLNKIYPPSNAKIIKEIYQNA-LALSEYDP 120 >gi|283956048|ref|ZP_06373535.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 1336] gi|283792368|gb|EFC31150.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 1336] Length = 257 Score = 36.5 bits (85), Expect = 1.3, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GL+ +YP N ++++I++N +A+SE Sbjct: 93 ANGLEQIYPRTNEKIIKQIYENA-LALSEY 121 >gi|258447580|ref|ZP_05695724.1| DNA processing Smf protein [Staphylococcus aureus A6300] gi|257853771|gb|EEV76730.1| DNA processing Smf protein [Staphylococcus aureus A6300] Length = 178 Score = 36.5 bits (85), Expect = 1.4, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 61 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 92 >gi|253731868|ref|ZP_04866033.1| DNA processing protein [Staphylococcus aureus subsp. aureus USA300_TCH959] gi|3767595|dbj|BAA33858.1| ORF4 [Staphylococcus aureus] gi|253724278|gb|EES93007.1| DNA processing protein [Staphylococcus aureus subsp. aureus USA300_TCH959] gi|320140934|gb|EFW32781.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus MRSA131] gi|320144350|gb|EFW36116.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus MRSA177] Length = 267 Score = 36.5 bits (85), Expect = 1.4, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 150 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 181 >gi|149369266|ref|ZP_01889118.1| Smf protein DNA processing chain A [unidentified eubacterium SCB49] gi|149356693|gb|EDM45248.1| Smf protein DNA processing chain A [unidentified eubacterium SCB49] Length = 380 Score = 36.5 bits (85), Expect = 1.4, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GL+ +YP ++ + ++ NGG ISE Sbjct: 190 AHGLNQVYPKVHKKYMSQVEANGGF-ISEF 218 >gi|298694541|gb|ADI97763.1| DNA processing protein DprA, putative [Staphylococcus aureus subsp. aureus ED133] gi|323443896|gb|EGB01507.1| DNA protecting protein DprA [Staphylococcus aureus O46] Length = 267 Score = 36.5 bits (85), Expect = 1.4, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 150 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 181 >gi|291280181|ref|YP_003497016.1| DNA processing protein A [Deferribacter desulfuricans SSM1] gi|290754883|dbj|BAI81260.1| DNA processing protein A [Deferribacter desulfuricans SSM1] Length = 378 Score = 36.1 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 M GL +YP NR +E+ + G A++E Sbjct: 184 MGCGLKYVYPDSNRRYFKELVE-KGCALTEF 213 >gi|323441027|gb|EGA98734.1| DNA protecting protein DprA [Staphylococcus aureus O11] Length = 267 Score = 36.1 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 150 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 181 >gi|257795695|ref|ZP_05644674.1| DNA processing protein Smf [Staphylococcus aureus A9781] gi|258415919|ref|ZP_05682189.1| DNA processing protein Smf [Staphylococcus aureus A9763] gi|258421681|ref|ZP_05684605.1| DNA processing Smf protein [Staphylococcus aureus A9719] gi|258449422|ref|ZP_05697525.1| DNA processing Smf protein [Staphylococcus aureus A6224] gi|258454801|ref|ZP_05702765.1| DNA processing Smf protein [Staphylococcus aureus A5937] gi|282927591|ref|ZP_06335207.1| DNA processing protein [Staphylococcus aureus A10102] gi|295406185|ref|ZP_06815992.1| DNA processing protein [Staphylococcus aureus A8819] gi|297244413|ref|ZP_06928296.1| DNA processing protein [Staphylococcus aureus A8796] gi|257789667|gb|EEV28007.1| DNA processing protein Smf [Staphylococcus aureus A9781] gi|257839255|gb|EEV63729.1| DNA processing protein Smf [Staphylococcus aureus A9763] gi|257842367|gb|EEV66792.1| DNA processing Smf protein [Staphylococcus aureus A9719] gi|257857410|gb|EEV80308.1| DNA processing Smf protein [Staphylococcus aureus A6224] gi|257863184|gb|EEV85948.1| DNA processing Smf protein [Staphylococcus aureus