HHsearch alignment of GI: 254780305 and MMDB domain: 2g7u_A_1-75

>2g7u_A (A:1-75) Transcriptional regulator; ICLR family, structural genomics, MCSG, PSI, protein structure initiative, midwest center for structural genomics; 2.30A {Rhodococcus SP}
Probab=96.42  E-value=0.0029  Score=37.58  Aligned_cols=50  Identities=20%  Similarity=0.284  Sum_probs=43.7

Q ss_pred             HHHHHHCCC--CCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             999985889--889999999829999999999999999417986479868981
Q gi|254780305|r   38 RIKQSLNNV--PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT   88 (95)
Q Consensus        38 ~Il~~L~~~--p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~   88 (95)
                      +||+++...  |..+-+|++.+|++.+.++..|-.||-.|+|.+-.|+| ++.
T Consensus        18 ~iL~~l~~~~~~~t~~eia~~~glp~stv~Rll~tL~~~g~l~~~~g~Y-~lG   69 (75)
T 2g7u_A           18 AVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYVAGSGGRW-SLT   69 (75)
T ss_dssp             HHHHTCSSSCSSCBHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEETTEE-EEC
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCCE-EEC
T ss_conf             9999997379998999999997919999999999999799699428743-403