HHsearch results for GI: 254780305 and protein with PDBid: 2rdp_A

>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix DNA binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus}
Probab=91.19  E-value=0.17  Score=27.18  Aligned_cols=54  Identities=6%  Similarity=-0.012  Sum_probs=46.7

Q ss_pred             CCCCCHHHHHHHHHHC-CCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             8799989999999858-89889999999829999999999999999417986479
Q gi|254780305|r   29 PEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE   82 (95)
Q Consensus        29 p~~~~~~~~~Il~~L~-~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pG   82 (95)
                      .-..+..+-.||..|. ..++.+.+|+++.+++.+.++.++-.||=+|+|.+...
T Consensus        37 ~~~lt~~q~~vL~~l~~~~~~t~~~La~~l~~~~~~vs~~l~~L~~~Gli~r~~~   91 (150)
T 2rdp_A           37 NYPITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRD   91 (150)
T ss_dssp             TSSSCHHHHHHHHHHHHHCSBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEEEC
T ss_pred             HCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             7797999999999999779959999999989688789999999971897798521