A5937] gi|282590594|gb|EFB95671.1| DNA processing protein [Staphylococcus aureus A10102] gi|294968773|gb|EFG44795.1| DNA processing protein [Staphylococcus aureus A8819] gi|297178443|gb|EFH37689.1| DNA processing protein [Staphylococcus aureus A8796] gi|312829643|emb|CBX34485.1| protein smf. domain protein [Staphylococcus aureus subsp. aureus ECT-R 2] gi|329727641|gb|EGG64097.1| putative DNA protecting protein DprA [Staphylococcus aureus subsp. aureus 21172] Length = 178 Score = 36.1 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 61 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 92 >gi|88194957|ref|YP_499757.1| hypothetical protein SAOUHSC_01221 [Staphylococcus aureus subsp. aureus NCTC 8325] gi|304381187|ref|ZP_07363840.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus ATCC BAA-39] gi|87202515|gb|ABD30325.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] gi|304340170|gb|EFM06111.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus ATCC BAA-39] Length = 246 Score = 36.1 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 129 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 160 >gi|269202865|ref|YP_003282134.1| DNA processing protein DprA, putative [Staphylococcus aureus subsp. aureus ED98] gi|296274807|ref|ZP_06857314.1| hypothetical protein SauraMR_00625 [Staphylococcus aureus subsp. aureus MR1] gi|262075155|gb|ACY11128.1| DNA processing protein DprA, putative [Staphylococcus aureus subsp. aureus ED98] Length = 246 Score = 36.1 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 129 LAFGHQTHYPKSTLALRNKI-EEKGLVISEYPP 160 >gi|315586326|gb|ADU40707.1| DNA protecting protein DprA [Helicobacter pylori 35A] Length = 266 Score = 36.1 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N ++EI G+ +SE Sbjct: 97 PCSLDFIYPTNNHKAIQEI-AQNGLILSEY 125 >gi|83956397|ref|ZP_00964821.1| SMF protein [Sulfitobacter sp. NAS-14.1] gi|83839391|gb|EAP78575.1| SMF protein [Sulfitobacter sp. NAS-14.1] Length = 203 Score = 36.1 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + L YP +N LLEEI +AIS+ P G Sbjct: 73 LGTPLSKAYPAKNAGLLEEI-KRNHLAISQFPEG 105 >gi|146278352|ref|YP_001168511.1| DNA protecting protein DprA [Rhodobacter sphaeroides ATCC 17025] gi|145556593|gb|ABP71206.1| DNA protecting protein DprA [Rhodobacter sphaeroides ATCC 17025] Length = 369 Score = 36.1 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L G ISE P G Sbjct: 175 AGGVDVIYPLENAA-LAGRIAAAGCRISEQPMG 206 >gi|284007833|emb|CBA73720.1| conserved hypothetical phage protein [Arsenophonus nasoniae] Length = 274 Score = 36.1 bits (84), Expect = 1.6, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + L YP +N L + I +N + IS++PF Sbjct: 153 IGTPLSHFYPKQNIELQQRIRENY-LLISQVPF 184 >gi|283954084|ref|ZP_06371609.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 414] gi|283794363|gb|EFC33107.1| DNA processing protein A [Campylobacter jejuni subsp. jejuni 414] Length = 257 Score = 36.1 bits (84), Expect = 1.7, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 A GL +YP N ++++I++N +A+SE Sbjct: 93 ANGLGQIYPKGNEKIIKQIYENA-LALSEY 121 >gi|320458226|dbj|BAJ68847.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis ATCC 15697] Length = 343 Score = 36.1 bits (84), Expect = 1.7, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ YP EN L + I G+ +S+ Sbjct: 201 IGTGITKRYPRENGTLQDRI-GRDGLVLSQF 230 >gi|213692109|ref|YP_002322695.1| SMF family protein [Bifidobacterium longum subsp. infantis ATCC 15697] gi|213523570|gb|ACJ52317.1| SMF family protein [Bifidobacterium longum subsp. infantis ATCC 15697] Length = 336 Score = 36.1 bits (84), Expect = 1.7, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+ YP EN L + I G+ +S+ Sbjct: 194 IGTGITKRYPRENGTLQDRI-GRDGLVLSQF 223 >gi|210633134|ref|ZP_03297701.1| hypothetical protein COLSTE_01614 [Collinsella