BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780304|ref|YP_003064717.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] (34 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780304|ref|YP_003064717.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] Length = 34 Score = 71.6 bits (174), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 34/34 (100%), Positives = 34/34 (100%) Query: 1 [protein fragment, 34 aa] 34 [protein fragment, 34 aa] Sbjct: 1 [protein fragment, 34 aa] 34 >gi|254780978|ref|YP_003065391.1| aspartyl/glutamyl-tRNA amidotransferase subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Score = 23.1 bits (48), Expect = 0.94, Method: Composition-based stats. Identities = 7/27 (25%), Positives = 15/27 (55%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISEI 31 LD P + +++WDNG + + ++ Sbjct: 96 LDGFRPHYESTVTQKLWDNGAVMLGKL 122 >gi|254780655|ref|YP_003065068.1| transketolase [Candidatus Liberibacter asiaticus str. psy62] Length = 673 Score = 20.4 bits (41), Expect = 6.7, Method: Composition-based stats. Identities = 6/9 (66%), Positives = 8/9 (88%) Query: 20 IWDNGGIAI 28 +WDN GI+I Sbjct: 194 LWDNNGISI 202 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.147 0.481 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,841 Number of Sequences: 1233 Number of extensions: 483 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 34 length of database: 328,796 effective HSP length: 8 effective length of query: 26 effective length of database: 318,932 effective search space: 8292232 effective search space used: 8292232 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)