RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780304|ref|YP_003064717.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] (34 letters) >gnl|CDD|129815 TIGR00732, dprA, DNA protecting protein DprA. Disruption of this gene in both Haemophilus influenzae and Helicobacter pylori drastically reduces the efficiency of transformation with exogenous DNA, but with different levels of effect on chromosomal (linear) and plasmid (circular) DNA. This difference suggests the DprA is not active in recombination, and it has been shown not to affect DNA binding, leaving the intermediate step in natural transformation, DNA processing. In Strep. pneumoniae, inactivation of dprA had no effect on the uptake of DNA. All of these data indicated that DprA is required at a later stage in transformation. Subsequently DprA and RecA were both shown in S. pneumoniae to be required to protect incoming ssDNA from immediate degradation. Role of DprA in non-transformable species is not known. The gene symbol smf was assigned in E. coli, but without assignment of function. Length = 220 Score = 36.9 bits (86), Expect = 0.001 Identities = 14/32 (43%), Positives = 21/32 (65%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + GLD +YP +N L +I +NGG+ +SE P Sbjct: 104 LGTGLDQIYPRQNSKLAAKIAENGGLLLSEYP 135 >gnl|CDD|182686 PRK10736, PRK10736, hypothetical protein; Provisional. Length = 374 Score = 30.7 bits (70), Expect = 0.089 Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GL+ +YP + L E I + GG +SE P Sbjct: 170 GLENIYPRRHARLAESIIEQGGALVSEFPL 199 >gnl|CDD|128765 smart00489, DEXDc3, DEAD-like helicases superfamily. Length = 289 Score = 25.4 bits (56), Expect = 3.7 Identities = 10/27 (37%), Positives = 12/27 (44%), Gaps = 3/27 (11%) Query: 11 PENRNLLEEIW---DNGGIAISEIPFG 34 P +EE+ D G I I E P G Sbjct: 11 PIQYEFMEELKRVLDRGKIGILESPTG 37 >gnl|CDD|128764 smart00488, DEXDc2, DEAD-like helicases superfamily. Length = 289 Score = 25.4 bits (56), Expect = 3.7 Identities = 10/27 (37%), Positives = 12/27 (44%), Gaps = 3/27 (11%) Query: 11 PENRNLLEEIW---DNGGIAISEIPFG 34 P +EE+ D G I I E P G Sbjct: 11 PIQYEFMEELKRVLDRGKIGILESPTG 37 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.147 0.481 Gapped Lambda K H 0.267 0.0608 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 606,114 Number of extensions: 17305 Number of successful extensions: 54 Number of sequences better than 10.0: 1 Number of HSP's gapped: 54 Number of HSP's successfully gapped: 7 Length of query: 34 Length of database: 5,994,473 Length adjustment: 8 Effective length of query: 26 Effective length of database: 5,821,609 Effective search space: 151361834 Effective search space used: 151361834 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.3 bits)