stercoris DSM 13279] gi|210159288|gb|EEA90259.1| hypothetical protein COLSTE_01614 [Collinsella stercoris DSM 13279] Length = 309 Score = 36.1 bits (84), Expect = 1.7, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + G D +YP +R L++ D G A+S P+G Sbjct: 103 LGTGADVVYPATSRTLIDRAIDASGCALSIEPWG 136 >gi|116072662|ref|ZP_01469928.1| SMF protein [Synechococcus sp. BL107] gi|116064549|gb|EAU70309.1| SMF protein [Synechococcus sp. BL107] Length = 357 Score = 36.1 bits (84), Expect = 1.8, Method: Composition-based stats. Identities = 8/34 (23%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 + L+ +YP + L E G+ ++E+ G Sbjct: 175 LGTALERVYPRHHETLQSE-VSCKGLLLTELSSG 207 >gi|146298756|ref|YP_001193347.1| DNA protecting protein DprA [Flavobacterium johnsoniae UW101] gi|146153174|gb|ABQ04028.1| DNA protecting protein DprA [Flavobacterium johnsoniae UW101] Length = 366 Score = 36.1 bits (84), Expect = 1.9, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GL+ +YP ++ + G I+E Sbjct: 174 LAHGLNQVYPKTHKK-YMAKMEGNGGFITEF 203 >gi|167753798|ref|ZP_02425925.1| hypothetical protein ALIPUT_02083 [Alistipes putredinis DSM 17216] gi|167658423|gb|EDS02553.1| hypothetical protein ALIPUT_02083 [Alistipes putredinis DSM 17216] Length = 370 Score = 36.1 bits (84), Expect = 1.9, Method: Composition-based stats. Identities = 5/24 (20%), Positives = 15/24 (62%) Query: 8 LYPPENRNLLEEIWDNGGIAISEI 31 + P ++ + ++ ++GG +SE+ Sbjct: 181 ITPAQHTAVARDMIEHGGAVVSEL 204 >gi|157736496|ref|YP_001489179.1| SMF protein, DNA processing chain A [Arcobacter butzleri RM4018] gi|157698350|gb|ABV66510.1| SMF protein, DNA processing chain A [Arcobacter butzleri RM4018] Length = 258 Score = 35.7 bits (83), Expect = 1.9, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAIS 29 A GLD YP N+NL+ +I +N G+ +S Sbjct: 92 ANGLDIRYPSINKNLIIDI-ENNGLILS 118 >gi|329846721|ref|ZP_08261994.1| protein smf [Asticcacaulis biprosthecum C19] gi|328844228|gb|EGF93796.1| protein smf [Asticcacaulis biprosthecum C19] Length = 230 Score = 35.7 bits (83), Expect = 2.0, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + L YP EN L EEI N + IS+IP Sbjct: 108 IGTPLGQYYPKENMELQEEIATNH-LLISQIP 138 >gi|329770047|ref|ZP_08261442.1| hypothetical protein HMPREF0433_01206 [Gemella sanguinis M325] gi|328837358|gb|EGF86988.1| hypothetical protein HMPREF0433_01206 [Gemella sanguinis M325] Length = 296 Score = 35.7 bits (83), Expect = 2.0, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G + +YP ++R L +E + + ISE Sbjct: 179 IAHGHNIIYPEQSRYLYKE-LEKKYLIISEY 208 >gi|111115122|ref|YP_709740.1| smf protein [Borrelia afzelii PKo] gi|110890396|gb|ABH01564.1| smf protein [Borrelia afzelii PKo] Length = 315 Score = 35.7 bits (83), Expect = 2.0, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 169 IDNIYPKQNRKYVLKLLEQGGGIITE 194 >gi|282916509|ref|ZP_06324267.1| DNA processing protein [Staphylococcus aureus subsp. aureus D139] gi|282318996|gb|EFB49348.1| DNA processing protein [Staphylococcus aureus subsp. aureus D139] Length = 290 Score = 35.7 bits (83), Expect = 2.1, Method: Composition-based stats. Identities = 9/25 (36%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Query: 9 YPPENRNLLEEIWDNGGIAISEIPF 33 YP L +I + G+ ISE P Sbjct: 181 YPKSTLALRNKI-EEKGLVISEYPP 204 >gi|224437003|ref|ZP_03657984.1| DNA processing protein DprA [Helicobacter cinaedi CCUG 18818] gi|313143476|ref|ZP_07805669.1| DNA processing protein DprA [Helicobacter cinaedi CCUG 18818] gi|313128507|gb|EFR46124.1| DNA processing protein DprA [Helicobacter cinaedi CCUG 18818] Length = 261 Score = 35.7 bits (83), Expect = 2.1, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD YP N+ ++E++ ISE Sbjct: 97 PSSLDIYYPRSNKTMIEKMM-QECAVISEY 125 >gi|88807796|ref|ZP_01123307.1| SMF family protein [Synechococcus sp. WH 7805] gi|88787835|gb|EAR18991.1| SMF family protein [Synechococcus sp. WH 7805] Length = 333 Score = 35.7 bits (83), Expect = 2.2, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + L +YP ++R L + + +N G+ +E+ Sbjct: 146 LGTPLHRVYPHDHRGLQQSVAEN-GLLFTEL 175 >gi|88802025|ref|ZP_01117553.1| Smf protein DNA processing chain A [Polaribacter irgensii 23-P] gi|88782683|gb|EAR13860.1| Smf protein DNA processing chain A [Polaribacter irgensii 23-P] Length = 367 Score = 35.7 bits (83), Expect = 2.2, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G + +YP ++ ++++ +NGG +E Sbjct: 175 LAHGFEQIYPKVHKKYMQQVNENGGFL-TEF 204 >gi|219684549|ref|ZP_03539492.1| protein smf [Borrelia garinii PBr] gi|219671911|gb|EED28965.1| protein smf [Borrelia garinii PBr] Length = 315 Score = 35.7 bits (83), Expect = 2.3, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 169 IDNIYPRQNRKYVFKLLEQGGGIITE 194 >gi|150026465|ref|YP_001297291.1| protein Smf of unknown function [Flavobacterium psychrophilum JIP02/86] gi|149773006|emb|CAL44490.1| Protein Smf of unknown function [Flavobacterium psychrophilum JIP02/86] Length = 366 Score = 35.7 bits (83), Expect = 2.3, Method: Composition-based stats. Identities = 7/31 (22%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GL+ +YP ++ + G ++E Sbjct: 174 LAHGLNQIYPKVHKK-YMSKVEENGGFMTEF 203 >gi|209964829|ref|YP_002297744.1| DNA processing protein DprA, putative [Rhodospirillum centenum SW] gi|209958295|gb|ACI98931.1| DNA processing protein DprA, putative [Rhodospirillum centenum SW] Length = 381 Score = 35.3 bits (82), Expect = 2.6, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Query: 9 YPPENRNLLEEIWDNGGIAISEIPFG 34 YPPEN L ++ + G+ ++E P G Sbjct: 185 YPPENEGLHRDLAER-GLLLAESPLG 209 >gi|224531727|ref|ZP_03672359.1| protein smf [Borrelia valaisiana VS116] gi|224511192|gb|EEF81598.1| protein smf [Borrelia valaisiana VS116] Length = 315 Score = 35.3 bits (82), Expect = 2.7, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 169 IDNIYPKQNRKYVFKLLEQGGGIITE 194 >gi|219685645|ref|ZP_03540460.1| protein smf [Borrelia garinii Far04] gi|219672833|gb|EED29857.1| protein smf [Borrelia garinii Far04] Length = 314 Score = 35.3 bits (82), Expect = 2.7, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 168 IDNIYPKQNRKYVFKLLEQGGGIITE 193 >gi|224534372|ref|ZP_03674950.1| protein smf [Borrelia spielmanii A14S] gi|224514474|gb|EEF84790.1| protein smf [Borrelia spielmanii A14S] Length = 314 Score = 35.3 bits (82), Expect = 2.7, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 168 IDNIYPKQNRKYVFKLLEQGGGIITE 193 >gi|225552020|ref|ZP_03772960.1| protein smf [Borrelia sp. SV1] gi|225371018|gb|EEH00448.1| protein smf [Borrelia sp. SV1] Length = 314 Score = 35.3 bits (82), Expect = 2.7, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISE 30 +D +YP +NR + ++ + GG I+E Sbjct: 168 IDNIYPKQNRKYVFKLLEQGGGIITE 193 >gi|332686609|ref|YP_004456383.1| rossmann fold nucleotide-binding protein Smf [Melissococcus plutonius ATCC 35311] gi|332370618|dbj|BAK21574.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Melissococcus plutonius ATCC 35311] Length = 290 Score = 35.3 bits (82), Expect = 2.8, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + GLD YP ++ L ++ + + +SE P Sbjct: 172 IGNGLDYFYPKDSEWLQKK-LEKDQLILSEYP 202 >gi|325523313|gb|EGD01667.1| GntR family transcriptional regulator [Burkholderia sp. TJI49] Length = 170 Score = 35.3 bits (82), Expect = 2.9, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 4/30 (13%) Query: 8 LYPPENRNLLEEIWDNGGIAISE---IPFG 34 ++P +NR L ++I D G I E P G Sbjct: 3 IHPIQNRRLYQQIADKLGALI-ESGDFPPG 31 >gi|193214336|ref|YP_001995535.1| DNA protecting protein DprA [Chloroherpeton thalassium ATCC 35110] gi|193087813|gb|ACF13088.1| DNA protecting protein DprA [Chloroherpeton thalassium ATCC 35110] Length = 386 Score = 35.3 bits (82), Expect = 2.9, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Query: 1 MAGGLDCLY--PPENRNLLEEIWDNGGIAISE 30 +A G+D +Y P + I +N G +SE Sbjct: 189 LACGVDNIYTDPKG--KIYPAIIEN-GALLSE 217 >gi|148238859|ref|YP_001224246.1| Rossmann fold nucleotide-binding protein involved in DNA uptake [Synechococcus sp. WH 7803] gi|147847398|emb|CAK22949.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Synechococcus sp. WH 7803] Length = 368 Score = 35.3 bits (82), Expect = 3.0, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + L YP E+R L + + G+ +E+ Sbjct: 181 LGTPLHRAYPQEHRGLQMSVAET-GLLFTEL 210 >gi|83594524|ref|YP_428276.1| SMF protein [Rhodospirillum rubrum ATCC 11170] gi|83577438|gb|ABC23989.1| SMF protein [Rhodospirillum rubrum ATCC 11170] Length = 374 Score = 35.3 bits (82), Expect = 3.1, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Query: 9 YPPENRNLLEEIWDNGGIAISEIPFG 34 YPPEN L + G ISE G Sbjct: 181 YPPENDGLYRRLI-TEGAVISETAPG 205 >gi|213963472|ref|ZP_03391726.1| SMF family protein [Capnocytophaga sputigena Capno] gi|213953880|gb|EEB65208.1| SMF family protein [Capnocytophaga sputigena Capno] Length = 364 Score = 35.3 bits (82), Expect = 3.2, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIA 27 +A GL+ +YP + E + +NGG Sbjct: 173 LAHGLNLIYPATHAKYCEAMEENGGFI 199 >gi|224417736|ref|ZP_03655742.1| DNA processing protein DprA [Helicobacter canadensis MIT 98-5491] gi|253827080|ref|ZP_04869965.1| DNA processing protein DprA [Helicobacter canadensis MIT 98-5491] gi|313141278|ref|ZP_07803471.1| DNA processing protein DprA [Helicobacter canadensis MIT 98-5491] gi|253510486|gb|EES89145.1| DNA processing protein DprA [Helicobacter canadensis MIT 98-5491] gi|313130309|gb|EFR47926.1| DNA processing protein DprA [Helicobacter canadensis MIT 98-5491] Length = 253 Score = 35.3 bits (82), Expect = 3.2, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 LD +YP N+ ++EI+ G+ +S+ Sbjct: 88 PSSLDIIYPKTNQKTIQEIY-QKGLILSQFSP 118 >gi|295131961|ref|YP_003582637.1| Smf family protein [Zunongwangia profunda SM-A87] gi|294979976|gb|ADF50441.1| Smf family protein [Zunongwangia profunda SM-A87] Length = 366 Score = 35.3 bits (82), Expect = 3.3, Method: Composition-based stats. Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGG 25 +A GLD +YP + ++++ NGG Sbjct: 174 LAHGLDQIYPKLHAKYVDDVLKNGG 198 >gi|152992041|ref|YP_001357762.1| DNA processing protein A [Sulfurovum sp. NBC37-1] gi|151423902|dbj|BAF71405.1| DNA processing protein A [Sulfurovum sp. NBC37-1] Length = 258 Score = 34.9 bits (81), Expect = 3.4, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 GLD YP + ++E I ++ G+ +S+ Sbjct: 92 GNGLDIRYPVVHAKMIEAI-ESNGLMLSQF 120 >gi|302332855|gb|ADL23048.1| DNA recombination-mediator protein [Staphylococcus aureus subsp. aureus JKD6159] Length = 290 Score = 34.9 bits (81), Expect = 3.4, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 173 LAFGHQTHYPKSTLALRNKI-EEIGLVISEYPP 204 >gi|291277336|ref|YP_003517108.1| putative DNA processing protein DprA [Helicobacter mustelae 12198] gi|290964530|emb|CBG40383.1| putative DNA processing chain A, DprA [Helicobacter mustelae 12198] Length = 257 Score = 34.9 bits (81), Expect = 3.5, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 LD +YP N+++++EI + +SE Sbjct: 94 PSSLDLIYPASNQHIIKEIAARA-LILSEY 122 >gi|315224924|ref|ZP_07866743.1| DNA protecting protein DprA [Capnocytophaga ochracea F0287] gi|314945037|gb|EFS97067.1| DNA protecting protein DprA [Capnocytophaga ochracea F0287] Length = 364 Score = 34.9 bits (81), Expect = 3.6, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIA 27 +A GL+ +YP + E + +NGG Sbjct: 173 LAHGLNTIYPAAHSKYCEAMEENGGFI 199 >gi|49483412|ref|YP_040636.1| SMF family protein [Staphylococcus aureus subsp. aureus MRSA252] gi|257425303|ref|ZP_05601728.1| SMF family protein [Staphylococcus aureus subsp. aureus 55/2053] gi|257427963|ref|ZP_05604361.1| SMF family protein [Staphylococcus aureus subsp. aureus 65-1322] gi|257430597|ref|ZP_05606979.1| SMF family protein [Staphylococcus aureus subsp. aureus 68-397] gi|257433357|ref|ZP_05609715.1| SMF family protein [Staphylococcus aureus subsp. aureus E1410] gi|257436199|ref|ZP_05612246.1| SMF family protein [Staphylococcus aureus subsp. aureus M876] gi|282903804|ref|ZP_06311692.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus C160] gi|282905567|ref|ZP_06313422.1| DNA processing protein [Staphylococcus aureus subsp. aureus Btn1260] gi|282908542|ref|ZP_06316372.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus WW2703/97] gi|282910821|ref|ZP_06318624.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus WBG10049] gi|282914026|ref|ZP_06321813.1| putative DNA processing protein DprA [Staphylococcus aureus subsp. aureus M899] gi|282918948|ref|ZP_06326683.1| SMF family protein [Staphylococcus aureus subsp. aureus C427] gi|282924071|ref|ZP_06331747.1| DNA processing protein [Staphylococcus aureus subsp. aureus C101] gi|283957992|ref|ZP_06375443.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus A017934/97] gi|293501058|ref|ZP_06666909.1| DNA processing protein [Staphylococcus aureus subsp. aureus 58-424] gi|293510020|ref|ZP_06668728.1| DNA processing protein [Staphylococcus aureus subsp. aureus M809] gi|293526606|ref|ZP_06671291.1| putative DNA processing protein DprA [Staphylococcus aureus subsp. aureus M1015] gi|297591306|ref|ZP_06949944.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus MN8] gi|49241541|emb|CAG40227.1| SMF family protein [Staphylococcus aureus subsp. aureus MRSA252] gi|257271760|gb|EEV03898.1| SMF family protein [Staphylococcus aureus subsp. aureus 55/2053] gi|257274804|gb|EEV06291.1| SMF family protein [Staphylococcus aureus subsp. aureus 65-1322] gi|257278725|gb|EEV09344.1| SMF family protein [Staphylococcus aureus subsp. aureus 68-397] gi|257281450|gb|EEV11587.1| SMF family protein [Staphylococcus aureus subsp. aureus E1410] gi|257284481|gb|EEV14601.1| SMF family protein [Staphylococcus aureus subsp. aureus M876] gi|282314043|gb|EFB44435.1| DNA processing protein [Staphylococcus aureus subsp. aureus C101] gi|282316758|gb|EFB47132.1| SMF family protein [Staphylococcus aureus subsp. aureus C427] gi|282322094|gb|EFB52418.1| putative DNA processing protein DprA [Staphylococcus aureus subsp. aureus M899] gi|282325426|gb|EFB55735.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus WBG10049] gi|282327604|gb|EFB57887.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus WW2703/97] gi|282330859|gb|EFB60373.1| DNA processing protein [Staphylococcus aureus subsp. aureus Btn1260] gi|282595422|gb|EFC00386.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus C160] gi|283790141|gb|EFC28958.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus A017934/97] gi|290920678|gb|EFD97741.1| putative DNA processing protein DprA [Staphylococcus aureus subsp. aureus M1015] gi|291096063|gb|EFE26324.1| DNA processing protein [Staphylococcus aureus subsp. aureus 58-424] gi|291466964|gb|EFF09482.1| DNA processing protein [Staphylococcus aureus subsp. aureus M809] gi|297576192|gb|EFH94908.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus MN8] gi|312438372|gb|ADQ77443.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus TCH60] gi|315194137|gb|EFU24530.1| SMF family protein [Staphylococcus aureus subsp. aureus CGS00] Length = 290 Score = 34.9 bits (81), Expect = 3.6, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 173 LAFGHQTHYPKSTLALRNKI-EEIGLVISEYPP 204 >gi|298207288|ref|YP_003715467.1| Smf protein DNA processing chain A [Croceibacter atlanticus HTCC2559] gi|83849924|gb|EAP87792.1| Smf protein DNA processing chain A [Croceibacter atlanticus HTCC2559] Length = 366 Score = 34.9 bits (81), Expect = 3.6, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIA 27 +A GL+ +YP + + +I DNGG Sbjct: 174 LAHGLNQIYPKVHSKYVSQIEDNGGFI 200 >gi|119953096|ref|YP_945305.1| Smf protein [Borrelia turicatae 91E135] gi|119861867|gb|AAX17635.1| Smf protein [Borrelia turicatae 91E135] Length = 314 Score = 34.9 bits (81), Expect = 3.7, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 +A +D +YP +NR + + +NGG ++E Sbjct: 165 IATDIDNIYPKQNRKYVACLLENGGGVLTE 194 >gi|325690460|gb|EGD32463.1| DNA protecting protein DprA [Streptococcus sanguinis SK115] Length = 332 Score = 34.9 bits (81), Expect = 3.7, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + L+ YP EN+ + EI + G+ +S+ Sbjct: 180 IGTHLNQYYPAENKEVQLEI-EKKGLVVSQFSP 211 >gi|223044257|ref|ZP_03614294.1| DNA protecting protein DprA [Staphylococcus capitis SK14] gi|222442407|gb|EEE48515.1| DNA protecting protein DprA [Staphylococcus capitis SK14] Length = 290 Score = 34.9 bits (81), Expect = 3.8, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G YP + E I + G+ ISE P Sbjct: 173 LGFGHSYHYPKSSLKTRENI-ERKGLVISEYPP 204 >gi|313159668|gb|EFR59025.1| DNA protecting protein DprA [Alistipes sp. HGB5] Length = 367 Score = 34.9 bits (81), Expect = 4.0, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 18/31 (58%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A L + P ++ + +I D+GG ++E+ Sbjct: 172 LANPLPEVTPAQHTAVARDILDHGGALVTEL 202 >gi|319762396|ref|YP_004126333.1| smf family protein [Alicycliphilus denitrificans BC] gi|317116957|gb|ADU99445.1| SMF family protein [Alicycliphilus denitrificans BC] Length = 298 Score = 34.9 bits (81), Expect = 4.1, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + + +YP EN L E I N + +S++P Sbjct: 171 IGTPISEVYPRENSELQEHIARNY-LLVSQVP 201 >gi|295427736|ref|ZP_06820368.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus EMRSA16] gi|295128094|gb|EFG57728.1| DNA protecting protein DprA [Staphylococcus aureus subsp. aureus EMRSA16] Length = 246 Score = 34.9 bits (81), Expect = 4.2, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G YP L +I + G+ ISE P Sbjct: 129 LAFGHQTHYPKSTLALRNKI-EEIGLVISEYPP 160 >gi|154148585|ref|YP_001405977.1| SMF family protein [Campylobacter hominis ATCC BAA-381] gi|153804594|gb|ABS51601.1| SMF family protein [Campylobacter hominis ATCC BAA-381] Length = 268 Score = 34.5 bits (80), Expect = 4.4, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Query: 2 AGGLDCLYPPENRNLLEEI--WDNGGIAISEI 31 A GLD +YP EN E+I + +AISE Sbjct: 94 ANGLDIIYPKENS---EQISKIYSDALAISEY 122 >gi|317057707|ref|YP_004106174.1| SMF family protein [Ruminococcus albus 7] gi|315449976|gb|ADU23540.1| SMF family protein [Ruminococcus albus 7] Length = 380 Score = 34.5 bits (80), Expect = 4.7, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Query: 9 YPPENRNLLEEIWDNGGIAISEIPFG 34 YP ++ E G+ ISE P G Sbjct: 178 YPKNAGDIKER-VAQSGLLISEYPPG 202 >gi|254426522|ref|ZP_05040237.1| SMF family [Synechococcus sp. PCC 7335] gi|254426611|ref|ZP_05040326.1| SMF family [Synechococcus sp. PCC 7335] gi|196187534|gb|EDX82501.1| SMF family [Synechococcus sp. PCC 7335] gi|196187623|gb|EDX82590.1| SMF family [Synechococcus sp. PCC 7335] Length = 293 Score = 34.5 bits (80), Expect = 4.7, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + L+ +YP EN L +I + ++++PF Sbjct: 172 IGTALNEVYPKENAELQRKISKEF-LLVTQVPF 203 >gi|291514827|emb|CBK64037.1| DNA protecting protein DprA [Alistipes shahii WAL 8301] Length = 366 Score = 34.5 bits (80), Expect = 5.1, Method: Composition-based stats. Identities = 5/22 (22%), Positives = 13/22 (59%) Query: 10 PPENRNLLEEIWDNGGIAISEI 31 P ++ ++ +I GG ++E+ Sbjct: 181 PAQHTDVARDILARGGALVTEL 202 >gi|257784505|ref|YP_003179722.1| SMF family protein [Atopobium parvulum DSM 20469] gi|257473012|gb|ACV51131.1| SMF family protein [Atopobium parvulum DSM 20469] Length = 291 Score = 34.5 bits (80), Expect = 5.2, Method: Composition-based stats. Identities = 9/28 (32%), Positives = 12/28 (42%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAIS 29 G D YP + +L E + G IS Sbjct: 99 GCGADVTYPTTSLDLFEAAREGKGAVIS 126 >gi|118474360|ref|YP_892283.1| SMF family protein [Campylobacter fetus subsp. fetus 82-40] gi|261885966|ref|ZP_06010005.1| SMF family protein [Campylobacter fetus subsp. venerealis str. Azul-94] gi|118413586|gb|ABK82006.1| SMF family protein [Campylobacter fetus subsp. fetus 82-40] Length = 255 Score = 34.5 bits (80), Expect = 5.2, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GL+ +YP +N ++E+I+ + +A+SE Sbjct: 89 GNGLNNIYPAQNSKMIEKIYKDA-LALSEYEP 119 >gi|78189408|ref|YP_379746.1| SMF protein [Chlorobium chlorochromatii CaD3] gi|78171607|gb|ABB28703.1| SMF protein [Chlorobium chlorochromatii CaD3] Length = 385 Score = 34.5 bits (80), Expect = 5.3, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 5/32 (15%) Query: 1 MAGGLDCLY--PPENRNLLEEIWDNGGIAISE 30 +A G+D +Y P L +I ++ G +SE Sbjct: 179 LASGIDTIYTDPKG--LLWPKILEH-GAIVSE 207 >gi|241896011|ref|ZP_04783307.1| DNA protecting protein DprA [Weissella paramesenteroides ATCC 33313] gi|241870742|gb|EER74493.1| DNA protecting protein DprA [Weissella paramesenteroides ATCC 33313] Length = 288 Score = 34.2 bits (79), Expect = 5.8, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G D YP +L I G+ +SE Sbjct: 169 IGTGFDYAYPKHCEDLQNTI-SQLGLLLSEY 198 >gi|221194723|ref|ZP_03567780.1| putative DNA processing protein DprA [Atopobium rimae ATCC 49626] gi|221185627|gb|EEE18017.1| putative DNA processing protein DprA [Atopobium rimae ATCC 49626] Length = 299 Score = 34.2 bits (79), Expect = 6.3, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 13/31 (41%), Gaps = 5/31 (16%) Query: 1 MAGGLDCLYPPENRNLLEEIWD--NGGIAIS 29 + G D +YP + L I G+ +S Sbjct: 99 LGCGADVIYPRSSEPL---ILAAQEQGVVLS 126 >gi|78187620|ref|YP_375663.1| SMF protein [Chlorobium luteolum DSM 273] gi|78167522|gb|ABB24620.1| SMF protein [Chlorobium luteolum DSM 273] Length = 286 Score = 33.8 bits (78), Expect = 8.1, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Query: 1 MAGGLDCLY--PPENRNLLEEIWDNGGIAISE 30 +A G+D +Y P L +I + G ISE Sbjct: 160 LASGVDTVYTDPKG--RLWPKIVER-GALISE 188 >gi|308234477|ref|ZP_07665214.1| DNA protecting protein DprA [Atopobium vaginae DSM 15829] gi|328944070|ref|ZP_08241535.1| DNA protecting protein DprA [Atopobium vaginae DSM 15829] gi|327492039|gb|EGF23813.1| DNA protecting protein DprA [Atopobium vaginae DSM 15829] Length = 340 Score = 33.8 bits (78), Expect = 9.5, Method: Composition-based stats. Identities = 8/27 (29%), Positives = 14/27 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAI 28 G D +YP ++++ EE D G + Sbjct: 140 GCGADKVYPSSSKDIFEEAKDGRGCVV 166 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.312 0.246 1.01 Lambda K H 0.267 0.0751 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 854,901,149 Number of Sequences: 14124377 Number of extensions: 40618693 Number of successful extensions: 92935 Number of sequences better than 10.0: 2284 Number of HSP's better than 10.0 without gapping: 1991 Number of HSP's successfully gapped in prelim test: 293 Number of HSP's that attempted gapping in prelim test: 89688 Number of HSP's gapped (non-prelim): 2314 length of query: 34 length of database: 4,842,793,630 effective HSP length: 8 effective length of query: 26 effective length of database: 4,729,798,614 effective search space: 122974763964 effective search space used: 122974763964 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (20.5 bits) S2: 78 (33.8 bits)